
Sample records for ac con electrodos

  1. Soldabilidad de un acero de blindaje con electrodos de acero inoxidable austenitico




    Se evaluaron las propiedades mecánicas y la microestructura de las soldaduras obtenidas con diferentes electrodos para unir platinas de un acero, templado y revenido, de alta dureza y baja aleación producido bajo la especificación MIL A46100, el cual es usado en la fabricación de estructuras blindadas. Se determinó el efecto que tiene el material de aporte (aceros inoxidables austeníticos, E307 y E308Mo, y dúplex, E312 y Eutectic 680),aplicado con proceso de soldadura al arco con electr...

  2. Comportamiento del tiempo de duración, la frecuencia de los cortocircuitos y la conductividad eléctrica durante el reencendido del arco en la soldadura SMAW (AC con electrodos E6013 Behavior of short-circuit frequency and duration time and electrical conductivity on arc turn- on during SMAW (AC with E6013 electrodes

    Directory of Open Access Journals (Sweden)

    Alejandro García Rodríguez


    Full Text Available El presente trabajo tiene como objetivo la evaluación del comportamiento del tiempo de duración, la frecuencia de los cortocircuitos y la conductividad durante el reencendido del arco en el proceso de soldadura SMAW (Shielded Metal Arc Welding, con corriente alterna y electrodos E6013. El análisis estadístico no-paramétrico garantiza un procesamiento robusto de los datos, atenuando la influencia de valores atípicos y errores derivados del empleo de aproximaciones a distribuciones continuas conocidas. La mediana y la mediana de la desviación absoluta (MAD, respecto a la mediana de los datos, constituyen los estimadores de localización y dispersión utilizados, respectivamente. El electrodo, en el régimen de 160 A, presenta una mayor estabilidad, en el aporte metálico, dada por el menor valor del MAD promedio del período de cortocircuito (39,36 ms y de la duración del cortocircuito (1,43 ms, reafirmada con la presencia de una mayor conductividad eléctrica durante el reencendido (1766,17x10-3 S·s-1.The objective of this work is the valuation of the behavior of short-circuits frequency and duration time and electrical conductivity on arc reigniting in SMAW (Shielded Metal Arc Welding process with alternate current and E6013 electrodes. The non parametric statistic analysis realize a robust data processing, minimizing the outliers influence and mistakes derivates about employ of approximations to well know continues distributions. The median and the median absolute deviation (MAD respect to median of the data are the localization and dispersion estimators used, respectively. The electrode at 160 A present a better stability on metal transference supported on the most little value of MAD for the period of transference (39,36 ms, and the MAD of the short-circuit duration (1,43 ms, according with the presence of a major electric conductivity during the arc reigniting (1766,17x10-3 S·s-1.

  3. Levantamiento del mapa de modo de transferencia para el electrodo ER100S1 aplicado con proceso de soldadura GMAW


    Arias Rendón, María Isabel


    Resumen: Durante este trabajo se estableció una metodología para caracterizar los modos de transferencia para el par metal de aporte/gas en un proceso de soldadura GMAW y poder generar un cuadro de relación entre los parámetros eléctricos fundamentales: corriente y voltaje del arco. Este cuadro se denominó como mapa de modo de transferencia para un electrodo aplicado con proceso de soldadura por arco eléctrico con protección gaseosa (Gas Metal Arc Welding – GMAW). La metodología desarrollada ...

  4. Aplicación de técnicas voltamperométricas con electrodos serigrafiados a la especiación de metales pesados en muestras naturales


    Sosa Gómez, Velia Ruth


    El principal objetivo de esta Tesis es el estudio de la viabilidad analítica de nuevos dispositivos electródicos como son los electrodos serigrafiados modificados con bismuto o antimonio como materiales alternativos al mercurio en la determinación y especiación de metales pesados mediante técnicas voltamperométricas. La tecnología del serigrafiado permite la fabricación de dispositivos económicos y desechables de sistemas electródicos como alternativa a los electrodos clásicos que se pue...

  5. Influencia de los parámetros de corte con electrodo en las características de la zona de influencia térmica (ZIT). // Influence of cutting electrode parameters in the termic zone characteristics.


    R. Batista Sánchez; R. Collazo Carceller; Fraga, E.; C. Figueroa Hernández


    El presente trabajo trata sobre las características microestructurales de la zona de influencia térmica con el uso del electrodoBISECOR, así como el régimen óptimo de trabajo.Palabras claves: Características microestructurales, zona de influencia térmica, electrodos , régimen detrabajo.__________________________________________________________________________________AbstractThe present paper deals with microestructural characteristics in the termic influence zone by means of the BISECORelectr...

  6. Energía de ionización simple en la soldadura con electrodo revestido Simple ionization energy in coated electrode welding


    Alejandro García Rodríguez


    El objetivo del presente trabajo es presentar, a la comunidad científica internacional, la concepción de un método de estimación de la energía de ionización simple, indispensable para el establecimiento del plasma térmico necesario para realizar el proceso de soldadura con electrodo revestido. A partir de la síntesis y el análisis de resultados teóricos y experimentales establecidos en la literatura especializada, fue deducido un método de estimación de la energía invertida en el proceso de i...

  7. Alternativa de doble recubrimiento para electrodo destinado al proceso de relleno manual con arco eléctrico//Alternative of double coating for electrode dedicated to the manual metal arc filler process

    Directory of Open Access Journals (Sweden)

    Odonel González‐Cabrera


    Full Text Available El objetivo del presente trabajo fue establecer diferencias entre el comportamiento de electrodosobtenidos con recubrimiento monocapa y bicapa para el proceso de relleno manual. La relación entrelos materiales de los recubrimientos se estableció en 70 % de materiales no metálicos y 30 % decarga de aleación para cada tipo de electrodo. Para cumplimentar el objetivo fueron evaluados los procedimientos de fabricación por inmersión y extrusión, conjuntamente con la posición relativa delos constituyentes de los recubrimientos sobre el alma y su influencia en las propiedades eléctricas y operativas de los electrodos. Como resultado se obtuvo que el electrodo con recubrimiento bicapa consume un 4,8 % menos de potencia durante la soldadura que el electrodo de recubrimiento monocapa (más económico, pero con mayor cantidad, 27 %, de metal aportado por unidad detiempo (mayor rendimiento, depositando cordones ligeramente menos altos (19,9 %, pero más profundos (46,5 %.Palabras claves: electrodos con doble recubrimiento, electrodos doblemente revestidos, relleno superficial._______________________________________________________________________________AbstractThe object of the present paper was to establish differences among one and twin coating electrodes dedicated to the manual filler process. The resulting relationship among the coating materials are established in 70 % of non-metallic compound and 30 % of alloy for each electrode type. For execute the work objective, two conventional procedures (immersion and extrusion for manufacturingelectrodes, as well as the influence of coating placement on the electrodes operational properties was evaluated. As result of experiment was obtained a twin coated electrode whish consume a 4,8 % lessthan power during the welding that one layer electrode (more economic, but with bigger quantity (27 % of metal contributed by unit of time (bigger yield, less height of reinforcement (19,9 % and greater depth of

  8. Materiales híbridos basados en nanocarbones y polioxometalatos para aplicación como electrodos en supercondensadores con mecanismo dual de almacenamiento de energía


    Suárez Guevara, Jullieth Gabriela


    Baterías y supercondensadores son dos tipos de dispositivos de almacenamiento de energía con mecanismos y prestaciones complementarios. Las baterías, con mecanismos de reacciones redox faradaicas presentan alta densidad de energía y baja densidad de potencia mientras que el mecanismo electrostático de los supercondensadores (doble capa eléctrica) les confiere una alta densidad de potencia con densidad de energía limitada. El diseño de materiales y electrodos híbridos que combin...

  9. Estudio de la reacción de reducción electroquímica de CO2 sobre electrodos sólidos modificados con Poli-(3,4-etilendioxitiofeno) (PEDOT) Poli-(3,4-etilendioxitiofeno) (PEDOT)


    Molina Osorio, Andres Felipe


    En este trabajo se presentan los resultados del estudio de la reducción electroquímica de CO2 en medio acuoso, CH3CN y mezclas de CH3CN:H2O ricas en CH3CN, utilizando electrodos de Au y Au recubierto con poli-(3,4- etilendioxitiofeno) (PEDOT) y PEDOT-Óxido de Grafeno Reducido. Los estudios se llevaron a cabo por voltamperometría cíclica, electrólisis en condiciones galvanostáticas y potenciostáticas y técnicas cuantitativas como Cromatografía de Gases. Los resultados en el m...

  10. Diseño Mc. Lean‐Anderson aplicado para obtener recubrimientos de electrodos aleados con carbono, cromo y titanio//Mc. Lean‐Anderson design applied for recovered electrodes obtaining with carbon, chrome and titanium alloys


    Carlos René Gómez-Pérez; Ana Paula Perotti; Alejandro García-Rodríguez; José Antônio Esmerio-Mazzaferro; Arnaldo Rubén-Gonzalez; Ivan Guerra-Machado


    En el trabajo se estudia el comportamiento de electrodos recubiertos destinados al relleno superficial con el proceso de soldadura manual (SMAW, Shielded Metal Arc Welding). Para el diseño experimental se aplican un procedimiento de cálculo para el revestimiento y un plan de mezclas del tipo Mc. Lean-Anderson. En el diseño se conjuga una matriz compuesta por Calcita (26,73 %), Ferrosilicio (19,02 %),Ferromanganeso (16,58 %), Rutilo (26,69 %), Silicato de Potasio (11,70 %) y diferentes cargas ...

  11. Diseño Mc. Lean‐Anderson aplicado para obtener recubrimientos de electrodos aleados con carbono, cromo y titanio//Mc. Lean‐Anderson design applied for recovered electrodes obtaining with carbon, chrome and titanium alloys

    Directory of Open Access Journals (Sweden)

    Carlos René Gómez-Pérez


    Full Text Available En el trabajo se estudia el comportamiento de electrodos recubiertos destinados al relleno superficial con el proceso de soldadura manual (SMAW, Shielded Metal Arc Welding. Para el diseño experimental se aplican un procedimiento de cálculo para el revestimiento y un plan de mezclas del tipo Mc. Lean-Anderson. En el diseño se conjuga una matriz compuesta por Calcita (26,73 %, Ferrosilicio (19,02 %,Ferromanganeso (16,58 %, Rutilo (26,69 %, Silicato de Potasio (11,70 % y diferentes cargas de aleación conformadas por Grafito (2 ≤ X1 ≤ 10 %, Ferro Cromo (5 ≤ X2 ≤ 35 %, ferrotungsteno (5 ≤ X3 ≤ 10 % y matriz (60 ≤ X4 ≤ 80 %. En el trabajo se ofrecen criterios sobre la selección de los niveles límites a explorar durante el plan experimental, a partir de consideraciones sobre los materiales empleados, sus rangos y el procedimiento de fabricación de los electrodos.Palabras claves: electrodos recubiertos, recubrimientos de electrodos, smaw, diseño de experimentos, relleno superficial._______________________________________________________________________________AbstractIn the present work the behavior of recovered electrodes for superficial filler with Shielded Metal Arc Welding (SMAW process is study. For the experimental design a coating calculation procedure and a Mc. Lean- Anderson type experimental plan are used. On the experimental design a matrix, composed by Calcite (26,73 %, Ferrosilicio (19,02%, Ferromanganese (16,58%, Rutile (26,69%, Potassium Silicate (11,70 %, and a alloy, conformed by Graphite (2 ≤ X1 ≤ 10, Ferro Chromium (5 ≤ X2 ≤ 35 %, ferrotungsteno (5 ≤ X3 ≤ 10 % and matrix (60 ≤ X4 ≤ 80 % is conjugated. In the work some criteria on the selection of the levels limits to explore during the experimental plan are offer, starting from considerations on the materials employees, their ranges and the procedure of production of the electrodes.Key words: recovered electrodes, electrodes coating, smaw

  12. Propuesta para la recuperación de los machetes Zuazaga de los centrales azucareros con electrodos de acero al cromo.


    R. Collazo Carceller; H. López Salinas; A. Días Romero


    El trabajo resume el estudio y análisis desarrollado, para la presentación de una propuesta tecnológica de recuperación de los machetes Zuazaga, en nuestros centrales azucareros. Se determinó la influencia de los parámetros, energía introducida (Hi), número de capas (Nc) y ancho del depósito (Ad), en la morfología y el incremento de la resistencia al desgaste abrasivo, utilizando el electrodo de acero al cromo DUR 600. Se realizó una valoración económica de la propuesta tecnológicaThis work, ...

  13. Bifunctional electrodes with ir and Ru oxide mixtures and pt for unified regenerative cells; Electrodos bifuncionales basados en mezclas de oxidos de Ir y Ru con Pt para celdas regenerativas unificadas

    Energy Technology Data Exchange (ETDEWEB)

    Duron-Torres, S.M.; Escalante-Garcia, I.L. [Universidad Autonoma de Zacatecas, Zacatecas (Mexico); Cruz, J. C.; Arriaga-Hurtado; L.G. [Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Pedro Escobedo, Queretaro (Mexico)]. E-mail:


    reaccion de evolucion de oxigeno (OER) en el PEMWE son las etapas limitantes de las URFC segun sea el modo de operacion. La obtencion de electrocatalizadores bifuncionales que se desempenen de manera satisfactoria en ambas reacciones del oxigeno y que soporten las diferentes condiciones de trabajo encontradas en una celda de combustible y un electrolizador, es el enfoque principal de las investigaciones relacionadas con las URFC. El presente trabajo es una contribucion a la investigacion de electrocatalizadores bifuncionales y muestra algunos resultados preliminares del estudio electroquimico de diferentes mezclas de Pt gcc, IrO{sub 2} y RuO{sub 2} soportadas en Ebonex® como electrodos de oxigeno. La caracterizacion electroquimica por voltamperometria ciclica (CV), Voltamperometria lineal (LV) y Espectroscopia de Impedancia electroquimica (EIS) en H{sub 2}SO{sub 4} 0.5 M, en ausencia y presencia de oxigeno revela que los electrodos bifuncionales IrO{sub 2}-Pt y RuO{sub 2}-Pt soportados en Ebonex® presentan propiedades electrocataliticas razonables para las reacciones de evolucion y reduccion de oxigeno y presentan posibilidad para su uso en una URFC. Los electrodos basados en el oxido de Ir muestran una mayor estabilidad que los correspondientes electrodos basados en oxido de rutenio.

  14. Propuesta para la recuperación de los machetes Zuazaga de los centrales azucareros con electrodos de acero al cromo.

    Directory of Open Access Journals (Sweden)

    R. Collazo Carceller


    Full Text Available El trabajo resume el estudio y análisis desarrollado, para la presentación de una propuesta tecnológica de recuperación de los machetes Zuazaga, en nuestros centrales azucareros. Se determinó la influencia de los parámetros, energía introducida (Hi, número de capas (Nc y ancho del depósito (Ad, en la morfología y el incremento de la resistencia al desgaste abrasivo, utilizando el electrodo de acero al cromo DUR 600. Se realizó una valoración económica de la propuesta tecnológicaThis work, sumarises the study and the analisys developed, to prupose the Zuazaga cut cane thecnology recuperation, in aur sugar mills. The parameters influency was determinated, Heat input (Hi, Number of layers (Nc and the Cord whith (Ad, in the mofology and the abrasive wear resistance increase, using the cromiun steel UTP DUR - 600. The economical calculation of the thecnology was done.

  15. Estudio de la reacción de reducción de oxígeno sobre electrodos mono cristalinos de platino modificados con películas delgadas de polianilina


    Silva Olaya, Alex Ricardo


    Se sintetizaron películas de polianilina por voltamperometría cíclica y por cronopotenciometría sobre electrodos de platino de bajo índice de Miller. Las propiedades de estas películas se analizaron mediante voltamperometría cíclica, voltamperometría de onda cuadrada y cronoamperometría. Se observó que las propiedades de estas películas difieren dependiendo del electrodo cristalino de Pt que se use para su electro síntesis, lo que evidencia que la superficie funciona como una plantilla para l...

  16. Resultados de ensayos de soldadura a tope y por solape, con electrodo, de barras de aceros estirados en frío

    Directory of Open Access Journals (Sweden)

    Calavera Ruiz, José


    Full Text Available The authors report on a series of tests carried out in the welding of reinforced concrete bars. The tested bars were cold drawn, with elastic limits of 4,200 and 5,000 kg/cm2. The tests included butt and overlap welding, involving excentric and axial overlaps, with joint reinforcements. Results of these experiments show that if the indicated method is adopted, including an average standard of workmanship, the weld attains 100 % of the bar strength.Los autores dan cuenta de una serie de ensayos realizados sobre soldadura de barras para hormigón armado. Las barras ensayadas son de acero estirado en frío con límites elásticos de 4.200 y 5.000 kp/cm2. Los ensayos abarcaron la soldadura a tope y la soldadura por solape, con sus variantes de solape excéntrico y solape centrado con cubrejuntas. Los resultados de los ensayos demuestran que siguiendo la técnica indicada, y con una calidad normal de ejecución, la soldadura presenta el 100 % de la resistencia de la barra.

  17. Microscale adaptation of the potentiometric method with ion-selective electrode for the quantification of fluoride; Adaptacion a microescala del metodo potenciometrico con electrodo ion selectivo para la cuantificacion de fluoruro

    Energy Technology Data Exchange (ETDEWEB)

    Guevara Ruiz, Paulina; Ortiz Perez, Maria Deogracias [Laboratorio de Bioquimica, Facultad de de Medicina, Universidad Autonoma de San Luis Potosi, San Luis Potosi, San Luis Potosi, (Mexico)]. E-mail:


    muestra necesarios, disminuya costo y substancias de desecho. Se valido el metodo potenciometrico establecido en la NMX-AA-077-SCFI-2001, asi como el metodo a microescala propuesto en este trabajo; posteriormente, se compararon ambos metodos mediante graficos y calculos estadisticos. Ademas se analizaron por ambos metodos 125 muestras de agua embotellada de venta en la ciudad de San Luis Potosi. Los datos de la validacion del metodo fueron optimos para su desempeno. Los resultados de la determinacion en las muestras de agua embotellada por ambos metodos, indican que la modificacion a microescala es estadisticamente comparable al metodo potenciometrico con electrodo ion selectivo. El metodo propuesto a microescala es apropiado para su utilizacion, con una reduccion de 95 % en costo y desechos generados.

  18. Comportamiento acústico de espacios cubiertos con estructuras textiles


    Maya Simoes, Flavio


    En el presente trabajo estudiamos el comportamiento acústico de espacios cubiertos con textiles. Presentamos una reseña histórica de usos de textiles en la arquitectura, de la prehistoria hasta hoy. Realizamos una búsqueda bibliográfica y presentamos los resultados encontrados. Presentamos la metodología actual de análisis acústico que se utiliza en ensayos de laboratorio, simulaciones y mediciones. Estudiamos la absorción sonora de los materiales de las cubiertas textiles, en ensayos de labo...

  19. Propuesta para la recuperación de los machetes Zuazaga de los centrales azucareros con electrodos de acero al cromo. // Proposal for Recuperation of Sugar Mill Cut Cane by Using Chromium Steel Electrodes.


    R. Collazo-Carceller; H López-Salinas; A. Días-Romero.


    El trabajo resume el estudio y análisis desarrollado, para la presentación de una propuestatecnológica de recuperación de los machetes Zuazaga, en nuestros centrales azucareros. Sedeterminó la influencia de los parámetros, energía introducida (Hi), número de capas (Nc) y anchodel depósito (Ad), en la morfología y el incremento de la resistencia al desgaste abrasivo, utilizandoel electrodo de acero al cromo DUR 600. Se realizó una valoración económica de la propuestatecnológica.Palabras claves...

  20. Modelado acústico de silenciadores con material absorbente




    Esta Tesis se centra en el desarrollo e implementación de métodos para el diseño y modelado acústico de silenciadores de motores de combustión interna, a través de herramientas basadas en soluciones analíticas y numéricas de la ecuación de ondas. La necesidad de técnicas de diseño que proporcionen rápida y eficazmente resultados precisos incluso a altas frecuencias ha aumentando con el tiempo, debido a que el ruido de los vehículos se ha convertido en una fuente importante de contaminación am...

  1. Propuesta para la recuperación de los machetes Zuazaga de los centrales azucareros con electrodos de acero al cromo. // Proposal for Recuperation of Sugar Mill Cut Cane by Using Chromium Steel Electrodes.

    Directory of Open Access Journals (Sweden)

    R. Collazo-Carceller


    Full Text Available El trabajo resume el estudio y análisis desarrollado, para la presentación de una propuestatecnológica de recuperación de los machetes Zuazaga, en nuestros centrales azucareros. Sedeterminó la influencia de los parámetros, energía introducida (Hi, número de capas (Nc y anchodel depósito (Ad, en la morfología y el incremento de la resistencia al desgaste abrasivo, utilizandoel electrodo de acero al cromo DUR 600. Se realizó una valoración económica de la propuestatecnológica.Palabras claves: morfología, desgaste abrasivo, parámetro de soldadura, dendrites._____________________________________________________________________________AbstractThis work, sumarises the study and the analisys developed, to prupose the Zuazaga cut canethecnology recuperation, in aur sugar mills. The parameters influency was determinated, Heatinput (Hi, Number of layers (Nc and the Cord whith (Ad, in the mofology and the abrasive wearresistance increase, using the cromiun steel UTP DUR - 600. The economical calculation of thethecnology was done.Key words: morphology abrasive wear, welding parameters. dendrites, modeling

  2. Elaboración y prueba de un electrodo para la cuantificación de cloruro de potasio y bromuro de potasio

    Directory of Open Access Journals (Sweden)

    José de Jesús Pérez-Saavedra


    Full Text Available Con la idea de mejorar el método potenciométrico para cuantificar cloruro de potasio y bromuro de potasio, se diseñó un electrodo combinado de plata como indicador y cobre/nitrato de cobre como referencia, donde los electrolitos del electrodo no interfieren en la cuantificación y al mismo tiempo se pueden disminuir los volúmenes por valorar (Arnaiz, 2005; Rincón y Pérez 2003, además de eliminar el puente de agar. A los resultados de los volúmenes de punto de equivalencia, con el montaje convencional y el electrodo elaborado, se les aplica la prueba estadística de t de Student con un 95% de confianza (Harris, 1991, dando como resultado que no hay diferencia significativa, con ese nivel de confianza, entre ambos métodos.

  3. Selección de Electrodos Basada en k-means para la Clasificación de Actividad Motora en EEG


    R. Lemuz-López; W. Gómez-López; I. Ayaquica-Martínez; C. Guillén-Galván


    Se presenta un algoritmo para la selección del grupo de electrodos relacionados con la imaginación de movimiento. El algoritmo utiliza la técnica de agrupamiento llamada kmeans para formar grupos de sensores y selecciona el grupo que corresponde a la actividad correlacionada más alta. Para evaluar la selección de electrodos, se calcula el indice de clasificación aplicando la descomposición proyectiva llamada patrones espaciales comunes y un discriminante lineal en una prueba de una sola época...

  4. Membranas poliméricas basadas en líquidos iónicos : aplicaciones en electrodos selectivos de iones y procesos de separación


    Martínez Rubio, Aurora


    El objetivo global de esta Tesis Doctoral fue la evaluación del uso de membranas poliméricas basadas en líquidos iónicos en el desarrollo de electrodos selectivos de iones y en procesos de separación de metales (Zn2+, Fe3+, Cu2+ y Cd2+) y compuestos orgánicos (α-pineno e ibuprofeno). Para alcanzar dicho objetivo se estudió, en primer lugar, la respuesta potenciométrica de un número de electrodos selectivos de iones basados en membranas poliméricas construidas con policloruro de vinilo (PVC) y...

  5. Procedimiento para diseñar una cámara acústica reverberante para ensayos auditivos con animales


    Cobo, Pedro; Varela-Nieto, Isabel; Murillo-Cuesta, Silvia; Cediel, Rafael


    Procedimiento para diseñar una cámara acústica reverberante para ensayos auditivos con animales. El objeto principal de la presente invención es procedimiento para diseñar una cámara acústica reverberante de dimensiones (L1, L2, L3) cuyo campo acústico sea homogéneo espacial y espectralmente; las operaciones del procedimiento son: elegir una de las dimensiones L3; obtener las funciones (valor medio del campo acústico) y (desviación cuadrática media del campo acústico);...

  6. Determinación de nitratos y amonio en muestras de suelo mediante el uso de electrodos selectivos


    Pulgarín, Gloria Arango


    Con el objetivo de evaluar un método alternativo para la cuantificación de diferentes formas de nitrógeno, se determinó la concentración de nitratos (NO3-) y amonio (NH4+) por dos métodos: Colorimetría y Electrodo de Ión Selectivo (EIS), en muestras de suelos cultivados con flores o banano en el departamento de Antioquia, Colombia. Se realizaron análisis de regresión y correlación para las concentraciones obtenidas por los dos métodos, que mostraron una asociación altamente significativ...

  7. Fabricación de electrodos para control de transporte y alineamiento a micro y nanoescalas usando técnicas bottom-up y top-down

    Directory of Open Access Journals (Sweden)

    Darwin Rodríguez


    Full Text Available El continuo avance de aplicaciones en dispositivos de autoensamble, posicionamiento, sensores, actuadores, y que permitan controladamente la manipulación de micro y nanoestructuras, han generado amplio interés en el desarrollo de metodologías que permitan optimizar la fabricación de dispositivos para el control y manipulación a micro y nanoescalas. Este proyecto explora técnicas de fabricación de electrodos con el fin de encontrar una técnica óptima y reproducible. Se compara el rendimiento de cada técnica y se describen protocolos de limpieza y seguridad. Se diseñan e implementan tres geometrías para movilizar y posicionar micro y nanopartículas de hierro en una solución de aceite natural. Finalmente se generan campos eléctricos a partir de electroforesis, con el fin de encontrar la curva que describe el desplazamiento de las partículas con respecto al potencial aplicado. Estos resultados generan gran impacto en los actuales esfuerzos de fabricación bottom-up (controlando con campos la ubicación y la movilidad en dispositivos electrónicos. El hecho de fabricar geometría planar con electrodos genera la posibilidad de que se pueda integrar movimiento de partículas a los circuitos integrados que se fabrican en la actualidad.

  8. Electrodo capacitivo de alta sensibilidad para la detección de biopotenciales eléctricos


    J.L. Varela-Benítez; J.O. Rivera-Delgado; J.H. Espina-Hernández; J. M. de la Rosa-Vázquez


    En este trabajo se presenta el diseño e implementación de un electrodo capacitivo de no contacto para la detección de biopotenciales en el cuerpo humano. Se presentan los circuitos eléctricos, el criterio de selección del amplificador operacional en base al análisis de la resistencia óptima de ruido, se describe el montaje físico, se presentan las señales obtenidas con este y la evaluación de su desempeño en base a la relación señal a ruido S/N. Se muestra el desempeño de diversos amplificado...


    Directory of Open Access Journals (Sweden)

    Gloria Arango Pulgarín


    Full Text Available Con el objetivo de evaluar un método alternativo para la cuantificación de diferentes formas de nitrógeno, se determinó la concentración de nitratos (NO3- y amonio (NH4+ por dos métodos: Colorimetría y Electrodo de Ión Selectivo (EIS, en muestras de suelos cultivados con flores o banano en el departamento de Antioquia, Colombia. Se realizaron análisis de regresión y correlación para las concentraciones obtenidas por los dos métodos, que mostraron una asociación altamente significativa entre ellos. La determinación de NO3- mediante la formación de complejo coloreado con brucina ácida o mediante el uso de un electrodo selectivo para nitratos presentó un coeficiente de determinación altamente significativo (R² = 99,2. En forma similar, la determinación de NH4+ basada en la formación de complejo coloreado azul de indofenol ó utilizando el electrodo para amoniaco presentó un valor de R² = 98,4. El uso de electrodos presenta ventajas en comparación con las técnicas colorimétricas, que requieren mucho más tiempo y equipos mas costosos.In order to evaluate an alternative method for quantifying different forms of nitrogen, the concentrations of nitrates (NO3- and ammonium (NH4 were determined by two methods: Colorimetry and Ion Selective Electrode (ISE, in soil samples from soils cultivated with flowers or banana in the department of Antioquia,Colombia. Regression and correlation analyses on the concentrations obtained from the two methods showed highly significant relationships among them. The determination of NO3- by means of colored complexes with brucine acid or by means of the use of an electrode selective for nitrates exhibited a highly significant coefficient of determination (R² = 99.2. In a similar way, determination of NH4 based on the formation of blue colored complexes of indophenol or employing the electrode for ammoniac yielded a value of R² = 98.4. The use of electrodes has advantages over the colorimetric

  10. Electrodos austeníticos inoxidables semisintéticos para la soldadura manual por arco eléctrico: Una variante económica para las pequeñas y medianas empresas (PIME. // Semi-synthetic austenitics stainless steel electrodes for shielded metal arc welding: A

    Directory of Open Access Journals (Sweden)

    A. Paz Iglesias


    Full Text Available En el presente trabajo se brinda una valoración económica para la producción de electrodos austeníticos inoxidables tiposE308L, E309, E312 y E316L en las pequeñas y medianas empresas (PIME. Lo significativo de la presente valoración esque se brindan los resultados obtenidos al fabricar los electrodos de forma semisintética; es decir, utilizando un solo tipo dealambre inoxidable (308L y añadiendo las ferroaleaciones necesarias en el revestimiento. Los resultados que se muestranestán basados en las experiencias de investigación, producción y comercialización de una planta con capacidad para 200toneladas al año, a la cual le es muy difícil insertarse en el mercado utilizando los mismos procedimientos tecnológicos yfinancieros de una gran empresa con grandes capitales y recursos.Palabras claves: Electrodos austeníticos inoxidables, electrodos sintéticos, ferroaleaciones, electrodossemisintéticos, electrodos convencionales, metal depositado.___________________________________________________________________Abstract.This paper offers an economic valuation for the production of stainless electrodes type E308L, E309, E312 and E316L,for small and middle companies (PIME. The significant part of the present valuation gives the results obtained in theproduction of semi-synthetic electrodes; using just one type of stainless wire (308L and adding the ferroalloys neededin the coat. The results shown are based on investigation experiences, production and trading of companies with acapacity for 200 T/year, so it is very difficult to enter in the market using the same technological procedures of a bigcompany with higher capital and financial resources.Key words: Nonrusting austenistic electrodes, sintetic electrodes, semisintetic electrodes, iron alloy,conventional electrodes, metal deposition.

  11. Posicionamento ectópico de eletrodo de marcapasso Posicionamiento ectópico de electrodo de marcapaso Ectopic positioning of pacemaker electrode

    Directory of Open Access Journals (Sweden)

    Gildo Mota


    Full Text Available Apresentamos o caso de um paciente portador da forma cardíaca da doença de Chagas com disfunção ventricular esquerda e bloqueio atrioventricular de 2º grau Mobitz II, associados a vários episódios de síncope. Foi submetido a implante de marcapasso artificial definitivo dupla câmara. Após um ano do implante foi diagnosticado deslocamento de eletrodo atrial, sendo submetido a reimplante de eletrodo atrial. Após dois anos do primeiro procedimento cirúrgico, apresentava dispneia aos grandes esforços. Durante a avaliação, foi solicitado ecocardiograma, que detectou a presença de corpo estranho de características metálicas em câmaras cardíacas esquerdas, consistente com eletrodo de marcapasso ectópico.Referimos el caso de un paciente portador de la forma cardíaca de la enfermedad de Chagas con disfunción ventricular izquierda y bloqueo atrioventricular de 2° grado Mobitz II, asociados a varios episodios de síncope. Fue sometido a implante de marcapaso artificial definitivo doble cámara. Tras un año del implante se diagnosticó desplazamiento de electrodo atrial, con la sumisión del paciente a reimplante de electrodo atrial. Tras dos años del primer procedimiento quirúrgico, presentaba disnea a los grandes esfuerzos. Durante la evaluación, se solicitó ecocardiograma, que detectó presencia de cuerpo extraño de características metálicas en cámaras cardíacas izquierdas, de acuerdo con electrodo de marcapaso ectópico.The present case reports on a patient presenting the cardiac form of Chagas disease, with left ventricular dysfunction and second-degree atrioventricular block Mobitz type II, associated with several syncope episodes. The patient underwent a double-chamber definitive artificial pacemaker implant. One year after the implant, the displacement of the atrial electrode was diagnosed and the patient was submitted to re-implantation of the atrial electrode. Two years after the first surgical procedure, the

  12. Estudio de la reducción del ruido aerodinámico de trenes de alta velocidad con pantallas acústicas


    Romero Ibáñez, Arturo


    RESUMEN: Las fuentes de ruido aerodinámico se localizan en toda la altura del tren. Esto hace que pantallas acústicas que fueron diseñadas para ruido de rodadura, producido en la zona baja del tren, no sean efectivas frente al ruido aerodinámico. Para el estudio del comportamiento de las pantallas acústicas se ha elegido el Método de Elementos de Contorno, Se ha desarrollado un programa en Visual Basic basado en él, verificándolo con métodos analíticos y semiempíricos. Se han obtenido conclus...

  13. Materiales híbridos moleculares orgánicos-inorgánicos: síntesis y aplicación como electrodos en baterías recargables de litio


    Torres-Gómez, G.; Lira-Cantú, Monica; Gómez-Romero, P.


    [ES] Se describe la síntesis y aplicación como electrodos para el almacenamiento o conversión de energía de materiales híbridos basados en la dispersión de especies inorgánicas electroactivas en el seno de polímeros orgánicos conductores. Polianilina y polipirrol son dopados con polioxometalatos electroactivos ([PMo12O40]3-) o aniones ferricianuro ([(FeCN)6]3-) como únicas especies dopantes. La elevada carga y tamaño de estos aniones evitan, en la mayoría de los casos, su desintercal...

  14. Aislamiento acústico a ruido aéreo en techos con materiales ecológicos


    Martínez de Adrianza, Ede Coromoto


    El incremento de la contaminación acústica se ha convertido en un problema medioambiental lo cual ha generado un aumento en la demanda del aislamiento de los edificios para lograr el confort acústico. Existen métodos de medición de aislamiento acústico a ruido aéreo de fachadas bajo ensayo “in situ” pero no para techos. El objetivo de esta investigación consiste en determinar el aislamiento acústico de prototipos de techos ecológicos multicapas adaptando la metodología recomendada por normas...

  15. Manejo de los electrodos de agujas en el laboratorio de EMG. Experiencia practica de enfermería.


    Padilla Puentes, E.; Gómez Fernández, L.; Sánchez Curuneaux, A.; Morales Chacón, L.; Peña, M. A.


    En la práctica, el personal de enfermería participa en el cuidado de los electrodos de agujas para los estudios electrofisiológicos, en especial de su esterilización y almacenamiento adecuado. Se debe de respetar la atención especial a la manipulación de los electrodos, la realización del lavado de manos, y al uso del material en buen estado. Estas prácticas repercuten positivamente en la calidad del servicio y benefician directamente al paciente. El objetivo de nuestro trabaj...

  16. Desarrollo y evaluación de electrodos y prototipos de baterías recargables


    Humana, Rita Mariángeles


    En el presente trabajo de tesis se propone como objetivos generales: el diseño, preparación y caracterización de nuevos materiales de electrodo para baterías de níquel-hidruro metálico, a partir de aleaciones formadoras de hidruro. Se pretende aumentar la capacidad de absorción de hidrógeno durante la carga y la actividad catalítica superficial para alcanzar altas velocidades de descarga. Posteriormente se compara el comportamiento en celda electroquímica respecto al funcionamiento en prototi...

  17. Ensayo de aislamiento acústico a ruido aéreo de los cerramientos exteriores y particiones realizados con paneles de madera

    Directory of Open Access Journals (Sweden)

    Pacios Álvarez, Antonia


    Full Text Available The house prototype of the Provisional Emergency House System uses wood and its derivatives for the facades, floor structure, roofing and partitions.  The extensive use of wooden panels for the construction and the lack of data, in Spain, about their acoustic behavior bring up the necessity to make in situ measurements of the acoustic isolation to airborne sound. Panels used for facades and partitions are built with a wooden framework and membrane of oriented strand board in both sides, for the facades, and of laminated plaster boards for the inner partitions. With the objective of verifying the sound insulation of the facades according to Spanish Standard UNE EN ISO 140-5, in situ measurements of airborne sound insulation of facade elements and facades have been made; according to Spanish Standard UNE EN ISO 140-4, in situ measurements of airborne sound insulation between rooms for internal walls have also been made. The procedure of the global insulation has been followed to measure the acoustic insulation of complete facades without making distinction between the elements that form it.El prototipo de vivienda del Sistema de Vivienda Provisional de Emergencia utiliza principalmente la madera y sus derivados tanto en los cerramientos y particiones como en el forjado y la cubierta. El empleo de soluciones constructivas ligeras y la falta de datos en España acerca del comportamiento acústico de los mismos plantea la necesidad de realizar mediciones in situ del aislamiento acústico a ruido aéreo. El panel base de cerramiento y particiones se construye partiendo de un entramado de montantes de madera con membrana en ambas caras de tableros de virutas de madera orientadas, para el caso de los cerramientos exteriores, y de tableros laminados de yeso para las particiones interiores. Con el objeto de comprobar el aislamiento acústico de dichos cerramiento se han realizado ensayos siguiendo la Norma UNE EN ISO 140-5 para la medición in situ del

  18. Evaluación de diferentes tipos de barnices en la protección de electrodos para la soldadura subacuática//Evaluation of different types of varnishs to protect underwater welding electrodes

    Directory of Open Access Journals (Sweden)

    Manuel Rodríguez-Pérez


    Full Text Available El artículo tiene como objetivo evaluar  las posibilidades de empleo de diferentes tipos de barnices como impermeabilizantes para los electrodos del tipo AWS E 6013, cuando se realiza la soldadura  en condiciones subacuática mojada. Los barnices evaluados son el Vinílico, Marítimo, base Poliuretano y una nueva variante base Isopor. Los métodos de evaluación incluye el comportamiento de la resistencia mecánica que le confiere al revestimiento a cada uno de los barnices, el agua adsorbida y el tipo de estructura en el cordón, utilizando microscopía óptica convencional. En este aspecto, la estructura en todos los cordones realizados con el electrodo E 6013, independientemente del impermeabilizante utilizado es similar, caracterizada por ferrita primaria o de contorno de grano y del tipo Widmanstätten, sin embargo, se determinó, que el impermeabilizante base Isopor, garantiza una mejor protección del electrodo en cuanto a la cantidad de agua adsorbida y adherencia del revestimiento.Palabras claves: soldadura subacuática, impermeabilizante, electrodos._______________________________________________________________________________The article aims to assess the potential use of different types of paints and waterproofing materials for the electrodes of type AWS E 6013, when performing underwater welding in wet conditions. The coatings evaluated are Vinyl, Maritime, polyurethane base and a new variant Isopor base. Evaluation methods include the behavior of the mechanical strength to the coating gives each of the varnishes, the adsorbed water and the type of structure in the welds, using conventional microscopy. In this sense, the structure in all the welds made with the electrode E 6013, regardless of waterproofed used is similar, characterized by primary or ferrite grain boundary and Widmanstätten type, however, it was determined that the base waterproofing Isopor, guarantees better protection of the electrode in terms of the amount of

  19. Implantación transarterial de un electrodo de marcapaso permanente en ventrículo izquierdo, como complicación rara de esta cirugía

    Directory of Open Access Journals (Sweden)

    Yirleydis Desdin Hernández


    Full Text Available Se  presenta el caso de una mujer de 48 años de edad, que recibió hace más de cuatro  años un implante de marcapaso permanente (MPP por bloqueo AV de 3er grado, y que desde los inicios de esta  cirugía ha estado muy sintomática, con cuadros de mareos recurrentes y un accidente cerebro vascular tromboembólico. En el EKG de 12 derivaciones se encontró un hallazgo que llamó la atención, se trataba de complejos electro estimulados con morfología de bloqueo de rama derecha (BRD, esto hizo sospechar de que al no tener una gran dilatación del ventrículo derecho se trataba entonces de una implantación inadecuada del electrodo en el ventrículo izquierdo. Una radiografía  de tórax PA a distancia tele y lateral izquierda, así como un estudio de ecocardiografía bidimensional, confirmó la implantación del electrodo en el VI vía arteria subclavia derecha. La paciente se trató con anticoagulación, dada su negativa de retirarlo quirúrgicamente,  y desde entonces ha estado asintomática por alrededor de un año y con una función del MPP normal. Este hecho refleja la necesidad de realizar EKG de 12 derivaciones posoperatorio a todos los casos de implante de MPP, dado lo fácil que resulta resolver esta complicación en esta etapa, convirtiéndose después de los seis meses en un serio problema de solución quirúrgica, generalmente.

  20. Efectos acústicos inmediatos de una secuencia de ejercicios vocales con tubos de resonancia Immediate effects of a vocal exercise sequence with resonance tubes

    Directory of Open Access Journals (Sweden)

    Marco Guzmán


    Full Text Available OBJETIVO: el propósito de este estudio es conocer el efecto acústico inmediato de una secuencia de ejercicios fonatorios utilizando tubos de resonancia en un grupo de sujetos disfónicos. MÉTODO: se aplicó una secuencia única de cuatro tareas fonatorias dentro de tubos de resonancia a veinticuatro profesores con voces disfónicas, evaluadas perceptualmente con la escala GRBAS. Las muestras de voz fueron grabadas antes y después de la secuencia de ejercicios. El análisis acústico incluyó Cepstrum, Jitter, Shimmer y relación armónico-ruido (NHR. Se solitó completar un protocolo de autovaloración vocal posterior a la secuencia de ejercicios para evaluar los efectos subjetivos. Se compararon los valores de los parámetros acústicos en las muestras pre y post entrenamiento. RESULTADOS: cambios significativos fueron obtenidos en el análisis Cepstral, Jitter y relación armónico-ruido. En la autovaloración, los efectos positivos predominaron sobre los negativos, siendo los principales: voz más estable, voz más clara y garganta más abierta. CONCLUSIÓN: el uso de tareas fonatorias dentro de tubos de resonancia puede tener un efecto fisiológico terapéutico inmediato en sujetos con voces disfónicas y una percepción subjetiva de mejoría en la producción de la voz posterior a la terapia.PURPOSE: the purpose of this study is to determine the immediately acoustic effect of phonatory exercise sequence using resonance tubes in a group of dysphonic subjects METHOD: a unique sequence of four phonatory tasks within resonance tubes was applied in twenty-four teachers with dysphonic voices, assessed perceptually with GRBAS scale. Voice samples were recorded before and after the exercise sequence. Acoustic analysis included the following items: Cepstrum, Jitter, Shimmer, noise-harmonic ratio (NHR. Subjects were asked to fill out a vocal self-assessment protocol after the exercise sequence in order to assess the subjective effects of these

  1. Modelacion y Visualizacion Tridimensional Interactiva de Variables Electricas en Celdas de Electro-Obtencion con Electrodos Bipolares

    CERN Document Server

    Labraña, César Mena; Silva, Lautaro Salazar


    The use of floating bipolar electrodes in electrowinning cells of copper constitutes a nonconventional technology that promises economic and operational impacts. This paper presents a computational tool for the simulation and analysis of such electrochemical cells. A new model is developed for floating electrodes and a method of finite difference is used to obtain the threedimensional distribution of the potential and the field of current density inside the cell. The analysis of the results is based on a technique for the interactive visualization of three-dimensional vectorial fields as lines of flow.

  2. Análisis de soldabilidad de aceros inoxidables con aceros de medio y bajo carbono por SMAW

    Directory of Open Access Journals (Sweden)

    José Luddey Marulanda Arevalo


    Full Text Available Se presenta un estudio de la soldabilidad de aceros inoxidables austeníticos AISI 304 y AISI 316 con aceros de bajo y medio carbono AISI 1020 – AISI 1045, empleando como materiales de aporte los electrodos EutecTrode® 52 NG, 54 NG y 57 NG, mediante el proceso de arco eléctrico con electrodo revestido (SMAW. Para analizar la soldabilidad de estos electrodos cuando se realiza la unión de aceros inoxidables con aceros al carbono, se practicaron pruebas metalográficas y ensayos mecánicos de dureza, doblez y tracción, con el fin de observar el comportamiento tanto de la zona afectada térmicamente como del cordón de soldadura, a partir del cambio en las propiedades mecánicas y metalúrgicas en las diferentes regiones de las uniones soldadas. Durante el proceso de soldadura se siguió una especificación del procedimiento de soldadura (WPS, para que los resultados fueran repetibles, minimizando los problemas de agrietamiento en caliente, agrietamiento en frío, formación de fase sigma y precipitación de carburos.

  3. Diseño de una instalación solar térmica con aplicaciones para acs y calefacción en un bloque de viviendas ubicado en Pontevedra


    Martínez Fontúrbel, Eduardo


    La realización del presente proyecto tenía como objetivo principal la de desarrollar una instalación solar para satisfacer la demanda de ACS y calefacción de la forma más eficiente posible teniendo en cuenta tanto la energía solar aprovechable del Sol y la viabilidad económica del proyecto. Además del diseño de la instalación se ha querido analizar de forma detallada los principales aspectos de funcionamiento de la instalación para buscar con ello la mejor respuesta posible ...

  4. El ambiente acústico de los hospitales de Madrid: metodología de análisis y diagnóstico con SIG


    Pedro Martínez Suárez; Antonio Moreno Jiménez


    La conveniencia de que ciertas actividades se desarrollen en un ambiente apropiado, particularmente en materia de ruido, se ha ido asentando racional y normativamente de manera inequívoca, debido a las repercusiones que tienen sobre el bienestar o salud humanas. La disponibilidad reciente de mejores datos sonoros sobre el ámbito urbano está abriendo la posibilidad de determinar las características acústicas de los entornos exteriores que envuelven a diversas instalaciones y equ...

  5. Incertidumbre de la medición de masa en la determinación de los parámetros de consumo de electrodos de recargue Measurement uncertainty of mass in the determination of the consumption parameters of hardfacing electrodes

    Directory of Open Access Journals (Sweden)

    Rosenda Valdés Arencibia


    Full Text Available Este trabajo presenta la evaluación de la incertidumbre de las mediciones realizadas para la determinación de los parámetros de consumo de electrodos de recargue, dando énfasis a la medición de masa. Para ello fueron realizados tres depósitos a tres niveles de corriente (120 A, 145 A y 160 A, respectivamente, registrándose el tiempo de soldadura, la longitud del cordón, así como la masa inicial y final de las probetas y de los electrodos. A partir de los datos anteriores fueron determinados los parámetros de consumo. Fue calculada la incertidumbre asociada a la masa de las probetas, a la masa consumida del electrodo, a la masa depositada y a los parámetros de consumo. Al finalizar el trabajo se comprobó que el rendimiento del depósito muestra un comportamiento decreciente con la corriente, siendo el mejor resultado de (74,12 % para una corriente de soldadura de 120 A. Los valores de incertidumbre expandida para el rendimiento varían entre 1,47 % y 2,41 %, para la tasa de consumo fueron obtenidos valores entre 0,4 g/min y 0,6 g/min, mientras que para la tasa de deposición la incertidumbre varía de 0,6 g/min a 0,7 g/min.This work presents the evaluation of the uncertainty of the measurements to determine the consumption parameters of hardfacing electrode, emphasizing the mass measurement. The experimentation was carried out obtaining deposits at three levels of current (120 A, 145 A y 160 A and measuring the time spent in welding, the length of the welds the test plate and electrode mass (initial and final. Based on these results, the consumption parameters were also determined. The uncertainty related to the measurements the mass of the samples, the mass consumption of the electrode, the deposited mass and consumption parameters was determined. The results showed that the deposition efficiency increase as a function of the current, turning the best result (74.12 % at 120 A. The expanded measurement uncertainty associated to

  6. Influencia del entorno acústico laboral en el comportamiento audiométrico y su correlación con el registro de otoemisiones acústicas de productos de distorsión


    Burgos Sánchez, Antonio Jesús


    El ruido puede ser considerado el contaminante físico con mayor presencia en el mundo laboral. La exposición continuada sin la protección adecuada, a niveles sonoros de elevada intensidad constituye ineludiblemente un riesgo potencial para la salud. El efecto nocivo del ruido en el medio laboral se traduce en una pérdida auditiva o hipoacusia que generalmente es progresiva e irreversible, y que estaría encuadrada dentro de la denominada pérdida auditiva inducida por ruido (PAIR). La evaluació...



    Vert Belenguer, Vicente Bernardo


    Las celdas de combustible de óxido sólido (cuyo acrónimo en inglés es SOFC) son dispositivos energéticos capaces de convertir la energía química de un combustible directamente en energía eléctrica. Esto las dota de unas eficiencias eléctricas muy elevadas, que pueden llegar a ser del 80% si se aprovecha su calor residual de alta calidad mediante turbinas. Además, son capaces de funcionar con una gran variedad de combustibles: hidrógeno, gas natural, gas de síntesis, etanol, metanol, etc. Sin ...

  8. Comportamiento electroquímico del ion Ag (I) sobre electrodo de Pt en Cloruro de 1-Butil-3 Metil-Imidazolio (BMIMCl) entre 343-363 K


    Sanz de Paz, Diego


    En este trabajo se investiga la reducción electroquímica sobre electrodo de Pt del ion Ag (I) disuelto en el líquido iónico Cloruro de 1-Butil-3-Metil-Imidazolio (BMIMCl), a temperaturas comprendidas entre 343 y 363 K, utilizando las técnicas de voltamperometría de onda cuadrada (SWV), voltamperometría cíclica (CV), voltamperometría convolutiva de potencial (CPSV), cronoamperometría (CA) y cronopotenciometría (CP). La reducción de Ag (I) a Ag (0) tiene lugar mediante un proceso reversible...

  9. Study for increasing the stabilization time of a catalytic dye to facilitate the fabrication of membrane electrode assemblies; Estudio para incrementar el tiempo de estabilizacion de una tinta catalitica para facilitar la fabricacion de ensambles membrana-electrodo

    Energy Technology Data Exchange (ETDEWEB)

    Flores Hernandez, J. Roberto [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)] e-mail:; Martinez Vado, F. Isaias [Facultad de Quimica, Universidad Nacional Autonoma de Mexico, Mexico D.F. (Mexico); Cano Castillo, Ulises, Albarran Sanchez, Lorena [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)


    An infrastructure project has been underway for hydrogen technology and fuel cells at the Electrical Research Institute (IIE, Spanish acronym). Part of this project is an activity for the fabrication of membrane electrode assemblies (MEA). Currently, a fabrication process is well-established for the MEA using the spray technique. In addition, a catalytic dye base composition has been developed for use in the fabrication of high-quality MEA with a good degree of reproducibility. Nevertheless, the instability of the dye over time prevents continuous fabrication of MEA. This document presents the results obtained, to-date, of research conducted at the IIE aimed at increasing the stability of the catalytic dye by adding a surfactant with different concentrations and increasing the concentration of the Nafion® solution. It was found that the effect of adding the surfactant to the catalytic dye results in a qualitative decrease in the agglomerate sizes, while also decreasing the porosity of the dye once it has dried. In addition, it was found that increasing the amount of Nafion® in the catalytic die increases the porosity. [Spanish] En el Instituto de Investigaciones Electricas (IIE) se ha venido trabajando en un proyecto de infraestructura sobre la tecnologia de hidrogeno y celdas de combustible. Dentro de este proyecto se tiene una actividad orientada a la fabricacion de Ensambles Membrana-Electrodo (MEA's). Actualmente se tiene un proceso de fabricacion bien establecido para la elaboracion de MEA's utilizando la tecnica de rociado, asimismo, se tiene una composicion base de tinta catalitica con la cual se fabrican MEA's de buena calidad y con buen grado de reproducibilidad. Sin embargo, la inestabilidad de la tinta con respecto al tiempo impide tener una fabricacion continua de los MEA's. En este documento se presentan los resultados obtenidos hasta ahora de una investigacion que se realiza en el IIE orientada a incrementar la estabilidad de la

  10. Eletrodo de marca-passo mal posicionado no ventrículo esquerdo Electrodo de marcapasos mal posicionado en el ventrículo izquierdo Pacemaker electrode misplaced in the left ventricle

    Directory of Open Access Journals (Sweden)

    André Luiz Cerqueira de Almeida


    Full Text Available Relatamos caso de implantação anômala de eletrodo de marca-passo VVI no ventrículo esquerdo (VE, diagnosticada durante avaliação de rotina, dois anos pós-implante. Trata-se de mulher de 65 anos e soropositiva para doença de Chagas. O eletrocardiograma (ECG apresentava padrão de bloqueio do ramo direito. A radiografia de tórax em perfil mostrou trajeto com curvatura posterior do eletrodo. No ecocardiograma transtorácico, o diagnóstico final mostrou cateter que penetrava o átrio direito, atravessava o septo interatrial e descia pelo átrio esquerdo e orifício valvar mitral para se implantar na parede lateral do VE. Abordam-se os seguintes aspectos relacionados: possíveis trajetos de implantação, quadro clínico, radiológico, eletrocardiográfico, ecocardiográfico, complicações e opções terapêuticas.Relatamos caso de implantación anómala de electrodo de marcapasos VVI en el ventrículo izquierdo (VI, diagnosticada durante evaluación de rutina, dos años post implante. Se trata de mujer de 65 años y seropositiva para enfermedad de Chagas. El electrocardiograma (ECG presentaba estándar de bloqueo de rama derecha. La radiografía de tórax de perfil mostró trayecto con curvatura posterior del electrodo. En el ecocardiograma transtorácico, el diagnóstico final mostró catéter que penetraba el atrio derecho, atravesaba el septo interatrial y descendía por el atrio izquierdo y orificio valvar mitral para implantarse en la pared lateral del VI. Se abordan los siguientes aspectos relacionados: posibles trayectos de implantación, cuadro clínico, radiológico, electrocardiográfico, ecocardiográfico, complicaciones y opciones terapéuticas.This study reports the case of an anomalous implantation of VVI pacemaker electrode in the left ventricle (LV diagnosed during routine evaluation, two years after implantation. The patient is a 65-year-old woman with Chagas disease. Electrocardiogram (ECG revealed a pattern of right

  11. Implementación de un interferómetro de difracción puntual con un monopíxel de cristal líquido


    Ramírez, Claudio; Otón Martínez, Eva; Iemmi, Claudio; Moreno Soriano, Ignacio; Bennis, Noureddine; Otón Sánchez, José Manuel; Campos, Juan


    En este trabajo se presenta la implementación de un interferómetro por difracción puntual construido con un monopíxel de cristal líquido. En primer lugar se ha fabricado un monopíxel de cristal líquido con alineamiento paralelo de unas dimensiones de 3x3 cm2, en el que el electrodo cubre toda la superficie excepto en un orificio central de unas 50 ?m. Este orificio es el que actuará como punto difractor. Aplicando diferentes tensiones se puede cambiar la fase de la onda que llega al píxel en ...

  12. Electrochemical performance in the hydrogen evolution reaction of Ni-TR (TR= La, Ce) materials synthesized using the solid state reaction method; Desempeno electroquimico en la reaccion de evolucion de hidrogeno de materiales de electrodo Ni-TR (TR = La, Ce) sintetizados por el metodo de reaccion de estado solido

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Huerta, A. M.; Dominguez-Crespo, M. A.; Ramirez-Meneses, E.; Yanez-Zamora, C. [CICATA, IPN, Altamira, Tamaulipas (Mexico); Avila-Garcia, I. [IPN, ESIQIE, UPALM, Mexico, D.F. (Mexico)]. E-mail:;


    relacionados con su operacion. El material de electrodo con mayor electroactividad es el Pt, pero debido a su costo elevado se han tenido que buscar electrocatalizadores alternativos con un balance entre costo y actividad. Uno de los materiales que mas se ha utilizado es el Niquel en conjunto con algunas de sus aleaciones. Este material ha demostrado un buen desempeno utilizando bajos sobrepotenciales en reacciones tradicionales como las reacciones de evolucion de hidrogeno (REH) y oxigeno (REO), asi como una alta resistencia a la corrosion y bajo costo. Particularmente, aleaciones binarias y ternarias han demostrado un incremento importante en la actividad de la REH al compararla con los materiales en su estado puro o masivo. Por esta razon, en la busqueda de nuevas alternativas con una aceptable eficiencia al compararla con los materiales a bajo costo, en este trabajo se obtuvieron materiales Ni-TR (TR = La, Ce) por el metodo de reaccion de estado solido, a partir de: a) acetilacetonatos metalicos y b) polvos metalicos. Estos materiales se sinterizaron durante 3 h a diferentes temperaturas (795 o 920 , 1000 y 1200 grados centigrados) a fin de evaluar su efecto en el desempeno electroquimico de los electrocatalizadores. La caracterizacion estructural y morfologica de materiales se realizo por las tecnicas de DRX y MEB, respectivamente. Asimismo, el desempeno electroquimico de los materiales de electrodo se evaluo en la REH utilizando voltametria ciclica (VC) y curvas potenciodinamicas. Los resultados obtenidos muestran que a bajas temperaturas se obtiene una mezcla de oxidos (NiO, CeO{sub 2} y LaNiO{sub 3}); sin embargo a medida que la temperatura de sinterizado se incrementa, se alcanza la formacion de las aleaciones NiO-CeO{sub 2} y NiO-LaNiO{sub 3}, respectivamente. Al mismo tiempo se observo una clara dependencia de la actividad electrocatalitica con la fuente obtencion de estos materiales (Ni-TR).

  13. Apuntes de Acústica


    Martín Domingo, Agustín


    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  14. EVALUACIÓN DE RENDIMIENTO Y NITRATOS EN AJO cv. NIEVE INTA CON RIEGO POR GOTEO Evaluation of sap nitrate and yield on garlic cv. ‘Nieve INTA’ under drip irrigation


    Silvia Gaviola; Víctor M. Lipinski


    Los objetivos del trabajo fueron: evaluar la relación entre los contenidos de nitratos en el jugo foliar (JF) de las hojas de ajo (Allium sativum L.) blanco cv. Nieve INTA, medido con un electrodo específico portátil y la densidad de plantación y fertirrigación nitrogenada; y establecer, en diferentes fechas de muestreos, los umbrales de concentración de nitratos que se relacionen con los máximos rendimientos. El ensayo fue conducido sobre un suelo franco arenoso (Tipic Torrifluvent) en Mendo...

  15. Electrodeposición y caracterización de láminas de Cu2C.Aplicación como electrodos de baterías de ión-litio


    Bijani Chiquero, Shanti


    El trabajo que se expone en la presente tesis doctoral tiene por objetivo la electrodeposición y posterior caracterización de láminas de Cu2O puro para la obtención de electrodos negativos de baterías de ión-litio de 3 V y capacidades específicas superiores a 300 A·h·kg-1. Esta tesis optimiza electrodos para el diseño de baterías prototipo de ión-litiotipo botón, demostrando que éstas, que son de gran aplicabilidad comercial, pueden ser fabricadas utilizando métodos sencillos y e...

  16. Materiales híbridos moleculares orgánicos-inorgánicos: síntesis y aplicación como electrodos en baterías recargables de litio

    Directory of Open Access Journals (Sweden)

    Torres-Gómez, G.


    Full Text Available A novel family of molecular hybrid materials based on electroactive inorganic species dispersed in conducting organic polymers is reported as electrodes for energy storage or conversion. Polyaniline and polypyrrole are effectively doped with electroactive polyoxometalates ([PMo12O40]3- or ferricyanide ([(FeCN6]3- anions as the only doping species. The high charge and size of these anions prevents their deintercalation during reduction in most cases. The synthesis of these hybrids can be made by chemical (bulk powders and electrochemical (films methods. For [PMo12O40]3-, nine aniline/pyrrole rings by anion are found in each case and the anion stays in the polymer matrix even after reduction at -0.4V (vs Ag/AgCl, 2.6V vs Li. In the case of Polypyrrole-FeCN6 hybrid the pyrrole-ring/Fe(CN6 ratio was around 10-12 depending on the temperature of synthesis. Temperature also affects the electrical conductivity, with the best values around 60Scm-1 (sample prepared at 0ºC. Fe(CN6 stays in the polymer matrix when the hybrid material is reduced in organic media. PMo12 hybrids intercalate up to 5.3 h+ during discharge (52 Ah/Kg whereas the hybrid with Fe(CN6 intercalates 2.7 lithium ions per formula unit (69Ah/Kg.

    Se describe la síntesis y aplicación como electrodos para el almacenamiento o conversión de energía de materiales híbridos basados en la dispersión de especies inorgánicas electroactivas en el seno de polímeros orgánicos conductores. Polianilina y polipirrol son dopados con polioxometalatos electroactivos ([PMo12O40]3- o aniones ferricianuro ([(FeCN6]3- como únicas especies dopantes. La elevada carga y tamaño de estos aniones evitan, en la mayoría de los casos, su desintercalación durante la reducción. Estos híbridos se han sintetizado por métodos químicos y electroquímicos, siendo la relación anillos de anilina o de pirrol por anión de [PMo12O40]3- de nueve, de manera que el anión permanece en el interior de la matriz

  17. Influencia de la cantidad de O2 adicionado al CO2 en el gas de protección sobre la microestructura del metal depositado en uniones soldadas de bordes rectos en aceros de bajo contenido de carbono con el proceso GMAW Influence of O2 content, added to CO2 in the shielding gas, on the microstructure of deposited metal in butt welded joint with straight edges, in low carbon steels using GMAW process


    Eduardo Díaz-Cedré; Amado Cruz-Crespo; Félix Ramos Morales; Mauricio Tello Rico; Joel Chaparro Gonzáles; Manuel Rodríguez Pérez; Juan A. Pozo Morejón; Nancy M. Pérez Pino


    La presencia de ferrita acicular (FA) en la microestructura del cordón de soldadura, dentro de determinado rango de valores, eleva considerablemente la tenacidad de las uniones soldadas. Es por ello, que el presente trabajo trata sobre un estudio que relaciona la cantidad de ferrita acicular en el cordón en función del contenido de oxígeno presente en la mezcla activa CO2+O2, durante la realización de uniones soldadas de bordes rectos en aceros de bajo carbono con el proceso con electrodo fus...

  18. Evaluación de diferentes tipos de barnices en la protección de electrodos para la soldadura subacuática//Evaluation of different types of varnishs to protect underwater welding electrodes


    Manuel Rodríguez-Pérez; Alexandre Queiroz-Bracarense; Lorenzo Perdomo-González; Rafael Quintana- Puchol; Alejandro Duffus-Scott


    El artículo tiene como objetivo evaluar  las posibilidades de empleo de diferentes tipos de barnices como impermeabilizantes para los electrodos del tipo AWS E 6013, cuando se realiza la soldadura  en condiciones subacuática mojada. Los barnices evaluados son el Vinílico, Marítimo, base Poliuretano y una nueva variante base Isopor. Los métodos de evaluación incluye el comportamiento de la resistencia mecánica que le confiere al revestimiento a cada uno de los barnices, el agua adsorbida y el ...

  19. Una plataforma MEMS para la medición in-situ y en tiempo real de la tensión/esfuerzo inducido electroquímicamente en el electrodo de una bateria de litio-ion


    Barón, Sergio D.


    En este trabajo se reporta la primera demostración exitosa de las capacidades de sensado de una plataforma MEMS para la caracterización in-situ de los procesos de expansión/contracción reversible inducida electroquímicamente en electrodos de baterías de litio-ion (LIB). La plataforma consiste en un arreglo de membranas flexibles que cambian su forma dinámicamente debido al intercalado/expansión y extracción/contracción de litio. El cambio de curvatura de la membrana se mide por el principio d...

  20. Evaluación del proceso de daño y deterioro mecánico del concreto reforzado con fibras mediante técnicas acústicas


    León Ramírez, José Alfredo


    La necesidad de realizar pruebas y ensayos de tipo no destructivo con el fin de investigar el comportamiento del concreto, se ha incrementado en los últimos tiempos. De la mano con esto, la mejora y evolución en dichas técnicas ha venido en constante ascenso, obteniendo muchas ventajas respecto a la utilización de pruebas y ensayos de tipo destructivo, como por ejemplo, la necesidad de obtener información en el sitio de inspección sin necesidad de recurrir a procedimientos invasivos y destruc...

  1. Comparación de los resultados de las mediciones in situ del aislamiento acústico al ruido aéreo de fachadas, mediante la utilización de los métodos globales con altavoces y con ruido de aviones.


    Díaz Sanchidrián, César; Pedrero González, Antonio


    En este trabajo se comparan los resultados experimentales de las mediciones in situ del aislamiento acústico al ruido aéreo de fachadas de recintos, por aplicación en cada uno de los recintos de dos métodos globales de la Norma EN ISO 140-5, Agosto 1998. Se han utilizado como fuentes de ruido un altavoz y el ruido de aeronaves. Las mediciones acústicas se han realizado en 26 dormitorios situados en viviendas de uso residencial privado.


    Directory of Open Access Journals (Sweden)

    Alfredo Aguilar Valdés


    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  3. La conexión Levantino-Chipriota. Indicios de comercio Atlántico con el Mediterráneo Oriental durante el Bronce Final (1150-950 a.C.

    Directory of Open Access Journals (Sweden)

    Mederos Martín, Alfredo


    Full Text Available Starting from an analysis of the trade and the chronological sequence between the Iberian Peninsula and the Cypro-Philistinian area during part of the Late Bronze Age (1150-950 BC, we can recognize, in the most peripheral territories of the Eastern Mediterranean, the presence at least of some exports of manufactured products in the form of articulated spits and knobbed fibulas of the Huelva type, and imports of bronze bowls. These artefacts appear in small hoards (Berzocana, Spain or in tombs (Amathus, Cyprus, associated with members of the leading elites. This suggests an exchange of gifts in order to establish trade ties. We also evaluate the historic and economical aims of this trade.

    A partir de un análisis del comercio y de las secuencias cronológicas de la Península Ibérica y el área Chipro-Filistea durante parte del Bronce Final (1150-950 AC, se puede reconocer en los territorios más periféricos del Mediterráneo Oriental, la presencia de, al menos, algunas exportaciones de productos manufacturados como asadores articulados y fíbulas de codo tipo Huelva y de importaciones de vasos metálicos. Dichos productos aparecen en pequeños depósitos (Berzocana, España o enterramientos (Amathus, Chipre asociados a miembros de las élites dirigentes, insinuando un intercambio de regalos para establecer lazos comerciales. Se evalúan las implicaciones históricas y económicas que incentivaron dicho comercio.

  4. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun


    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  5. Identificación de una tradición tecnológica cerámica con desgrasante óseo en el Neolítico peninsular. Estudio arqueométrico de materiales cerámicos de Madrid (5300-3400 cal AC

    Directory of Open Access Journals (Sweden)

    Vírseda, Lydia


    Full Text Available The archaeometric characterization of a set of potsherds from six Neolithic sites from the Madrid region has allowed the identification of a new and time-persisting regional technological tradition, based on the deliberated addition of crushed bone as temper in most pottery containers. This is the first known case in Iberia, and is outstanding because of its early chronologies and persistence in time: from 5300 to perhaps 3400 cal BC. Samples were characterized by complementary mineralogical and geochemical techniques such as thin-section, conventional and grazing angle X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray fluorescence spectrometry (XRF. The addition of bone temper created a light and resistant ceramic material, with technological advantages for both the storage and transportation. Such advantages might be linked to mobile or semi-sedentary groups.

    La caracterización arqueométrica de un conjunto de materiales cerámicos procedentes de 6 yacimientos neolíticos de Madrid ha permitido identificar una nueva tradición tecnológica regional persistente en el tiempo, basada en la adición intencionada de hueso machacado como desgrasante en la mayoría de los recipientes cerámicos. Se trata del primer caso de la Península Ibérica en el que se documenta este tipo de desgrasante en cerámicas de estas cronologías con una continuidad temporal de entre el 5300/5200 hasta posiblemente el 3400 cal AC. Los materiales seleccionados se caracterizaron por técnicas mineralógicas y geoquímicas complementarias como lámina delgada, difracción de rayos X (DRX convencional y de ángulo rasante, microscopía electrónica de barrido (MEB y espectrometría de fluorescencia de rayos X (FRX. La adición de hueso produce un material cerámico ligero pero a su vez resistente, con ventajas tecnológicas para recipientes de almacenamiento y/o transporte. Dichas ventajas quizá podrían vincularse a grupos con hábitos m


    Directory of Open Access Journals (Sweden)



    Full Text Available El objetivo de este trabajo fue evaluar y caracterizar el comportamiento mecánico en desgaste del acero API 5L X65, revestido con niobio en comparación al desempeño del revestimiento de la aleación de inconel 625 empleados en la industria de petróleo y gas. El revestimiento de niobio fue obtenido por el proceso de aspersión térmica a plasma de arco no transferido y el revestimiento inconel 625 por soldadura con electrodo revestido. La resistencia al desgaste por abrasión fue evaluada según la norma Petrobras N-2568, en un tribómetro CTER, la rugosidad y el volumen de material desgastado se determinó a través de perfilometría y la dureza de los revestimientos por microscopia Vickers. Los revestimientos obtenidos fueron caracterizados respecto a su morfología por microscopia electrónica de barrido (MEB y microscopía óptica (MO. La mayor dureza del revestimiento con niobio obtenido puede haber contribuido a reducir la tasa de desgaste en comparación con el revestimiento de inconel 625.

  7. Ac response to humidity and propane of sprayed Fe-Zn oxide films

    Directory of Open Access Journals (Sweden)

    A. Avila-García


    Full Text Available Se depositaron peliculas de óxido de fierro con distintos contenidos de Zn sobre subestratos de vidrio y se les evaporaron electrodos interdigitados de oro. Se usaron soluciones conteniendo 2, 10 y 30% atomico de Zn. Resultaron películas con estructuras de hematita, amorfa y franklinita, respectivamente. Tales estructuras fueron probadas como sensores de humedad y propano bajo condiciones de corriente alterna para frecuencias entre 1 y 10(5 Hz y a dos temperaturas: 30 y 250°C. Se calcularon sus impedancias en aire seco, aire húmedo y aire húmedo más propano, mediante mediciones de voltaje con un amplificador Lock-In. Se determinaron los valores de sensibilidad a la humedad (53% HR y a 189, 500 y 786 ppm de propano de las respuestas de la partes real e imaginaria de la impedancia y también de la impedancia total, como funciones de la frecuencia. Se reportan la máxima sensibilidad para cada caso y la frecuencia correspondiente. La sensibilidad máxima a la humedad está entre 24% y 308%. En el caso de propano, la sensibilidad va desde 45% hasta 711%. La mayor sensibilidad corresponde en todos los casos a la parte imaginaria de la impedancia. Se determinan los tiempos de respuesta y de recuperacion de la respuesta dinámica, además de la dependencia de la sensibilidad con la concentración. Se comentan los mecanismos de sensado.

  8. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  9. Cefalea cervicogénica: Tratamiento con estimulación eléctrica subcutánea periférica C1-C2-C3 Cervicogenic headache: Treatment with peripheral C1-C2-C3 subcutaneous electrostimulation


    M. D. Rodrigo; J. M. Azcona; J. Quero; LORENTE, C; P. Acín; J. Azcona


    Introducción: Presentamos siete pacientes con dolor cervicogénico (C1-C2-C3) de larga evolución, persitente, severo, no controlado, de diferentes etiologías, en los que se habían agotado otras posibilidades terapéuticas, tratados con una técnica de estimulación eléctrica extraespinal periférica occipital (C1-C2-C3), mediante implante quirúrgico de electrodo cérvico-occipital uni- o bilateral. Material y método: Se trata de siete pacientes, mujeres, edad media de 50,5 años, con los siguientes ...

  10. Análisis y simulación numérica de problemas electrohidrodinámicos relacionados con el electrospray


    Ibáñez León, Santiago Enrique


    La presente tesis es un estudio analítico y numérico del electrospray. En la configuración más sencilla, un caudal constante del líquido a atomizar, que debe tener una cierta conductividad eléctrica, se inyecta en un medio dieléctrico (un gas u otro líquido inmiscible con el primero) a través de un tubo capilar metálico. Entre este tubo y un electrodo lejano se aplica un voltaje continuo que origina un campo eléctrico en el líquido conductor y en el espacio que lo rodea. El campo eléctrico in...

  11. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  12. Modification of porosity in the catalyst layer of membrane electrode assemblies using pore-forming agents; Modificacion de la porosidad en la capa catalitica de ensambles membrana-electrodo empleando agentes formadores de poros

    Energy Technology Data Exchange (ETDEWEB)

    Flores Hernandez, J. Roberto [Instituto de Investigaciones Electricas Cuernavaca, Morelos (Mexico)] e-mail:; Reyes, Brenda [UNAM. Facultad de Quimica, Mexico D.F. (Mexico); Barbosa P., Romeli [Centro de Investigacion en Energia, UNAM, Temixco, Morelos (Mexico); Cano Castillo, Ulises; Albarran, Lorena [Instituto de Investigaciones Electricas Cuernavaca, Morelos (Mexico)


    Membrane electrode assemblies (MEA) are the most important part of PEM fuel cells since their interface results in the electrochemical reactions that make the generation of electricity possible. The MEA is composed of a proton exchange membrane, both sides of which are impregnated with a catalyst layer, normally of carbon-supported platinum. Depending on the technique used for its fabrication (atomization, serigraphy, brush methods, chemical reduction, etc.), the properties of the MEA can be different in terms of porosity, distribution of the catalyst, thickness and structure of the catalyst layer, and the quality of the union between the catalyst layer and the membrane, etc. Currently, the porosity of the electrodes is generated by isopropanol evaporation (solvent used in the dye) during the fabrication process conducted in the Instituto de Investigaciones Electricas (IIE). This document presents the results obtained from adding a porous agent to the catalytic dye base composition used in the fabrication of MEA at the IIE. [Spanish] Los Ensambles Membrana-Electrodo (MEA's) son la parte mas importante en las celdas de combustibles tipo PEM, ya que en su interfaz se llevan a cabo las reacciones electroquimicas que hacen posible la generacion de electricidad. El MEA esta compuesto de una membrana de intercambio protonico a la cual se le impregna en ambos lados una capa catalitica normalmente de platino soportado en carbon. Dependiendo de la tecnica empleada en su fabricacion (atomizado, serigrafia, brocha, reduccion quimica, etc.), las propiedades del MEA pueden ser diferentes en cuanto a porosidad, distribucion del catalizador, grosor y estructura de la capa catalitica, asi como la calidad de la union entre la capa catalizadora y la membrana, etc. Actualmente, la porosidad de los electrodos es generada por la evaporacion del isopropanol (solvente utilizado en la tinta) durante el proceso de fabricacion que se realiza en el Instituto de Investigaciones

  13. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE


    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  14. AC1 Wing


    Adrian DOBRE


    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  15. Interfaz humano-computadora basada en señales de electrooculografía para personas con discapacidad motriz

    Directory of Open Access Journals (Sweden)

    Daniel Pacheco Bautista


    Full Text Available En este trabajo se presenta el desarrollo de un prototipo que asiste, a personas con cierta discapacidad motriz, en la interacción con la computadora de una forma simple y económica, mediante señales de electrooculografía. Esta técnica permite detectar los movimientos oculares basada en el registro de la diferencia de potencial existente entre la córnea y la retina, tal propiedad es aprovechada en este proyecto para controlar el desplazamiento del cursor del ratón de una forma precisa sobre la pantalla de la computadora. El prototipo es un diseño compacto alimentado de una fuente única de 5V proveniente del puerto USB y utiliza la circuitería ya implementada en cualquier ratón electromecánico convencional con mínimas modificaciones. El uso de tales dispositivos así como de electrodos convencionales hace el producto de un costo relativamente bajo en relación a las propuestas en otros trabajos.

  16. Evaluación de un electrodo de carbón vítreo modificado con Zeolita tipo “A” en la adsorción de 2-clorofenol

    Directory of Open Access Journals (Sweden)

    Aurora Molina


    Full Text Available Glassy carbon electrodes modified with Zeolite “A” were studied in order to evidence the adsorption of 2-chlorophenol. Synthesis of zeolite was undertaken by a hydrothermal method using calcined kaolin as raw material. The zeolite was first exchanged with calcium ions. Then, it was modified with the cationic surfactant CTAB (cetyl trimethyl ammonium bromide or the non-ionic surfactant Triton X-100 (t-octylphenoxy-polyethoxyethanol. Adsorption of 2-chlorophenol was evaluated by cyclic voltammetry, once it was adsorbed onto the modified electrode. Electrochemical results indicated that the films surfactant-zeolites were able to adsorb the 2-chlorophenol from an aqueous alkaline medium. The best results were achieved when the cationic surfactant CTAB was used. The importance of electrode surface cleaning to guarantee the complete adherence between the vitreous carbon and the modified surfactant zeolite was determinated. Polishing and cleaning processes depend on the type of surfactant used.

  17. Nuevos tratamientos de lana con enzimas


    Vílchez, Susana


    [spa] Uno de los objetivos destacables de los tratamientos textiles modernos es obtener el efecto requerido modificando preferentemente la superficie de las fibras a fin de mantener la calidad del material, utilizando procesos que conlleven el mínimo impacto ambiental, tanto en el uso de productos como en la tecnología empleada. Dentro de este contexto, los procesos catalizados por enzimas cumplen el requisito de ser respetuosos con el medio ambiente, ya que los enzimas son biodegradables, ac...

  18. ac bidirectional motor controller (United States)

    Schreiner, K.


    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  19. Electrocristalización de nanopartículas de Au sobre electrodos de polipirrol y su empleo en el sensado


    Gutiérrez Pineda, Eduar; Rodríguez Presa, María J.; Bolzán, Agustín E.; Gervasi, Claudio Alfredo


    La electrodeposición de metales es uno de los métodos más extendidos en la obtención de capas metálicas para muchas aplicaciones decorativas e ingenieriles, principalmente debido a su bajo coste y fácil control. Este proceso involucra la formación de una nueva fase sobre el sustrato, lo que implica la participación de una serie de etapas relacionadas con el transporte de materia, la transferencia de carga y la formación de nuevas estructuras cristalinas [1]. La deposición de nanopartículas de...

  20. Redes de Control de la Contaminación Acústica


    Perera, P; Santiago Páez, José Salvador


    La Contaminación Acústica se concentra en las ciudades, que han crecido sin considerar el ruido como un factor determinante de la Planificación Urbana. La realidad actual, es que las ciudades son ruidosas y las administraciones tienen el deber de mejorar su calidad acústica. El primer paso para poder abordar el problema con garantías, es el conocimiento de su "realidad acústica". Los mapas acústicos son uno de los procedimientos utilizados para este cometido, pero la información que proporcio...

  1. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  2. AC/RF Superconductivity


    Ciovati, G.


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  3. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto


    EHV AC Undergrounding Electrical Power discusses methods of analysis for cable performance and for the behaviour of cable, mixed and overhead lines. The authors discuss the undergrounding of electrical power and develop procedures based on the standard equations of transmission lines. They also provide technical and economical comparisons of a variety of cables and analysis methods, in order to examine the performance of AC power transmission systems. A range of topics are covered, including: energization and de-energization phenomena of transmission lines; power quality; and cable safety cons

  4. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  5. Hermetisk AC-Krets


    Hirsch, Carl; Smirnoff, Alexander


    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  6. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar


    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  7. Superconducting ac cable

    International Nuclear Information System (INIS)

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  8. Electrodos híbridos a base de Polianilina/V2O5 para el desarrollo de baterías plásticas de litio

    Directory of Open Access Journals (Sweden)

    Gómez-Romero, P.


    Full Text Available We present the synthesis and characterization of the hybrid PAni/V2O5 and its performance as cathode in reversible lithium cells. The synthesis was made directly from the V2O5 gel. We observe a direct relationship between the synthesis conditions and the specific charge (Ah/Kg obtained during the analysis of the material as cathode in lithium batteries. On the other hand, oxygen treatments were carried out to increase the oxidation state of the V2O5 in the hybrid material. Higher temperatures and period of treatment leads to the decomposition of the organic part of the hybrid PAni/V2O5. The syntesis conditions of the hybrid, showed great influence over the specific charge. Values as high as 302 Ah/Kg were observed at slow discharge rate (C/48 and 200-238 Ah/Kg at discharge rate of C/12, this values correspond to the insertion of 2.7 and 2.08 lithium ions respectively. These values demonstrate the synergic response between PAni and the V2O5 oxide material.Presentamos la síntesis y caracterización del híbrido PAni/V2O5 y su aplicación como cátodo en baterías reversibles de litio. La síntesis se realizó directamente a partir del hidrogel de V2O5. Observamos una relación directa entre las condiciones de síntesis y la carga específica (Ah/Kg obtenida durante el análisis del material como cátodo en baterías recargables de litio. Por otro lado, se llevaron a cabo tratamientos con oxígeno para aumentar el estado de oxidación del V2O5 en el material híbrido. El uso de mayores temperaturas y tiempos de reacción provoca la descomposición de la parte orgánica del híbrido PAni/V2O5. La carga específica y tratamientos posteriores de los híbridos obtenidos son muy sensibles a las condiciones de síntesis. Se observaron valores tan elevados como 302 Ah/Kg a baja velocidad de descarga (C/48 y 200-238 Ah/Kg a una velocidad de descarga de C/12, valores que corresponden a la inserción de 2.7 y 2.08 iones litio respectivamente. Estos valores

  9. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam


    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  10. Estudio del impacto acústico de la llegada del AVE a Alicante


    Pamies Rodríguez, María Isabel


    Este estudio del impacto acústico de la alta velocidad en la ciudad de Alicante sirve para ver cómo ha afectado esta nueva línea a la ciudad, sus repercusiones acústicas. Se pretende evaluar el ruido ferreoviario antes y después de la llegada AVE comparando sus decibelios, sus frecuencias y los si los métodos de barrera son útiles y/o necesario. Para ello se van a emplear instrumentos de medida acústica así como el programa Cadna-A para la elaboración de los mapas de ruido junto con AutoCad....

  11. Actuación acústica en centro de arte contemporáneo




    Trabajo científico técnico. El proyecto trata sobre una intervención acústica en un museo de arte contemporáneo de Valencia, y es un estudio sobre aislamiento y acondicionamiento acústico de las distintas salas del edificio, y que se realizó en colaboración con los autores del proyecto Vazquez Martinez, A. (2011). Actuación acústica en centro de arte contemporáneo. Archivo delegado

  12. Cuidados con el anciano con tos productiva.


    Costa de Moura, María Lucia


    A partir de las informaciones y con la motivación para hacer un estudio dirigido a los cuidados con el anciano, sigue la necesidad del desarrollo de acciones pertinentes para la práctica de cuidar, o sea, la asistencia de enfermería prestada directamente al anciano, principalmente a aquellos que llegan a la unidad de salud quejándose de tos. El objeto de este estudio es la asistencia de enfermería basándome en las cuestiones que rodean la percepción del enfermero y cómo el...

  13. Cifrado con cubos marcados


    Coriat, Moisés; María C. Cañadas


    Con cuatro de los 8 tetracubos y con la ayuda de la noción de cubo mínimo (cubo formado por dos tetracubos), introducimos los “cubo marcados”. A su vez, usamos esta idea para generar claves con las que cabe transmitir mensajes cifrados. Damos ejemplos de claves y mencionamos algunas posibilidades más de cifrado con dichos cubos marcados. En la introducción presentamos algunas facetas del cifrado. Después, describimos algunos policubos y prestamos especial atención a los cuatro tetracubo...

  14. AcEST: BP920072 [AcEST

    Lifescience Database Archive (English)


  15. Improvement of the performance of a new type of single chamber microbial fuel cell compared to a conventional cell; Mejora del desempeno de un nuevo tipo de celda de combustible microbiana de una camara comparado con una celda convencional

    Energy Technology Data Exchange (ETDEWEB)

    Vazquez Larios, A.L.; Vazquez-Huerta, G.; Esparza-Garcia, F.; Solorza-Feria, O.; Poggi Varaldo, H.M. [Centro de Investigacion y de Estudios Avanzados del IPN, Mexico D.F. (Mexico)]. E-mail:;


    The objective of this work was to design, build and operate a new type of microbial fuel cell (MFC-A) and evaluate the architectural changes in the production of electricity. The results were compared with those of a standard fuel cell (MFC-B). The MFC-A consisted of a horizontal acrylate cylinder with two systems of sandwiched electrodes (each with a anode proton exchange membrane-cathode) separated by 78 mm. The MFC-B consisted of an anode and a cathode each in the opposite faces of the cell. The internal resistance of the cells were determined with polarization curves. The cells were operated in batch during 50 h at 30 degrees Celsius obtained with 38 mW/m{sup 2} and 5 mW/m{sup 2} for MFC-A and MFC-B, respectively. The changes in the architecture of the cell and design of the electrodes occurred at a power density 8 times greater, associated with the decrease in internal resistance of 1200 and 3900 {Omega} for MFC-A and MFC-B, respectively. The change in architecture (double electrode in the same volume for MFC-A) enabled obtaining a 13 times greater potential per unit volume, with 922 mW/m{sup 3} in the new MFC-A cell versus 69 mW/m{sup 3} in MFC-B. [Spanish] El objetivo de este trabajo fue disenar, construir y operar una celda de combustible microbiana de nuevo tipo (CCM-A), y evaluar los cambios de arquitectura en la produccion de electricidad. Los resultados fueron comparados con los de una celda de combustible estandar (CCM-B). La CCM-A consistio de un cilindro horizontal de acrilato, con dos sistemas de electrodos emparedados (cada uno con catodo/membrana de intercambio protonico/anodo) separados por 78 mm. La CCM-B consistio de un anodo y un catodo cada uno en las caras opuestas de la celda. Las Ri de las celdas fueron determinadas por curva de polarizacion. Las celdas fueron operadas en lote durante 50 h, a 30 grados centigrados, y fueron inoculadas con un inoculo sulfato reductor (In-SR) y cargadas con un extracto modelo similar al perfil de metabolitos

  16. Induction Motor Control through AC/DC/AC Converters


    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid


    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  17. AcEST: BP920905 [AcEST

    Lifescience Database Archive (English)


  18. AcEST: DK950147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  19. AcEST: DK959344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  20. AcEST: DK949716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  1. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))


    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  2. Valoración del desempeño de un dispositivo de autoalimentación diseñado para la evaluación operativa de electrodos revestidos Self-feed device behaviour valuation designed for assessment of operability of covered electrodes

    Directory of Open Access Journals (Sweden)

    Alejandro García Rodríguez


    Full Text Available El presente trabajo tiene como objetivo valorar la efectividad de un dispositivo de autoalimentación para electrodos revestidos. El mismo es capaz de eliminar perturbaciones inherentes a operarios o sistemas de control automático, para el estudio del comportamiento de electrodos revestidos. La conjugación de diferentes métodos, tales como el análisis estadístico del tiempo de duración del cortocircuito, el análisis metalográfico ( penetración, zona afectada por el calor, coeficiente de forma y distancia promedio entre frentes de solidificación del cordón, junto al análisis del comportamiento de los parámetros eléctricos primarios del arco y los índices de consumo del electrodo, permiten obtener relaciones entre el comportamiento eléctrico del arco, el proceso de transferencia de masa y la apariencia del cordón. Esto permite extraer criterios sobre la estabilidad del proceso y el desempeño del dispositivo de alimentación empleado. Se obtiene una metodología estadística, apropiada para el procesamiento del parámetro "duración del cortocircuito", a partir de un adecuado ajuste de las distribuciones empíricas a un modelo Lognormal. El dispositivo de autoalimentación para electrodos revestidos, permite la ejecución repetible y reproducible de cordones de soldadura en posición plana, manteniendo la longitud del arco en función de las características físico-químicas del consumible evaluado en regímenes de trabajo de 125A, 140A y 160A.The objective of the present work is to evaluate the effectiveness of a self-feed device for covered electrodes. This device is able of eliminate disturbances from manual operation or the use of automatic control systems during the study of covered electrode behavior. The conjugation of different methods like short-circuit time statistical analysis, metallographic analysis (penetration, heat affected zone, shape and mean distance between successive solidification fronts together with the

  3. con marcos extradensos

    Directory of Open Access Journals (Sweden)

    Manuel Rodríguez


    Full Text Available El cultivo del plátano vianda al igual que el de la papaya, en la región occidental del país, son fuertemente atacados por enfermedades que hacen que las plantaciones, por el grado de deterioro que estas les producen, no duren más de un ciclo de cultivo. Sembrar una misma área, un año tras de otro con el mismo cultivo, trae consigo el establecimiento en el suelo de elementos parásitos dañinos al mismo, que pueden ser eliminados o atenuados con una rotación con otro cultivo. El presente trabajo expone los resultados experimentales de dos años de trabajo de la rotación de estos cultivos, plantados con dos marcos de plantación de alta densidad, 2 x 4 x 1 m y 3 x 1 m, con una densidad de 3333 plantas/ha y regados con la técnica de riego por goteo. Se obtuvieron rendimientos de 40,73 t/ha en plátano y de 71,42 t/ha en papaya, con una relación beneficio costo de 1,15, tasa interna de retorno de 36,27 %, valor actual neto de 21,47 y plazo de recuperación de la inversión de 3,01 años.

  4. Arquitectura teatral, historia y acústica: el sonido de los teatros

    Directory of Open Access Journals (Sweden)

    Arturo Barba Sevillano


    Full Text Available La evolución arquitectónica de los edificios teatrales a lo largo de la historia está intrínsecamente relacionada con el tipo de espectáculos representados en ellos y con sus necesidades acústicas. En este artículo se exponen cronológicamente los rasgos morfológicos y acústicos de los edificios teatrales, desde las tipologías iniciales de la antigüedad clásica hasta las diferentes propuestas de teatros de ópera a la italiana en los siglos XVIII y XIX. Se analiza la herencia formal que cada modelo teatral adeuda a sus predecesores y se señalan sus diferencias. En cada tipo teatral aportamos una síntesis de sus características acústicas explicando sus virtudes y defectos, y argumentamos las razones de su funcionamiento sonoro.

  5. Atención conjunta y desarrollo léxico en niños con síndrome de Down y niños con desarrollo típico


    Galeote, Miguel; Checa, Elena; Sánchez-Palacios, Concha; Gamarro, Antonio; Isequilla, Estela; Conesa, Macarena


    En este estudio se analiza la relación entre la atención conjunta (AC) y el desarrollo léxico temprano en niños con síndrome de Down (SD) y niños con desarrollo típico (DT). Diversos estudios han demostrado el papel facilitador de la AC sobre el desarrollo léxico en niños con desarrollo típico (Carpenter, Nagel y Tomasello, 1998; Masur, Flynn y Eichorst, 2005; Shimp y Huttenlocher, 2007; Tomasello y Farrar, 1986; Tomasello y Todd, 1983). Dicho aprendizaje se ve favorecido si la madre sigue el...

  6. Investigando con personas con dificultades de aprendizaje

    Directory of Open Access Journals (Sweden)

    Borja González Luna


    Full Text Available El artículo muestra los orígenes de lo que Walmsley (2008 denomina «investigación inclusiva». Para comprender qué se entiende por investigación inclusiva tenemos que remontarnos a los debates epistemológicos sobre las metodologías cuantitativas y cualitativas, acontecidos en la década de los 90, en torno a la revista Disability & Society. A partir de una síntesis de dichos debates, focalizados en el ámbito de la «discapacidad intelectual y del desarrollo», se exponen dos estrategias de colaboración con dicha población: a una aproximación etnográfica (de trabajo grupal, y b una aproximación biográfica (de trabajo individual. A continuación se esboza un posible diseño de trabajo de campo que intenta superar el paradigma cualitativo «clásico» con el objetivo de incluir a dicho colectivo más allá del rol de «sujetos de la investigación». Para finalizar se recoge el debate sobre la accesibilidad de los resultados de la investigación a los participantes en dichas investigaciones, y con ello la necesaria innovación en el ámbito de las «devoluciones» de los resultados, cuando se trata de incluir a personas que presentan limitaciones para la comprensión del lenguaje abstracto oral y/o escrito.

  7. Acúmulo de macronutrientes e decomposição da palhada de braquiárias em razão da adubação nitrogenada durante e após o consórcio com a cultura do milho


    Nídia Raquel Costa; Marcelo Andreotti; Salatiér Buzetti; Keny Samejima Mascarenhas Lopes; Fernanda Garcia dos Santos; Cristiano Magalhães Pariz


    Em regiões de clima tropical, as principais limitações na manutenção de palhada na superfície do solo são a dificuldade de sua implantação e as suas elevadas taxas de decomposição. Visando identificar o potencial produtivo dos capins xaraés e ruziziensis, bem como a posterior formação de palhada para continuidade do sistema plantio direto, avaliou-se a produtividade de massa seca, a relação lignina/N total, o acúmulo de macronutrientes e a decomposição da palhada em duas safras agrícolas. Os ...

  8. AcEST: DK955197 [AcEST

    Lifescience Database Archive (English)


  9. AcEST: BP915640 [AcEST

    Lifescience Database Archive (English)


  10. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar


    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  11. Instrumentación multicanal con implementación de técnicas de reducción de ruido y procesado en-línea para la detección de ultrasonidos: aplicación a la localización de emisiones acústicas de descargas parciales


    Búa Núñez, Iago


    La medida de descargas parciales (Partial Discharges - PD) es un indicador muy fiable de la degradación del aislamiento eléctrico. Por esta razón, resulta muy interesante la monitorización de dicha actividad con el objetivo de analizar equipos eléctricos de alta tensión, tales como los transformadores, y de estudiar su probabilidad de fallo. En este sentido, se han desarrollado nuevas tecnologías para la detección de PDs, las cuales incorporan técnicas digitales de procesado de...

  12. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O


    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  13. AcEST: BP920800 [AcEST

    Lifescience Database Archive (English)


  14. AcEST: DK945549 [AcEST

    Lifescience Database Archive (English)


  15. AcEST: BP917632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  16. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  17. AcEST: DK946687 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  18. AcEST: DK949372 [AcEST

    Lifescience Database Archive (English)


  19. en pacientes con obesidad

    Directory of Open Access Journals (Sweden)

    Alcia María Alvarado Sánchez


    Full Text Available El objetivo de este estudio fue evaluar la eficacia de una intervención psicológica en pacientes con obesidad. Se utilizó un diseño cuasiexperimental con un grupo de estudio y un grupo control. Después de la intervención, se encontró una diferencia significativa en la reducción de peso entre los grupos. Asimismo, hubo un incremento significativo en la autoestima del grupo estudiado.

  20. Funcionando con la computadora


    Álvarez, Eduardo; Astiz, Mercedes; Medina, Perla; Montero, Y.; Oliver, María; Rocerau, M. Cristina; Valdez, Guillermo; Vecino, María; Vilanova, Silvia


    En este trabajo se presenta la descripción y resultados de la segunda etapa de una experiencia planteada con el objetivo de indagar la manera en que los alumnos determinan e interpretan funciones que explican situaciones problemáticas valiéndose de una nueva forma de trabajo en el aula: la utilización de la computadora como herramienta y un programa asistente matemático. La primera etapa consistió en el desarrollo de un taller optativo con alumnos de entre 14 y 15 años de edad del Colegio Dr....

  1. Evaluación acústica objetiva y subjetiva en salas y teatros de Andalucía


    Bustamante Rojas, Pedro


    Falta palabras clave La tesis doctoral tiene como objetivo principal caracterizar la acústica de las principales salas de concierto de Andalucía. En concreto, el estudio abarca un total de nueve salas, entre teatros y auditorios de la comunidad autónoma, actualmente en uso. Para ello ha sido necesario realizar mediciones acústica in situ con el fin de obtener y valorar los parámetros acústicos objetivos que se utilizarán para la citada caracterización. Pero la tesis tiene también como f...

  2. Energy saving in ac generators (United States)

    Nola, F. J.


    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  3. SSTI Clark ACS Technology Demonstrations


    Freesland, Douglas


    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  4. fertilizada con diferentes abonos

    Directory of Open Access Journals (Sweden)

    Jorge Alberto Elizondo-Salazar


    Full Text Available Producción y calidad de la biomasa de morera (Morus alba fertilizada con diferentes abonos. Se llevó a cabo un experimento en la Estación Experimental “Alfredo Volio Mata” de la Universidad de Costa Rica con el fi n de evaluar la aplicación de 150 kg de N/ha/año proveniente de dos abonos orgánicos: lombriabono y compostaje; y de un fertilizante químico, sobre la producción y calidad de la biomasa de morera. El periodo experimental comprendió un ciclo de 12 meses, iniciando en julio del 2003 y fi nalizando en julio del 2004. Se utilizó una plantación de morera de 12 años de establecida con una densidad de siembra de 27.777 plantas/ ha. Se empleó un diseño de bloques completos al azar con cuatro tratamientos: dos abonos orgánicos, nitrato de amonio (33,5% N y un control. Las plantas se podaron a 0,6 m sobre el nivel del suelo al inicio del ensayo. Durante el periodo experimental, las plantas fueron podadas consecutivamente cada 90 días. Las hojas y los tallos fueron separados y analizados para determinar el contenido de materia seca y proteína cruda. La producción de materia seca fue 23% superior y el contenido de proteína cruda fue signifi cativamente mayor con el nitrógeno químico, mientras que el contenido de materia seca fue menor. No se encontraron diferencias signifi cativas entre el tratamiento control y los tratamientos orgánicos.

  5. Utilización del mineral de manganeso (pirolusita) en la producción de aceros al carbono


    Aerles Batista-Cabrera; Efraín Navas-Medina


    Los métodos tradicionales de producción de acero utilizan el ferromanganeso para obtener el porcentaje de Mn en la marca establecida según la norma cubana, pero este compuesto es altamente costoso. Se ensayó, en la producción del Ac 35, sustituir el ferromanganeso por el mineral pirolusita (MnO2) con el fin de reducir los costos. Se evaluaron dos variantes de sustitución: la primera consiste en añadir el mineral con virutas de aluminio y coque (o residuos de electrodos) sobre la escoria del m...

  6. AcEST: DK950895 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  7. AcEST: BP914304 [AcEST

    Lifescience Database Archive (English)


  8. AcEST: BP911793 [AcEST

    Lifescience Database Archive (English)


  9. AcEST: BP921649 [AcEST

    Lifescience Database Archive (English)


  10. AcEST: BP919669 [AcEST

    Lifescience Database Archive (English)


  11. AcEST: DK957916 [AcEST

    Lifescience Database Archive (English)


  12. AcEST: DK956923 [AcEST

    Lifescience Database Archive (English)


  13. AcEST: BP921492 [AcEST

    Lifescience Database Archive (English)


  14. Una plataforma para facilitar el aprendizaje en ingeniería acústica


    Poveda Martínez, Pedro; Carbajo San Martín, Jesús; Ramis Soriano, Jaime


    En este trabajo se presenta una plataforma que facilita la realización de diversas actividades y prácticas asociadas a contenidos en el ámbito de lo que se viene denominando “ingeniería acústica”. El sistema central de esta plataforma es una tarjeta de adquisición de datos para la que se han programado diversas aplicaciones en Labview. Se pueden distinguir distintas áreas entre las que destacamos: el estudio de los transductores (con emisión audible y ultrasónicos) y la acústica de salas. Tam...

  15. Instalación para vivienda multifamiliar de ACS en Madrid


    Fernández Fanego, María


    El objeto de este proyecto consiste en el diseño y propuesta de una instalación solar térmica para producción de agua caliente sanitaria (ACS) en una vivienda multifamiliar situada en Madrid. Para ello se van a estudiar las necesidades térmicas de ACS en función de las características constructivas del edificio y analizando los datos climatológicos y de temperatura de red de agua fría propios del emplazamiento. Con ello se llevará a cabo un estudio energético teniendo en cue...

  16. Paisajes sonoros de Barcelona: itinerarios realizados para "Arquitectura acústica" en 2016


    Daumal Domènech, Francesc de Paula; Piguillem Poch, Núria; Díaz Blanco, Celia


    Cuando hablamos del Paisaje sonoro de una ciudad, hemos definido el itinerario acústico como una de las herramientas de análisis más expresivas del contenido histórico, cultural y perceptivo. Por ello, en esta comunicación, se muestran los trabajos realizados por 9 grupos de alumnos de la asignatura optativa e intensiva “Arquitectura Acústica”, impartida por este autor durante la última semana de enero del 2016, en concordancia con los estudios anteriormente realizados para el Area de Medi Am...

  17. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)


    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  18. sistema Web con JSP

    Directory of Open Access Journals (Sweden)

    César Viloria Núñez


    Full Text Available Este artículo presenta el desarrollo de un sistema de información que permite la adquisición y la administración de información relacionada con los signos vitales como la presión arterial, la frecuencia cardiaca y respiratoria, y la saturación de oxígeno en la sangre de un paciente. La implementación del sistema se basa en una solución Web, permitiendo así que médicos especialistas puedan monitorear a sus pacientes desde cualquier punto conectado a la red en tiempo real y, al mismo tiempo, dar indicaciones críticas al personal médico que se encuentra en el lugar con el paciente.

  19. Simultaneous distribution of AC and DC power (United States)

    Polese, Luigi Gentile


    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  20. pacientes con falla cardiaca

    Directory of Open Access Journals (Sweden)

    Diana Marcela Achury Saldaña


    Full Text Available Objetivo: determinar la adherencia al tratamiento de pacientes con falla cardiaca hospitalizados, al aplicar un plan educativo quefomenta el autocuidado.Método: estudio cuasiexperimental (entrevistas enfermera-paciente realizado entre diciembre de 2004 y mayo de 2006, con unamuestra de 50 pacientes seleccionados por conveniencia. Se diseñó un instrumento para evaluar los comportamientos de los pacientes,con base en algunos resultados de la adherencia y sus respectivos indicadores de la taxonomía NOC (Nursing out comes classification. Laadherencia al tratamiento fue medida en dos momentos: el primero durante la hospitalización, seguido de la aplicación del plan educativoantes del alta, que proporcionaba información en el manejo de su enfermedad desde una dimensión física, psicológica y social quepromueve el autocuidado; y el segundo un mes después del alta en su domicilio.Resultados: diferencias estadísticamente significativas (P=0,0001 que demuestran cómo mediante la capacitación al paciente enel manejo de su tratamiento farmacológico y no farmacológico, el establecimiento de una sana relación entre el profesional de enfermeríay el paciente, y la participación de la familia, se logra una total adherencia al tratamiento.Conclusiones: para lograr una adherencia total del paciente con falla cardiaca al tratamiento es necesario un proceso educativo y unseguimiento continuo y personalizado que motive permanentemente al paciente y se le reconozca el papel protagónico en su cuidado y manejo de la enfermedad.

  1. Contemos con la publicidad


    Muñoz Santonja, José


    En este artículo se presentan algunas propuestas para utilizar la publicidad en clases de Matemáticas, como apoyo didáctico a algunos temas que hay que analizar en el currículum de esta materia a lo largo del curso. Se plantean, al mismo tiempo, una serie de actividades para realizar con la publicidad en el ámbito de la prensa escrita.

  2. Los experimentos con ajusticiados.


    Bert, Paul


    Los experimentos realizados con ajusticiados se multiplican y son muy pocos los decapitados que escapan a las investigaciones más o menos preparadas y ejecutadas. Es conveniente indicar a los médicos y también al público lo que puede ser interesante intentar, lo que es inútil y sobretodo lo que no se puede permitir.

  3. AcEST: BP917226 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_H09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000097_H09. BP917226 CL27Con ... 01 (92%) Frame = -2 Query: 396 KIELGDEVGSFKFTPSTVTVSAGE AIEFALVGETGHNVVLDIPAGAPATVASELKAASMD 217 K+E+GDEVG+ ... FKF P ++TVSAGE A+EF LVGETGHN+V DIPAGAP TVASELKAASMD Sbjct: 2 KVEVG ...

  4. AcEST: BP916573 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000089_B09 502 Adiantum capillus-veneris mRNA. clone: YMU001_000089_B09. BP916573 CL27Con ... 100 (93%) Frame = -1 Query: 401 IEVGDEVGSFKFTPSTVTVSAGE AIEFALVGETGHNVVFDIPAGAPATVASELKAASMDE 222 +EVGDEVG+ ... FKF P ++TVSAGE A+EF LVGETGHN+VFDIPAGAP TVASELKAASMDE Sbjct: 3 VEVG ...

  5. AcEST: BP912427 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_H07 539 Adiantum capillus-veneris mRNA. clone: YMU001_000018_H07. BP912427 CL27Con ... 100 (93%) Frame = +2 Query: 152 IEVGDEVGSFKFTPSTVTVSAGE AIEFALVGETGHNVVFDIPAGAPATVASELKAASMDE 331 +EVGDEVG+ ... FKF P ++TVSAGE A+EF LVGETGHN+VFDIPAGAP TVASELKAASMDE Sbjct: 3 VEVG ...

  6. AcEST: BP919497 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_G04 479 Adiantum capillus-veneris mRNA. clone: YMU001_000125_G04. BP919497 CL27Con ... 01 (92%) Frame = -1 Query: 415 KIEVGDEVGSFKFTPSTVTVSAGE AIEFALVGETGHNVVFDIPAGAPATVASELKAASMD 236 K+EVGDEVG+ ... FKF P ++TVSAGE A+EF LVGETGHN+VFDIPAGAP TVASELKAASMD Sbjct: 2 KVEVG ...

  7. AcEST: BP919469 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_D11 490 Adiantum capillus-veneris mRNA. clone: YMU001_000125_D11. BP919469 CL27Con ... 100 (92%) Frame = -1 Query: 390 IEVGDEVGSFKFTPSTVTVSAGE AIEFALVGETGHNVVFDIPAGAPATVASELKAASMDE 211 +EVGDEVG+ ... FKF P ++TVSAGE A+EF LVGETGHN+VFDIPAGAP TVASELKAASMDE Sbjct: 3 VEVG ...

  8. AcEST: BP912407 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F10 443 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F10. BP912407 CL15Con ... U 33 kDa protein of the oxygen-evolving complex OS=Salicornia ... europaea GN=OEE1 PE=2 SV=1 Length = 330 Score = 16 ...

  9. AcEST: BP917600 [AcEST

    Lifescience Database Archive (English)


  10. AcEST: BP920944 [AcEST

    Lifescience Database Archive (English)


  11. AcEST: BP912493 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_B06 132 Adiantum capillus-veneris mRNA. clone: YMU001_000019_B06. BP912493 CL66Con ... 31/37 (83%) Frame = -3 Query: 130 KPAEKEIIIDVPLASRLAW RGFIWPLAAISELRNGKL 20 KP +KEIIIDVPLA++LAW +G WPLAA+ ... EL+ G L Sbjct: 179 KPTDKEIIIDVPLATKLAW QGAGWPLAAVQELQRGTL 215 >sp|Q9SHE8|PSAF_ARATH Photos ...

  12. AcEST: BP919359 [AcEST

    Lifescience Database Archive (English)


  13. AcEST: BP921840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G06 490 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G06. BP921840 CL18Con ... Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames ) GN=ddl PE=3 SV=1 Length = 349 Score = 30.8 bits ( ...

  14. AcEST: BP920341 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_A03 473 Adiantum capillus-veneris mRNA. clone: YMU001_000136_A03. BP920341 CL37Con ... h factor-like doma... 30 4.2 sp|Q8WXX7|AUTS2_HUMAN Autism ... susceptibility gene 2 protein OS=Ho... 30 4.2 sp|P ...

  15. Placa de pila de combustible con varias áreas de reacción química


    Lincheta Mesa, Eduardo; Lozano Fantoba, Antonio; Barreras Toledo, Félix; Valiño García, Luis; Mustata Oroviceanu, Radu


    La placa de pila de combustible, que se utiliza generalmente para distribuir de forma homogénea los fluidos reactantes sobre las áreas de reacción química correspondientes a las capas catalíticas (electrodos), presenta, en al menos una de las dos caras, dos o más áreas de reacción química una geometría de flujo determinada, de manera que se optimiza la producción de corriente por celda utilizando ensamblajes de membrana y electrodo del mismo tamaño, reduciendo el espacio nec...

  16. La atención odontológica del paciente geriátrico con deterioro cognitivo


    M.C. Haya Fernández; I. Blasco Garrido; M.B. Cabo Pastor


    La investigación clínica ha demostrado que una mejor función cognitiva se relaciona con un mejor estado de salud oral. Y, de la misma manera, los pacientes mayores institucionalizados con deterioro cognitivo presentan una pobre salud oral con mayor número de dientes ausentes, caries, acúmulo de placa y enfermedad periodontal. El diagnóstico precoz del paciente con deterioro cognitivo es fundamental para mejorar el pronóstico de la enfermedad y poder plantear un tratamiento odontológico preven...

  17. Cementos con cenizas volantes

    Directory of Open Access Journals (Sweden)

    Ossa M., Mauricio


    additions of 20 and 30% .

    Casi la generalidad de los estudios realizados sobre cementos con adición de cenizas volantes se refieren a sus características y comportamiento en pastas, morteros y hormigones, siempre en relación con aquéllos del cemento portland. Esta vez, se desarrolló un trabajo experimental orientado a relacionar entre sí los cementos con adiciones de cenizas volantes y de puzolana natural. Para ello se fabricaron a escala de laboratorio cementos de ambos tipos, empleando como materias primas comunes clinker y yeso y, como variables, diferentes porcentajes de las dos adiciones, que cumplieron previamente los requisitos normalizados en cuanto a sus actividades puzolánicas. La calidad de los cementos fabricados resultó adecuada y concordante con la del cemento portland-puzolánico obtenido a escala industrial con los mismos clinker, yeso y puzolana natural de este estudio. Posteriormente, se determinaron las características de los cementos experimentales y se confeccionaron morteros normales para la realización de ensayos físicos y mecánicos. Los resultados de ensayos indicaron que los cementos con adición de cenizas volantes (CCV requieren menos agua para consistencia normal, presentan tiempos de fraguado mayores y expansiones en autoclave menores que los cementos con adición de puzolana (CP. Los calores de hidratación a 7 y 28 días de edad fueron aproximadamente similares para ambos tipos de cemento. En morteros normales, los cementos CCV mostraron menor retracción de secado, mayor retentividad y mayor fluidez (para igual cantidad de agua que los cementos CP. En los ensayos de exudación se observó que ésta depende más de la finura que el tipo de adición. Finalmente, los ensayos mecánicos señalaron que las resistencias a compresión y flexotracción de los morteros con cementos CCV son menores a edades inferiores que 14 días (del orden de 5 a 10% a un día de edad, pero que a partir de entonces pasan a ser mayores que las de

  18. AcEST: DK948526 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  19. AcEST: DK962916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  20. AcEST: DK955705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  1. AcEST: DK961330 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  2. AcEST: BP913772 [AcEST

    Lifescience Database Archive (English)


  3. AcEST: DK952954 [AcEST

    Lifescience Database Archive (English)


  4. AcEST: BP912540 [AcEST

    Lifescience Database Archive (English)


  5. Electrodos poliméricos de PPy/PVS y PPy/DBS cómo cátodos en baterías de Zinc y Magnesio


    Granados García, Jorge Enrique


    En este proyecto se estudia la respuesta de los polímero PPy/PVS y PPy/DBS al ser usados como cátodos en baterías poliméricas con ánodos de Zinc y Magnesio. Se tratará de obtener las mejores películas poliméricas que incorporen estos cationes durante la descarga y los expulsen durante la recarga de la batería. Este esquema conjuga las buenas características del Zn y Mg metálico para ser usado como ánodo de baterías con las buenas propiedades de los polímeros conductores y la po...

  6. Funciones con Microsoft Excel


    Castillo, Dalia Imelda; Estrada, Ana Luisa; Hernández, Brenda Amalia


    En este documento se presenta el desarrollo de algunas actividades que se trabajaron con estudiantes de primer semestre de la Universidad Autónoma de Nayarit; utilizando la hoja de cálculo Excel en el tema de visualización de funciones, para la materia de lenguaje y pensamiento matemático. Ya que la tecnología ha adquirido un papel muy importante en el proceso enseñanza-aprendizaje, nos ofrece un medio para que el estudiante explore, analice, verifique y desarrolle habilidades que se serán út...

  7. Creo con mis dedos


    S??nchez Aniceto, Monta??a


    Las artes pl??sticas son muy importantes para los ni??os/as sobre todo para Educaci??n Infantil ya que promueven la creatividad mediante diferentes recursos y t??cnicas lo que favorece su motivaci??n en las competencias desde la edad temprana hasta la adolescencia. Es la primera forma que tiene el ni??o/a de expresarse en el mundo (a trav??s de los garabatos), de comunicarse, compartir sus emociones con los dem??s, creando su propio lenguaje que evolucionar?? hacia el lenguaje oral y escri...

  8. Historia editorial con moraleja

    Directory of Open Access Journals (Sweden)

    José Luis de Diego


    Full Text Available Cuando lo conocí, R. ya tendría cuarenta. Un hombre de esos con el pelo como un cepillo, que anda bronceado todo el año, que ostenta ropa de marca y que cuando entra a un boliche estira el cogote, ansioso por conocer a alguien y que otros lo reconozcan a él. Había hecho una buena carrera en Económicas y la influencia decisiva de un profesor le dio la oportunidad de hacer un posgrado en el exterior en algo que llaman Business Process Management, y que ignoro prolijamente qué diablos es, pero c...

  9. Eugenistas, pero con prudencia

    Directory of Open Access Journals (Sweden)

    Pogliano, Claudio


    Full Text Available Thinking that one could not describe eugenics like a unique movement, since numerous bound varians took place related to the geographical and cultural context, this article tries to demostrate the peculiarity of the Italian case. If already in 1889 Giuseppe Sergi wanted that the artificial selection take it to end what should make the natural, avoiding the risk of the so called «degeneration», only in the face of the First World War seems to grow the alarm for the decadent quality of the population, finding a more and more wide echo. In 1919 the Siges was born (Società italiana de genetica ed eugenica shocked under the impression of the difusse fear about the butcher the war had caused. From there from now on fastens a «nazional» direction closely related to the traditional thought and also with the new political temper. A «moderate» direction, Fascist, Catholic, that was built in consonance with the pronatalism of the regime and in rough polemic with the presumed Anglo-Saxon eugenics aberration.

    Partiendo de la base de que no se puede describir la eugénica como un movimiento unitario, ya que se produjeron numerosas variantes ligadas al contexto geográfico y cultural, este artículo intenta demostrar la peculiaridad del caso italiano. Si ya en 1889 Giuseppe Sergi deseaba que la selección artificial llevase a cabo lo que debía de hacer la natural, evitando así el riesgo de la «degeneración », sólo ante la Primera Guerra Mundial parece crecer la alarma por la decadente calidad de la población, encontrando un eco cada vez más amplio. En 1919 nació la Sige (Società italiana de genetica ed eugenica bajo la impresión del difuso temor que la carnicería bélica había provocado. De ahí en adelante prende rápidamente una dirección «nazional» que se imbrica tanto con una tradición del pensamiento como con el nuevo temple político. Una dirección «moderada» fascista, católica, que se construyó en consonancia con el

  10. con problemas de aprendizaje

    Directory of Open Access Journals (Sweden)

    Claudia Jaquelina González Trujillo


    Full Text Available Un grupo de niños con diversos problemas de aprendizaje fue atendido bajo un programa de intervención de integración y adaptación social. Mejoras importantes se obtienen en competencias académicas bajo el presente programa de intervención y delimitan áreas de oportunidad para la mejora en aspectos cognitivos como el del proceso de atención e integración social. Las implicaciones de los resultados se discuten bajo un programa de apoyo psicopedagógico para la educación especial.

  11. Mayonesa con quitosano


    Gaffrey, María Celeste


    Introducción: El quitosano es un polímero natural que se obtiene a partir de la quitina, la cual forma parte de la estructura de soporte de numerosos organismos vivos, tales como artrópodos (crustáceos e insectos), moluscos y hongos. Presenta propiedades aplicables en los alimentos, como estabilizante, emulsificante, y quelante. No puede ser digerido por los seres humanos por lo cual está considerado como una fibra dietética con un contenido calórico cero. Objetivos: Evaluar...

  12. Arquitectura con discurso


    Schaposnik, Viviana


    En particular a la Carrera Arquitectura le compete un doble rol social: uno general, "educar" desde la Universidad y otro, específico, el que le es propio: dar respuesta a las necesidades planteadas por la sociedad haciéndole su lugar: construyéndolo junto con ella. Aparece la figura del "alumno de arquitectura"' nuestro destinatario específico. El alumno de arquitectura, también deberá tomar conciencia, entender, que el "espacio" que él deberá dominar a través de su proyecto, le ser...

  13. Conversando con... BENEDETTA TAGLIABUE


    Torres, Ana; Cabanes, Miguel


    Esta entrevista se realiza en el marco del XIII Congreso Internacional de Expresión Gráfica Arquitectónica realizado en la Escuela Técnica Superior de Arquitectura de Valencia los días 27 al 30 de Mayo de 2010.Benedetta Tagliabue es, en la actualidad, una de las arquitectas con mayor prestigio en el panorama internacional. El Pabellón de España para la Expo de Shanghai 2010, es una de sus últimas obras más representativas, en el que se acentúa y desarrolla un conjunto de características arqui...

  14. Con-tacto


    Arietti, María Luz; Baeza, María Elena; Enriori, Adriana Amalia


    Proyecto de Educación Sexual con modalidad de Taller realizado en todos los años de la Escuela Normal “R.J.Cárcano” de Monte Caseros Corrientes, durante el ciclo lectivo 2008. Áreas: Ciencias Naturales, Educación Física, Artística y Matemática. Se realizó el diagnóstico a partir de una encuesta anónima e individual, para trabajar preconceptos sobre Educación sexual que nos permite indagar las ideas previas y representaciones que los alumnos poseen sobre pubertad, desarrollo, caracteres sec...

  15. Pulsaciones con ondas sonoras


    Beléndez Vázquez, Augusto; Álvarez López, Mariela Lázara; Beléndez Vázquez, Tarsicio; Bernabeu Pastor, José Guillermo; Bleda Pérez, Sergio; Calzado Estepa, Eva María; Campo Bagatín, Adriano; Dale Valdivia, Roberto; Durá Domenech, Antonio; Fernández Varó, Elena; Gallego Rico, Sergi; Hernández Prados, Antonio; Marco Tobarra, Amparo; Márquez Ruiz, Andrés; Martín García, Agapito


    El objetivo de esta práctica es la demostración del efecto de interferencia que se produce al superponerse varias ondas sonoras. Para ello se emplearán dos diapasones con sus cajas de resonancia, un martillo, un micrófono y un ordenador. Los diapasones nos servirán para crear dos señales sonoras de dos únicas frecuencias. El martillo se empleará para golpear los diapasones y así hacerlos vibrar. El micrófono lo emplearemos para captar el sonido generado por los diapasones e introducirlo en el...

  16. Planta de producción de ácido acético


    MeCO (Grup de recerca); Castro Alvaredo, Laura; Fernández Berbel, Natalia; Guillén Montalbán, Marina; Moya Gómez, Marta; Pallarés Mosquera, Sheila; Sierra Martín, César


    El presente proyecto trata sobre el diseño de una planta química para la producción de 75000 toneladas al año de ácido acético. Para la consecución de este objetivo utilizamos la carbonilación en continuo de metanol con monóxido de carbono. No obstante, no comercializaremos un solo producto, si no que se ha de ofertar de dos formas. Por un lado, ácido acético glacial (60% de la producción total), que es una solución de acético que como mínimo ha de contener un 98% de ácido y una concentración...

  17. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques


    Rakan Kh Antar


       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  18. Adaptación cognitiva en madres de niños con síndrome de Down


    Romero, Rosalinda; Morillo, Beatriz


    La presente investigación estuvo dirigida a determinar la Adaptación Cognitiva (AC) en madres de niños con Síndrome de Down (SD). El estudio es descriptivo y estuvo fundamentado en la Teoría de AC, elaborada por S.E. Taylor (1983), que explica el mecanismo de recuperación de las personas ante un evento victimizante. La muestra fue de 83 madres de niños con SD que asisten a los centros educativos del Estado Zulia, Venezuela. Los instrumentos empleados fueron la ...

  19. Entrevista con Geoffrey Lloyd.

    Directory of Open Access Journals (Sweden)

    Fernando Colina Pérez


    Full Text Available Helenista y también sinólogo de relieve internacional, Geoffrey E. R. Lloyd nació en Londres (1933, de padres galeses. Es un gran historiador de la ciencia y del pensamiento griegos. En 1940 fue evacuado de Londres con su madre. Sus estudios significativos comenzaron, tras algún rodeo, en el King’s College donde estudiaba su hermano. Éste sería, como su padre, médico, y él mismo dudó en estudiar esa profesión, que late en sus libros. Pero un profesor de clásicas como John Raven –que redactó, con Geoffrey Kirk, Los filósofos presocráticos–, le indujo a ocuparse de la filosofía antigua; y otro maestro, William Guthrie –a quien debemos la gran Historia de la filosofía griega–, le inició, además, en la medicina griega.

  20. AcEST: BP919203 [AcEST

    Lifescience Database Archive (English)


  1. AcEST: BP918551 [AcEST

    Lifescience Database Archive (English)


  2. AcEST: BP916242 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000085_A03 359 Adiantum capillus-veneris mRNA. clone: YMU001_000085_A03. BP916242 CL74Con ... .....................done Score E Sequences producing s ignificant alignments: (bits) Value sp|P17801|KPRO ... 98 VEMLSQGQKEFLAEIATIGGISHVNIVNLYGFCLEKKHRLLVYEYMENGS VDKWFFCKEG 277 +E + QG++ F AE++ IG I+H+N+V ++GFC E ... HRLLV EY+ENGS + F + G Sbjct: 564 LENVRQGKEVFQAELSVIGRINHMNLVRIWGF ... CSEGSHRLLVSEYVENGS LANILFSEGG 623 Query: 278 EQRQQVMSWETRYNVALGTARGLAY ...

  3. AcEST: BP912991 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_B07 477 Adiantum capillus-veneris mRNA. clone: YMU001_000025_B07. BP912991 CL54Con ... 27914|POLG_DEN2T Genome polyprotein (Fragments) OS=Dengue ... vi... 35 0.16 sp|Q9WDA6|POLG_DEN2Q Genome polyprot ... ein OS=Dengue ... virus type 2 (... 35 0.16 sp|P12823|POLG_DEN2P Gen ...

  4. AcEST: BP918715 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_F09 421 Adiantum capillus-veneris mRNA. clone: YMU001_000116_F09. BP918715 CL17Con ... finition sp|O98997|RCA_PHAAU Ribulose bisphosphate car boxylase/oxygenase activase, chloroplastic OS=Phase ... s) Value sp|O98997|RCA_PHAAU Ribulose bisphosphate car boxylase/oxygenase ... 57 3e-08 sp|Q9ZT00|RCA_MAIZE ...

  5. AcEST: BP913699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_C08 531 Adiantum capillus-veneris mRNA. clone: YMU001_000033_C08. BP913699 CL17Con ... finition sp|O98997|RCA_PHAAU Ribulose bisphosphate car boxylase/oxygenase activase, chloroplastic OS=Phase ... s) Value sp|O98997|RCA_PHAAU Ribulose bisphosphate car boxylase/oxygenase ... 109 6e-24 sp|Q7X999|RCA2_LAR ...

  6. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas


    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  7. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department


    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  8. ac electroosmosis in rectangular microchannels. (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo


    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  9. Entrevista con Juan Marichal.

    Directory of Open Access Journals (Sweden)

    - Consejo de Redacción


    Full Text Available Juan Marichal nació en Santa Cruz de Tenerife, en 1922, en el seno de una familia ligada al partido republicano insular. Muy joven, en 1935, se trasladó a Madrid, ciudad en la que vive el estallido de la guerra civil. En 1937, pasa a Valencia y luego a Barcelona; tras su exilio en 1938, prosigue sus estudios secundarios en un liceo de París, concluyéndolos en Casablanca. En 1941 emigra a México, formándose en la UNAM: fue alumno de los exiliados José Gaos y Joaquín Xirau así como del mexicano Edmundo O 'Gorman. Luego, becado en Princeton desde 1946, lo fue de América Castro, donde preparó una tesis sobre Feijoo. Apoyado en las vastas perspectivas de sus maestros, fue orientándose hada nuestra historia intelectual, desde el siglo XV hasta hoy. Su carrera profesional se ha desarrollado en los Estados Unidos (coincidiendo con Amado Alonso y con Ferrater Mora: ha sido profesor de estudios hispánicos en la Universidad de Harvard, desde 1948 hasta 1988, año en que se jubiló voluntariamente como numerario (aunque había permanecido en el Bryn Mawr College, entre 1953 y 1957. A este trabajo se suman, con todo, sus conferencias en América Latina y en España. Ha colaborado en las revistas más importantes, en este campo, de México, Nueva York, Puerto Rico, La Habana, Buenos Aires o París así como de las españolas, desde los sesenta. Juan Marichal -hoy, miembro de la Junta Directiva de los Amigos de la Residencia de Estudiantes, director del Boletín de la Institución Libre de Enseñanza y asociado al Instituto Universitario Ortega y Gasset-, reside en España desde otoño de 1989: se considera a sí mismo «voluntario en Madrid», como había dicho Alfonso Reyes en su estancia madrileña (1914-1924.

  10. Reinas de acá


    Artigas, Celina


    La más conocida de todas las mariposas de América fue clasificada (en 1874, por Nahuel Parada) con ese nombre por el vasto dominio que cubre esta especie naranja y negra. Es protagonista de una de las migraciones más emocionantes, que tiene en Michoacán, México, un santuario de regreso, declarado Patrimonio de la Humanidad en 2008.

  11. Entrevista con Geoffrey Lloyd.


    Fernando Colina Pérez; Mauricio Jalón


    Helenista y también sinólogo de relieve internacional, Geoffrey E. R. Lloyd nació en Londres (1933), de padres galeses. Es un gran historiador de la ciencia y del pensamiento griegos. En 1940 fue evacuado de Londres con su madre. Sus estudios significativos comenzaron, tras algún rodeo, en el King’s College donde estudiaba su hermano. Éste sería, como su padre, médico, y él mismo dudó en estudiar esa profesión, que late en sus libros. Pero un profesor de clásicas como John Raven –que redactó,...

  12. AcEST: BP920845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  13. AcEST: DK960083 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  14. AcEST: DK955376 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  15. AcEST: BP913416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  16. AcEST: DK947388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  17. AcEST: BP916217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  18. AcEST: DK953324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  19. AcEST: DK945049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  20. Entrevista con Georges Duby.

    Directory of Open Access Journals (Sweden)

    - Consejo de Redacción


    Full Text Available Duby, heredero de dos grandes historiadores como Marc Bloch y Lucien Febvre, es uno de los más importantes medievalistas europeos. Fue, y sigue siendo, un motor de la importante reforma en la historia producida desde los sesenta. En sus primeros trabajos se acusa la recepción de las ideas económicas y geográficas de la mejor historiografía. Su riguroso estudio sobre la base material de la Edad Media, le permitirá luego irrumpir en la historia de las mentalidades, analizando, como decía Febvre, el utillaje mental (vocabulario, sintaxis, lugares comunes, cuadros lógicos, etc. del Medioevo. Así, el ejemplo de Mauss y LéviStrauss le anima a trabajar sobre el matrimonio, la sexualidad y ciertos sistemas del pensamiento: el primero, con su defensa de los hechos sociales totales, y el segundo, que buscaba las dimensiones simbólicas de lo social, le impulsan a trabajar sobre la ideología entendida no como mero reflejo de la situación material sino como «proyecto de acción sobre lo vivido». A su obra individual, atenta a los impulsos culturales más vivos, se suma su empuje decisivo en la realización de proyectos colectivos como la Historia de la vida privada o la Historia de las mujeres. Prácticamente, han sido traducidos todos sus libros al castellano, y han podido verse en España asimismo varios de sus programas televisivos (ha sido presidente de la SEPT, cadena de televisión cultural fundada en 1985. La amplitud de sus intereses intelectuales, transmitidos en su obra con un lenguaje a la vez muy claro y bellamente elaborado, se hace palpable también en este diálogo.

  1. AcEST: BP921296 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000148_A12 535 Adiantum capillus-veneris mRNA. clone: YMU001_000148_A12. BP921296 CL10Con ... 0%), Gaps = 16/100 (16%) Frame = +2 Query: 32 PSLLRPSG PTRGSTGI-------LTRCPSTTPLGLILGPDSPSVDEPC---------GG ... T 163 P++ PSG ... GS+ + +T T P G + GP + SV G T Sbjct: 106 PAMANPSG FG ... GGTLP 283 + SG I + Q A++ TPA A+ G T P Sbjct: 166 AQPSG FNIGSAGNSAQPTAPATLPFTPATPAATTAGATQP 205 >sp|Q8R116| ... , Positives = 30/54 (55%) Frame = +2 Query: 35 SLLRPSG PTRGSTGILTRCPSTTPLGLILGPDSPSVDEPCGGTLRCSGHWILTN 196 ...

  2. AcEST: BP921110 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_G07 435 Adiantum capillus-veneris mRNA. clone: YMU001_000145_G07. BP921110 CL10Con ... me = +2 Query: 86 DGNQPTSAKAEGSLTARPTSRAGTKVGLSDPTVPSG RAVA 205 +G+Q A A+G+ TA ++ GTK LS+ P AVA Sbjct: 250 ... 1239 EKELPGQTLHWGPEATEAAGRGLQPLKLDYRALAAVPSAGSVQRVPSG AAGGKMAES-PC 1297 Query: 182 VPSG R 196 PSG + Sbjct: ... 1298 SPSG Q 1302 >sp|Q4U0G1|CLAP1_XENLA CLIP-associating prot ... e = +2 Query: 83 LDGNQPTSAKAEGSLTARPTSRAGTKVGLSDPTVPSG RA 199 +DGN+P+SA + S A T+R G +G + PS A Sbjct: 247 V ...

  3. AcEST: BP915381 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000070_G12 484 Adiantum capillus-veneris mRNA. clone: YMU001_000070_G12. BP915381 CL10Con ... e = +1 Query: 151 DGNQPTSAKAEGSLTARPTSRAGTKVGLSDPTVPSG RAVA 270 +G+Q A A+G+ TA ++ GTK LS+ P AVA Sbjct: 250 ... Positives = 33/68 (48%) Frame = +1 Query: 235 SDPTVPSG RAVAQRIKVTLGITG*SSPRVHIDGKVWHLDVGSSPPGAVVRPKGWAVRPL ... 1239 EKELPGQTLHWGPEATEAAGRGLQPLKLDYRALAAVPSAGSVQRVPSG AAGGKMAES-PC 1297 Query: 247 VPSG R 261 PSG + Sbjct: ... 1298 SPSG Q 1302 >sp|Q4U0G1|CLAP1_XENLA CLIP-associating prot ...

  4. AcEST: BP912585 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CAAAATAGAACACAGCATAT CACAAAGTAACTGTATGAGGTGGTGGCCAGCTTGCTTGGTGGTCAATATGG ■■Homology searc...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25...: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching........ Value sp|Q3U492|CRIM2_MOUSE Cysteine-rich motor neuron 2 protein OS=Mu... 30 2.8 sp|Q0KHY3|Y1004_DROME Extracellular... CERCRCLAGQVSCTRLQCPSLPCLHQV 947 >sp|Q0KHY3|Y1004_DROME Extracellular domains-con

  5. AcEST: BP917488 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_D10 357 Adiantum capillus-veneris mRNA. clone: YMU001_000101_D10. BP917488 CL27Con ... n 771 OS=Homo sapiens GN... 32 1.00 sp|O76743|GLH4_CAE EL ATP-dependent RNA helicase glh-4 OS=Cae norh... 3 ... roplastic OS=Chlamydomona... 30 4.9 sp|P34307|YKR1_CAE EL KH domain-containing protein C06G4.1 OS=Cae ... 2 ...

  6. autorregulado con estudiantes universitarios

    Directory of Open Access Journals (Sweden)

    Jairo Andrés Montes


    Full Text Available El propósito del presente estudio es describir la forma en la que se presentan los procesos de aprendizaje autorregulado con un grupo de estudiantes (22 estudiantes de tercer semestre de Psicología de la PUJ, Cali, en el evento de preparación para la presentación un examen. Asimismo se describen las correlaciones que ocurren entre las distintas fases de dicho proceso de autorregulación del aprendizaje. Para conseguir los objetivos propuestos se ha hecho uso de una observación de desempeño en tiempo real, es decir, de la observación durante una sesión de preparación de examen de los estudiantes, en la cual se emplearon protocolos verbales para dar cuenta de lo que «pasaba por su mente» mientras estudiaban. Una entrevista semi-estructurada y una prueba objetiva. Los resultados fueron analizados a la luz del modelo mixto de procesamiento de información y constructivismo abordado por Winne(1998. Como resultado se encontró una relación significativa entre los niveles de desempeño en el proceso de ARR y el resultado del examen. Igualmente se encontraron bajos niveles de regulación en una parte importante de la muestra y un desfase significativo entre conocimiento declarativo de ARR y desempeño en el mismo



    M.A INAYATHULLAAH,; Dr. R. Anita


    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  8. Calentamiento global con Scratch y escuelas eficientes con Arduino


    Ainzua Cemborain, José Ignacio


    Este trabajo final de máster está formado por dos proyectos con metodología de aprendizaje basado en proyectos (ABP). El primero de ellos se realiza en la asignatura de Tecnología y en coordinación con la asignatura de Ciencias Naturales, y el segundo únicamente para Tecnología. En la primera parte del proyecto se analiza la metodología ABP utilizada y se compara con la tradicional. Posteriormente se estudian las tres herramientas utilizadas en este proyecto como son; Scratch, Scratch for...

  9. AcEST: BP917821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TLAVDAKNLLD 992 >sp|A9FD62|LIPA_SORC5 Lipoyl synthase OS=Sorangium cellulosum (strain So ce56) GN=lipA PE=3 ...E28 Definition sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa Ali... (bits) Value sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis and coiled-coil domain-con... 29 7.8 >sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofeli...ld_1, whole... 33 9.1 tr|Q6C6J7|Q6C6J7_YARLI YALI0E09012p OS=Yarrowia lipolytica

  10. AcEST: BP916695 [AcEST

    Lifescience Database Archive (English)

    Full Text Available HUMAN Calcium-binding and coiled-coil domain-con... 35 0.14 sp|A9BGT9|SYC_PETMO Cysteinyl-tRNA synthetase OS=Petrotoga mobil...bium phaeobacteroides (strain DSM 266) GN=frr PE=3 SV=1 Length = 186 Score = 38.1 bits (87), Expect = 0.022 Identities...clic-nucleotide 2'-phosphodiesteras... 34 0.32 sp|Q2KJ21|CACO1_BOVIN Calcium-binding and coiled-coil...R 506 >sp|A9BGT9|SYC_PETMO Cysteinyl-tRNA synthetase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=cysS ... OS=Homo sapiens GN=MYH11 PE=1 SV=3 34 0.42 sp|A6QNP9|CCD69_BOVIN Coiled-coil domain-containing protein 69 O

  11. AcEST: BP915953 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tos... 30 2.8 sp|P25259|T2C2_HERAU Type-2 restriction enzyme HgiCII OS=Herpeto... 30 3.7 sp|Q5R809|TMED5_PONAB Transmembran...g prot... 29 6.3 sp|Q10033|YSI1_CAEEL Uncharacterized protein F15G9.1 OS=Caenorha... 29 8.2 sp|Q6AXN3|TMED5_RAT Transmembran...e emp24 domain-containing prot... 30 4.8 sp|Q9Y3A6|TMED5_HUMAN Transmembrane emp24 domain-con...taining prot... 30 4.8 sp|Q2KJ84|TMED5_BOVIN Transmembrane emp24 domain-containin...SL T L + Sbjct: 63 MRLNRFERSLSTGLGS 78 >sp|Q5R809|TMED5_PONAB Transmembrane emp24 domain-containing protein

  12. Entrevista con Alberto Tenenti.

    Directory of Open Access Journals (Sweden)

    - Consejo de Redacción


    Full Text Available Gran especialista en historia moderna, Alberto Tenenti nació en Viareggio, en 1924. Tras realizar estudios superiores en Italia, trabajó en el Centre National de la Recherche Scientifique varios años, asesorado por Lucien Febvre. Ha dirigido el Archivo del Estado de Brescia; y, más tarde, ha enseñado en París, desde una cátedra en la École Pratique des Hautes Études en Sciences Sociales (VI Sección, alIado de Braudel. Su Il senso della morte e l'amore della vita nel Rinascimento, de 1957, es una obra maestra sobre los orígenes de la sensibilidad moderna: sin olvidar el naciente vitalismo, estudia el desarrollo de dos motivos, el del ars moriendi, que tiene su evolución propia desde 1350 hasta su difusión impresa, y el de lo macabro, que refleja la crisis de conciencia del siglo XV y adquiere «unas dimensiones desconocidas y verdaderamente anormales». En este libro sobre un problema clave como la muerte, apela de modo notable a la iconografía: Tenenti ha recordado que la cultura tradicional, eclesiástica sobre todo, percibió un mayor peligro en la capacidad de reflexión autónoma y de crítica de los hombres de letras, que en las renovaciones radicales de los artistas. Numerosos trabajos de conjunto realizados por él han perseguido una historia global: Los fundamentos del mundo moderno; Florencia en la época de los Medicis; La formación del mundo moderno; El Renacimiento; el primero de ellos estaba firmado con un historiador de su misma generación, R. Romano, estudioso de las relaciones comerciales en la época moderna en Europa y en la América española. Tenenti ha publicado monografías (Venezia e i corsari, 1961, colecciones de artículos (Credence, ideologie, libertinismi tra medioevo ed eta moderna, 1978; Stato: un'idea, una logica. Dal comune italiano all'assolutismo francese, 1987 y editado a clásicos como Il libri della famiglia de L. B. Alberti, 1969. Es también especialista en temas económicos, como el del

  13. Sensor perfeccionado para la medida de la toxicidad del agua


    Campo García, Francisco Javier del; Mas Gordi, Jordi


    La invención se basa en un sensor de medida para la toxidad del agua y consiste en una red de micro-electrodos recubiertos de una membrana y de un biofilm. La red de micro-electrodos puede ser estándar, y es posible su funcionamiento con un único electrodo, aunque ello acarrearía una perdida de sensibilidad. La membrana se usa para evitar la pasivación del electrodo por las bacterias presentes en el agua, y se utilizará en una de las realizaciones posibles "Nafion", aunque también es posible ...

  14. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke


    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  15. Propiedades acústicas de los paneles de carrizo

    Directory of Open Access Journals (Sweden)

    Díaz, César


    Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems. This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.

    El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos. En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.

  16. Noise reduction in AC-coupled amplifiers


    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon


    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  17. Protocolo de mejora de la accesibilidad a personas con discapacidad auditiva en el medio


    Espínola Jiménez, Antonio


    Este trabajo nace con el objetivo de recopilar toda la información y medidas necesarias para alcanzar la plena accesibilidad universal y autonomía para personas con discapacidad auditiva en cualquier espacio. Para ello, se analizan las características del espacio y se verifica toda la normativa existente al respecto. Además, se hace un breve estudio de las características de los diferentes materiales de construcción para comprobar cómo interfiere la acústica del espacio en l...

  18. Diccionarios basados en taxonomías con estructura de grafo orientado acíclico


    Vaquero Sánchez, Antonio; Álvarez Montero, Francisco; Sáenz Pérez, Fernando


    Al irse multiplicando las bases de datos léxicas en diferentes formatos, ha crecido también la preocupación acerca del nivel de reusabilidad de los recursos léxicos. El intercambio e integración de datos, así como el desarrollo de software común, son importantes para evitar duplicaciones de esfuerzos y posibilitar el desarrollo de bases de datos de información lingüística a gran escala. Es necesario un enfoque unificado en el desarrollo de herramientas para la creación y gestió...

  19. con el aborto provocado

    Directory of Open Access Journals (Sweden)

    José Luis Redondo Calderón


    Full Text Available Las vacunas de células diploides humanas (WI-38, MRC-5 tienen un origen éticamente objetable, dado que dichas células proceden de abortos provocados. Entre ellas destacan vacunas empleadas contra rubéola, sarampión, parotiditis, rabia, poliomielitis, viruela, hepatitis A, varicela y herpes zóster. Actualmente se encuentran en desarrollo otras vacunas cultivadas en células (293, PER.C6 transformadas mediante virus, procedentes de abortos. Entre ellas hay vacunas contra la gripe, virus respiratorio sincitial, parainfl uenza, HIV, virus del Nilo Occidental, virus Ébola, Marburg y Lassa, hepatitis B y C, glosopeda, encefalitis japonesa, dengue, tuberculosis, carbunco, peste, tétanos y paludismo. También con igual origen se trabaja en la elaboración de anticuerpos monoclonales y otras proteínas, terapia génica y genómica. Existe la tecnología necesaria para producir todo lo descrito sin recurrir a abortos provocados. Debe indicarse en los prospectos de vacunas y otros productos el origen de las células empleadas. Debe facilitarse el acceso a las vacunas existentes no cultivadas en células procedentes de abortos provocados. Debe potenciarse la investigación de opciones en aquellos casos en los que no exista una vacuna no originada en células procedentes de abortos provocados. Debe potenciarse la elaboración de anticuerpos monoclonales y de otras proteínas, así como la terapia génica y la genómica sin recurrir a células procedentes de abortos provocados. No sería consecuente rechazar productos obtenidos a partir de células troncales embrionarias y aceptar los originados en células procedentes de abortos provocados. Se debe evitar que la biotecnología basada en el aborto provocado invada todos los terrenos de la medicina.

  20. Nanoparticulas basadas en complejos de Fe(II) con transicion de espin: sintesis, caracterizacion y aplicaciones en electronica molecular (United States)

    Monrabal Capilla, Maria

    sintesis de otro nuevo tipo de nanoparticulas, obtenidas a partir de otro polimero de la misma familia, el [FeO8ZnO2(Htrz)3](BF4). Estas nanoparticulas se sintetizaron con el objetivo de estudiar el efecto de la dilucion del metal en la muestra. Como resultado se obtuvieron nanoparticulas que tambien presentan una estrecha distribucion de tamanos pero en este caso la transicion de espin no es tan abrupta como en los casos anteriores. Aunque sigue presentando un ciclo de histeresis termica bastante ancho y a temperaturas proximas a la temperatura ambiente. En el capitulo 4 se describiran las estrategias que se han seguido para mejorar la estabilidad y afinidad sobre diferentes sustratos de las nanoparticulas sintetizadas en el capitulo 2. Tambien se hablara de los intentos realizados parar depositarlas en superficies y embeberlas en diferentes matrices organicas e inorganicas. En el capitulo 5 presentaremos la obtencion de un interruptor molecular realizado poniendo en contacto nanoparticulas individuales sintetizadas en el capitulo 2, con unos electrodos separados varios nanometros. Este dispositivo exhibe "switching" y efecto memoria a temperaturas proximas a la temperatura ambiente como consecuencia de la biestabilidad intrinseca de las nanoparticulas. Ademas demostraremos que el estado magnetico de estas nanoparticulas puede ser controlado electricamente, ya que la transicion de espin en este nanodispositivo molecular puede ser inducida simplemente aplicando un voltaje, lo que puede ser de gran interes para la electronica molecular.

  1. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  2. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E


    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  3. Una experiencia con los kuna


    Villalobos, Leonor Cristina de


    Me encuentro en la difícil tarea de materializar en palabras una experiencia única. De transmitir sensaciones y vivencias cargadas de magia que desestructuraron en gran medida lo que hasta ese momento formaba parte de mi vida. Es así como puedo definir mi experiencia con los indios Kuna. Tuve la oportunidad de convivir con ellos dos meses, invitada por investigadores de la Universidad de Miami, para realizar estudios sobre ectoparasitosis que afectan a esta comunidad india.

  4. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System


    Marian GAICEANU; Emil ROSU


    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  5. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)


    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  6. con mala calidad de vida

    Directory of Open Access Journals (Sweden)

    Agustín Martín-Rodríguez


    Full Text Available En este estudio ex post facto se ha analizado si los familiares de pacientes con mala calidad de vida presentan diferencias en las variables clínicas de personalidad y relaciones familiares en función de que el paciente haya estado o no ingresado en una Unidad de Cuidados Intensivos. Seleccionamos dos grupos: 29 familiares de pacientes traumatizados graves transcurridos cuatro años de su ingreso en una UCI de Traumatología y con mala calidad de vida (debido a secuelas físicas y/o psicológicas tras el ingreso, tales como traumatismos craneoencefálicos, politraumatismos y tetraplejias traumáticas y 32 familiares de pacientes con mala calidad de vida con cuatro años de evolución de su enfermedad física (hipertensión, diabetes, artritis reumatoide y síndrome de intestino irritable que no han estado ingresados en la UCI. Para alcanzar nuestro objetivo empleamos una Encuesta Psicosocial y los siguientes instrumentos: Cuestionario de Análisis Clínico, Escala de Clima Social en la Familia y Escala de Adaptación Psicosocial de la Enfermedad. Los resultados mostraron que los familiares de pacientes con mala calidad de vida que estuvieron ingresados en la UCI hace cuatro años, presentan diferencias significativas en las variables agitación y expresividad comparados con los familiares de pacientes con mala calidad de vida que no han estado ingresados en la UCI.

  7. Tratamiento con implantes Leader-Nano en paciente con oligodoncia


    Salvador Javier Santos Medina; Mayelín Cruz Acosta; Danilo Córdova González


    Los implantes dentales de titanio han revolucionado el mundo de la rehabilitación desde su surgimiento. De manera particular, el empleo de implantes de carga inmediata acorta el tiempo quirúrgico y protésico, con el consiguiente bienestar estético. Se presenta el caso de una paciente femenina de 32 años de edad, con antecedentes de oligodoncia de ambos incisivos laterales superiores y portadora de prótesis parcial acrílica. Fue atendida por el equipo multidisciplinario de implantes en la Clín...

  8. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.


    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  9. Study of pressing effects and variation in Pt charge in the anode on the performance of membrane electrode assemblies; Estudio de los efectos de prensado y variacion de la carga de Pt en el anodo en el rendimiento de ensambles membrana-electrodo

    Energy Technology Data Exchange (ETDEWEB)

    Albarran S, Irma Lorena; Flores Hernandez, J. Roberto; Cano Castillo, Ulises [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico). E-mail:; Loyola, Felix (UNAM, Facultad de Quimica, Mexico D.F. (Mexico)


    Fabricating membrane electrode assemblies (MEA) involves different variables that determine their performance, such as: amount of the catalyst, concentration of the different solvents used in the fabrication of the catalyst dye, use of a thermomechanical process to increase the degree of adhesion between the catalyst layers and the membrane, etc. This work studied the effect of the Pt charge in the anode on performance, as well as the effect of the thermomechanical process on the fabrication of MEAs. It is evident that the optimal Pt charge should be that which provides good performance during an acceptable useful lifetime at a competitive cost. This work presents the results obtained by varying the Pt charge in the anode between 1.0 and 0.4 mgPt/cm{sup ²} while maintaining a constant charge of 1 mgPt/cm{sup ²} in the cathode. It also shows the comparison between the polarization curves and the active areas obtained in the MEAs with and without pressing during their fabrication. [Spanish] En la fabricacion de los Ensambles Membrana-Electrodo (MEA's) intervienen diferentes variables que determinan su desempeno, como lo son: cantidad de catalizador, concentracion de los diferentes solventes que se emplean en la fabricacion de la tinta catalitica, el uso de un proceso termomecanico para incrementar el grado de adherencia entre las capas cataliticas y la membrana, etc. De las variables anteriormente mencionadas, en este trabajo se estudio el efecto de la carga anodica de Pt en el desempeno, asi como del proceso termomecanico en la fabricacion de MEA's. Es evidente que la carga optima de Pt debe ser aquella que proporcione un buen rendimiento por un periodo de vida util aceptable a un costo competitivo. En este trabajo se presentan los resultados obtenidos al variar la carga de Pt en el anodo entre 1.0 a 0.4 mgPt/cm{sup ²} manteniendo una carga constante de 1 mgPt/cm{sup ²} en el catodo. Tambien se muestra la comparacion de las curvas de polarizacion y las

  10. Entrevista con Hans Robert Jauss.

    Directory of Open Access Journals (Sweden)

    - Consejo de Redacción


    Full Text Available El importante teórico y crítico literario alemán nació en 1921. Tras el largo paréntesis de la segunda guerra mundial, Jauss realizará sus estudios superiores, a partir de 1948, en Heidelberg, licenciándose en filología románica. Se doctora pronto con una tesis, publicada en 1955, sobre el tiempo y el recuerdo en la obra capital de Marcel Proust, En busca del tiempo perdido, y se habilita en 1957 con un trabajo sobre la epopeya animal en la Edad Media. A continuación, escribe un conjunto de estudios sobre la alegoría, y codirige con el gran especialista Erich Kohler una monumental historia de la literatura medieval, campo al que ha dedicado otros artículos, a la par que proseguía sus investigaciones iniciales.

  11. AC losses in filamentary YBCO/hastelloy

    International Nuclear Information System (INIS)

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  12. Tratamiento con implantes Leader-Nano en paciente con oligodoncia

    Directory of Open Access Journals (Sweden)

    Salvador Javier Santos Medina


    Full Text Available Los implantes dentales de titanio han revolucionado el mundo de la rehabilitación desde su surgimiento. De manera particular, el empleo de implantes de carga inmediata acorta el tiempo quirúrgico y protésico, con el consiguiente bienestar estético. Se presenta el caso de una paciente femenina de 32 años de edad, con antecedentes de oligodoncia de ambos incisivos laterales superiores y portadora de prótesis parcial acrílica. Fue atendida por el equipo multidisciplinario de implantes en la Clínica Estomatológica Docente “3 de Octubre” y se le realizó tratamiento de rehabilitación integral con implantes Leader-Nano y prótesis fija con corona acrílica sobre dichos implantes. La implantología fue satisfactoria en la paciente; la mejoría estética y funcional, así como la satisfacción de la paciente, fueron los principales logros obtenidos

  13. Carlstad Comic Con : En fallstudie


    Fors, Marcus Gabriel


    This is a case study of Carlstad Comic Con 2011 and 2012.The purpose is to study the event in relation to a project management and a local culture policy perspective. This in order to analyze the organization of a popular culture event and see how such a local event may benefit Karlstad as a city. Besides studying the organization of Carlstad Comic Con and its outcomes I am sketching a short cultural history of popular culture media and its context within recent year’s globalization.The study...

  14. con dietas suplementadas con Cromo-L-metionina

    Directory of Open Access Journals (Sweden)

    Ram\\u00F3n Garc\\u00EDa-Castillo


    Full Text Available Un total de 48 cerdos (Sus scrofa domesticus; 24 machos castrados y 24 hembras cruzados (Yorkshire, Hampshire, Duroc y Landrace de 3,5 a 4,0 meses de edad y 60,0 ± 5,0 kg PV en finalización. Se alimentaron con dietas isoproteícas (14,5 % PC e isoenergéticas (3.400 kcal EM/kg de MS, adicionadas con Cr-L-metionina (MiCroPlex® (0, 200, 400 y 600 ppb. El experimento tuvo una duración de 45 días y se realizó de agosto a noviembre del 2002 en las instalaciones de la Universidad Autónoma Agraria Antonio Narro, localizada en Saltillo, Coahuila, México. Al tener los animales aproximadamente 95 kg PV, se tomó muestra de 15 ml de sangre por cada animal para determinar la concentración de glucosa, ácido úrico, creatinina, urea, proteinas totales y colesterol. Se aplicó un diseño completamente al azar con arreglo factorial 2 x 4; dos para el factor sexo y cuatro para nivel de cromo. Los metabolitos en suero no fueron afectados (P>0,05 por el factor sexo. La glucosa en suero disminuyó (P<0,05 y el colesterol incrementó (P<0,05 con cromo en la dieta. Se concluye que el Cr incrementa el metabolismo de glucosa y disminuye el de colesterol, con lo cual puede haber energía disponible para síntesis de proteína la cual es necesaria para el crecimiento de los animales

  15. AC loss performance of CS insert coil

    International Nuclear Information System (INIS)

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  16. ac propulsion system for an electric vehicle (United States)

    Geppert, S.


    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  17. La atención a los padres con hijos con necesidades educativas especiales (NEE)


    Claudia María Pernas Pico


    Los padres que tienen hijos con necesidades educativas especiales (NEE) necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, et...

  18. Análisis espacio-temporal con SIG del ruido ambiental urbano en Madrid y sus distritos


    Martínez Suárez, Pedro; Moreno Jiménez, Antonio


    La principal aportación de este artículo estriba en obtener y presentar una caracterización pionera del ruido ambiental en el ámbito urbano de la metrópoli madrileña, como un componente del llamado “paisaje sonoro”. Contando con la novedad del plano acústico, que por primera vez cubre la ciudad, se afronta la tarea de analizar espacio-temporalmente la intensidad acústica urbana. A tal fin se examinan los periodos diurno y nocturno, las variaciones día-noche y los niveles sonoro...

  19. AC loss in superconducting tapes and cables (United States)

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  20. ACS air bearing test-bed design


    Glitt, Sascha


    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  1. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing


    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  2. Juegos con monedas y palillos


    Cobarro, Trinidad


    Es frecuente entre nosotros, los que nos dedicamos a la enseñanza de las matemáticas por muy grande que sea nuestro amor por la materia y el deseo de comunicación, nos encontrarnos con un problema: ¿cómo mantener interesados a los alumnos?

  3. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S


    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)


    Directory of Open Access Journals (Sweden)



    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  5. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769. (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming


    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  6. Diseño y desarrollo de la técnica de susceptibilidad magnética AC: aplicación al estudio de cintas magnéticamente blandas


    Velásquez Salazar, Abilo Andrés


    Este trabajo es un informe pormenorizado sobre el diseño y desarrollo de la técnica de susceptibilidad AC implementada en el laboratorio de Magnetismo y Materiales Avanzados de la universidad Nacional de Colombia sede Manizales. La técnica desarrollada se encuentra implementada para realizar medidas de susceptibilidad AC en cintas magnéticamente blandas a temperatura ambiente. Este informe cuenta con una contextualización y una justificación que ubica la medida de la susceptibilidad AC en la ...

  7. AC power generation from microbial fuel cells (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason


    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  8. Performance of Halbach magnetized brushless AC motors


    Zhu, Z.Q.; Xia, Z.P.; Shi, Y.F.; Howe, D.; Pride, A.; X. J. Chen


    The steady-state performance of Halbach magnetized brushless ac machines when operated in constant torque and flux-weakening modes is investigated both theoretically and experimentally, with particular emphasis on the influence of cross-coupling magnetic saturation on the torque capability.

  9. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  10. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter


    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  11. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)


    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  12. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak


    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  13. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte (United States)

    Abbas, Qamar; Béguin, François


    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  14. Rapid cycling synchrotron magnet with separate ac and dc circuit

    International Nuclear Information System (INIS)

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  15. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique


    Sagar.S.Pawar; Prakash.T.Patil


    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  16. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar


    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  17. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters


    Pawel Szczesniak


    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  18. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.


    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  19. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter


    S. Arumugam S. Ramareddy M. Sridhar


    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  20. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters


    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara


    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  1. Robust control of synchronous motors through AC/DC/AC converters


    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara


    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  2. A new class of hybrid AC/AC direct power converters


    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick


    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  3. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.


    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  4. Alumnos con necesidades educativas especiales


    Álvarez Pérez, Luis


    El objetivo de este trabajo es delimitar el concepto de alumno con necesidades educativas especiales y determinar como se tiene que abordar su educación en el marco del proyecto educativo de centro. Además se pretende establecer un modelo operativo para consignar las adaptaciones curriculares que sea preciso adoptar en función de las orientaciones establecidas en la evaluación previa

  5. Haciendo arquitectura con la gente


    Doble Vía


    Construir en la memoria colectiva de los individuos, el rol del arquitecto en relación con la sociedad, es el objetivo del proyecto. Para ello propone establecer reciprocidad, entre un organismo educativo como la Facultad, un organismo político como una Delegación, y la gente. (Párrafo extraído del texto a modo de resumen)

  6. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  7. pacientes con insuficiencia renal terminal

    Directory of Open Access Journals (Sweden)

    Karen Herrera Herrera


    Full Text Available La presente investigación fundamenta en la clínica psicoanalítica el estudio de dos casos de tres personas diagnosticadas con IRT que reciben tratamiento de hemodiálisis, en razón a que dadas las características y el aumento de los reportes que se presentan, ya esto se considera un problema de salud pública. El objetivo principal es describir las características dinámicas del proceso de duelo en pacientes con IRT en un centro de terapia renal de la ciudad de Cartagena. El procedimiento metodológico empleó un diseño de tipo cualitativo; la investigación se desarrolló con un diseño clínico mediante el estudio de casos, y fundamentada en la hermenéutica psicoanalítica. Todo esto respaldado en la historia clínica, la entrevista semiestructurada individual y familiar, los test proyectivos, test del dibujo de la figura humana Machover y TAT de Murray, para la debida integración de los análisis. Se concluye que predominan funciones fallidas de los progenitores y que son individuos provenientes de familias psicosomáticas, que utilizan la enfermedad para obtener un beneficio secundario.

  8. 21 CFR 880.5500 - AC-powered patient lift. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  9. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊


    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  10. A New Approach for Benefit Evaluation of Multiterminal VSC–HVDC Using A Proposed Mixed AC/DC Optimal Power Flow


    Feng, Wang; Tuan, Le; Bertling Tjernberg, Lina; Mannikoff, Anders; Bergman, Anders


    In this paper, an extended optimal power-flow (OPF) model incorporating a detailed model of a voltage-source con- verter-based–multiterminal high-voltage direct current system (VSC–MTDC) is proposed, hereafter referred to as the mixed ac/dc OPF (M-OPF) model. A cost-benefit analysis approach using the M-OPF model as the calculation engine is proposed to determine the preferred VSC-MTDC alternative to be installed in an existing ac transmission system. In this approach, the op- erational benef...

  11. El territorio inmediato de Kelin en época ibérica (siglos IV-III a.C.): estrategias productivas y poblacionales


    Moreno Martín, Andrea; Quixal Santos, David


    Kelin (Caudete de las Fuentes, València) es un oppidum ibérico con una ocupación entre finales del siglo VII hasta el I a.C., que se consolida como lugar central ya a finales del V a.C. Kelin organizó su territorio en base a un patrón de asentamiento jerarquizado que incluía asentamientos de rango superior (oppida), granjas, caseríos y establecimientos rurales, atalayas fortificadas y lugares cultuales como necrópolis, cuevas y santuarios. Nuestra intención es analizar el entorno del yacimien...

  12. Arqueoacústica maya. La necesidad del estudio sistemático de efectos acústicos en sitios arqueológicos


    Clara Garza; Andrés Medina; Pablo Padilla; Alejandro Ramos; Francisca Zalaquett


    En este trabajo se discute la necesidad de sistematizar el estudio de los efectos acústicos en sitios arqueológicos, en especial los concernientes a la cultura maya. Presentamos un panorama del estado actual de estudios tanto antropológicos como los relacionados con modelos matemáticos. Después de presentar una introducción general y una discusión sobre lo que consideramos debería constituir un marco básico para un enfoque arqueoacústico, abordamos los antecedentes de trabajos sobre acústica ...

  13. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  14. Electrodos para supercondensadores obtenidos por electrodeposición


    Aldama Amado, Iván


    Tesis doctoral inédita leída en la Universidad Autónoma de Madrid, Facultad de Ciencias, Departamento de Química Inorgánica. Fecha de lectura: 17-11-2015 Los supercondensadores son dispositivos de almacenamiento de energía que tienen alta densidad de potencia (hasta 10 kW/kg), tiempos cortos de carga y descarga (1-30 s) y alta ciclabilidad (1 000 000 de ciclos de carga/descarga). La principal desventaja es la baja densidad de energía (hasta 5 Wh/Kg), muy inferior a la densidad de ...

  15. Fractional ac Josephson effect in unconventional superconductors

    International Nuclear Information System (INIS)

    For certain orientations of Josephson junctions between two px-wave or two d-wave superconductors, the subgap Andreev bound states produce a 4π-periodic relation between the Josephson current I and the phase difference ψ: I propor to sin(ψ/2) . Consequently, the ac Josephson current has the fractional frequency eV/h where V is the dc voltage. In the tunneling limit, the Josephson current is proportional to the first power (not square) of the electron tunneling amplitude. Thus, the Josephson current between unconventional superconductors is carried by single electrons, rather than by Cooper pairs. The fractional ac Josephson effect can be observed experimentally by measuring frequency spectrum of microwave radiation from the junction

  16. AC motor drive system for electric cars

    Energy Technology Data Exchange (ETDEWEB)

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))


    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  17. β-delayed fission from 230Ac

    International Nuclear Information System (INIS)

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  18. AC Dielectrophoresis Using Elliptic Electrode Geometry


    S. M. Rezaul Hasan; Aanan Khurma


    This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number) fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of...

  19. Lazy AC-Pattern Matching for Rewriting

    CERN Document Server

    Belkhir, Walid; 10.4204/EPTCS.82.3


    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  20. Entropy production in ac-calorimetry


    Garden, Jean-Luc; Richard, Jacques


    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  1. Experimentos GPS con estaciones virtuales


    Afailal, Sara; Rueda Galcerán, José Diego


    En múltiples ocasiones aceptamos como correcta la información nominal que aparece en los manuales de los fabricantes de receptores GPS. En esta información nos muestran una precisión esperable a la hora de obtener resultados, siguiendo ciertos métodos de observación en ciertas condiciones. Teniendo en cuenta que los datos los procesamos con un software de cálculo de vectores, que a su vez tiene también una precisión esperable, hemos querido hacer una serie de experimentos desde estaciones vir...

  2. Estudio de funciones con geogebra


    Benedicto Baldonado, Clara


    Nuestra investigación, “Estudio de funciones con GeoGebra”, se ha desarrollado en el “Máster Universitario en Profesor de Educación Secundaria” de la Universitat de València. El estudio se centra en cómo alcanzar una correcta comprensión de los conceptos referidos a funciones haciendo uso del GeoGebra. El problema que motiva esta investigación radica en que, en los cursos tradicionales de 2º de Bachillerato, cantidades significativas de estudiantes no logran comprender los conceptos básico...

  3. Tratamiento del paciente con artrosis


    Francisco Vargas Negrín; María D. Medina Abellán; Juan Carlos Hermosa Hernán; Ricardo de Felipe Medina


    El manejo terapéutico del paciente con artrosis tiene como objetivo disminuir la sintomatología dolorosa e inflamatoria, mejorar la capacidad funcional del paciente y la aplicación de intervenciones terapéuticas eficaces y lo más seguras posibles. Un enfoque centrado en el paciente implica su participación activa en el diseño del plan terapéutico y en la toma de decisiones informadas oportunas en todas las etapas de la enfermedad. La educación terapéutica, la actividad física y el ejercicio t...


    Directory of Open Access Journals (Sweden)

    Alejandra Bravo Del Toro


    Full Text Available El presente estudio analizó los rasgos de personalidad con mayor incidencia en una población mexicana con obesidad. Se distinguieron los rasgos que intervienen en el funcionamiento diario de los sujetos. La muestra estuvo conformada por 60 pacientes: 31 hombres y 29 mujeres, con edades de 30 a 40 años, casados, con nivel educativo básico y que acudían a consulta médica en un centro de diagnóstico clínico, con antecedentes de obesidad. Se utilizó el perfil-inventario de la personalidad de Gordon, según el cual se comprobó que los pacientes con obesidad tienden a mostrar rasgos de personalidad por debajo de la norma. Los análisis demostraron relaciones significativas entre la gente obesa y cada uno de los rasgos de personalidad con menor prevalencia que mide la escala.

  5. Development of a hardware-based AC microgrid for AC stability assessment (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  6. Food irradiation - pros and cons

    International Nuclear Information System (INIS)

    The use of ionising radiation for food preservation is a much-disputed topic, both among experts and among consumers. Pros and cons of this issue were discussed in detail at the consumers' forum. Professor Dr. Johannes Friedrich Diehl, Director of the Institute for Biochemistry of the Food Research Centre, Karlsruhe, is a well-known supporter of the new method of food preservation; he sees advantages in the radiopreservation of food because, for example, losses due to inedibility are reduced, the danger of salmonellosis is decreased, just as the use of chemicals. He thinks this method to be without danger to health, shown by many years of experience. Opponents to food irradiation like Prof. Dr. Konrad Pfeilsticker, Professor for food science and food chemistry at the Bonn University deem the method to be unnecessary and raise the problem of qualitative changes caused in the food. In the course of the discussions, the pros and cons seemed to balance each other out. (orig./AJ)

  7. Tratamiento del paciente con artrosis

    Directory of Open Access Journals (Sweden)

    Francisco Vargas Negrín


    Full Text Available El manejo terapéutico del paciente con artrosis tiene como objetivo disminuir la sintomatología dolorosa e inflamatoria, mejorar la capacidad funcional del paciente y la aplicación de intervenciones terapéuticas eficaces y lo más seguras posibles. Un enfoque centrado en el paciente implica su participación activa en el diseño del plan terapéutico y en la toma de decisiones informadas oportunas en todas las etapas de la enfermedad. La educación terapéutica, la actividad física y el ejercicio terapéutico junto con el control de peso, en caso de sobrepeso u obesidad, constituyen el núcleo central del tratamiento. Los autocuidados individuales y por los familiares son fundamentales en el control del día a día del paciente. El uso de terapias físicas, ayudas técnicas (bastón, etc. y de fármacos tipo analgésicos simples, opioides y antiinflamatorios tiene evidencias demostradas en el control del dolor, mejora la funcionalidad y la calidad de vida del paciente y una clara recomendación de uso en el tratamiento de la artrosis. La cirugía conservadora y la de reemplazo articular se indican en los casos en los que no se logran los objetivos terapéuticos en casos concretos.

  8. Resistencia a los cloruros en el concreto adicionado con escoria de alto horno


    Naliett Karina Santamaría Díaz; Luis Eduardo Yamín Lacouture; Carlos Alberto Arcila López


    Para evaluar la resistencia a los cloruros en diferentes mezclas de concreto se realizó el ensayo de permeabilidad rápida a cloruros, estipulado en la norma ASTM 1202. Para ello se utilizó un equipo hecho en el país que sigue los requerimientos dados por esta norma. Se ensayaron concretos con 6 diferentes relaciones agua/cementante (a/c) y tres porcentajes de adición de escoria en reemplazo de parte del cemento. Aunque la edad a la que se evaluaron las muestras de concreto fue la misma, tambi...

  9. Enfoque del paciente con intoxicación aguda por plaguicidas organosfoforados


    Hurtado Clavijo, Carlos Mauricio; Gutierrez de Salazar, Myriam


    Un gran número de insecticidas organofosforadosse usan en todo el mundo a diario. Lasintoxicaciones ocurren generalmente de formaaccidental por exposición laboral, o intencional,con fines suicidas. Los organofosforados producensus efectos tóxicos a través de la inhibiciónde la acetilcolinesterasa, la enzima responsablede la hidrólisis del neurotransmisoracetilcolina, produciendo ácido acético y colina,productos químicamente inertes. La unión entrelos organofosforados y la acetilcolina es unau...

  10. Depresion en pacientes con alteraciones del tiroides

    Directory of Open Access Journals (Sweden)

    Ljiljana Radanovic-Grguric´


    Full Text Available Nuestro estudio fue realizado en un grupo de 53 mujeres con disfunción tiroidea y 28 mujeres con depresión mayor. Empleamos la Escala de la Depresión de Hamilton, la Escala de Autoevaluación de la Depresión de Zung y la Escala sobre la Impresión Clínica Global. Los resultados del estudio demuestran que la mayoría de los pacientes con disfunción tiroidea se mostraron clínicamente significativos en cuanto al trastorno depresivo. Los episodios depresivos son más frecuentes en pacientes con hipotiroidismo que en aquellos que presentan hipertiroidismo. Era menos grave en pacientes con disfunción tiroidea que en aquellos que habían sido diagnosticados de depresión mayor unipolar. Los pacientes con hipertiroidismo tenían menos síntomas graves en cuanto a la inhibición y los pacientes con hipotiroidismo tenían menos síntomas graves de agitación que los pacientes con depresión mayor unipolar. Podemos concluir diciendo que los pacientes con disfunción tiroidea presentan un riesgo potencial para los trastornos depresivos por lo que el diagnóstico y tratamiento se recomienda con el fin de evitar el riesgo de la cronicidad.

  11. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar


    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  12. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application


    Oliveira, J. G.; Schettino, H.; Gama, V; Carvalho, R.; H. Bernhoff


    An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel...



    Sorrentino, Vincenzo


    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  14. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credit s ] BLAST Search Image Search Home About Archive Update History Contact us AcEST AcEST C ... Data acquisit ion method - Data analysis method - Number of data ... entries 4,298 entries Data it em Description Contig ID ID of contig sequence of A ... ris Number of clones The number of EST clones constit uting the contig sequence of Adiantum capillus-vene ... ris Definit ion Definit ion Link to clone list In the TogoDB edi ...

  15. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications


    Vuorsalo, Simo


    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  16. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;


    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  17. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;


    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is...

  18. La atención a los padres con hijos con necesidades educativas especiales (NEE

    Directory of Open Access Journals (Sweden)

    Claudia María Pernas Pico


    Full Text Available Los padres que tienen hijos con necesidades educativas especiales (NEE necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, etc... Siempre desde la empatía y la profesionalidad que debe transmitir el maestro de Audición y Lenguaje. Cambiando la preocupación de los padres por su ocupación.

  19. Fare astronomia con piccoli telescopi

    CERN Document Server

    Gainer, Michael K


    Non sono necessariamente richiesti strumenti mastodontici per produrre risultati scientificamente validi nel campo dell’astronomia. Anche l’astrofilo dotato di un piccolo telescopio, con un diametro di soli 8-9 cm, può contribuire alla scienza del cielo realizzando utili osservazioni del Sole, della Luna, dei pianeti, delle comete, degli asteroidi, delle stelle doppie o variabili, delle nebulose e degli ammassi stellari. Il manuale di M.K. Gainer spiega quale sia la dotazione minima (un piccolo telescopio, un computer, una semplice fotocamera digitale), come utilizzarla, e quali siano le tecniche appropriate da adottare nelle osservazioni. Offre inoltre schemi per interpretare e ridurre i dati raccolti, nonché schede da compilare e da spedire ai centri di raccolta internazionali. Questo libro è il passaporto grazie al quale l’astrofilo può entrare a pieno titolo nel mondo affascinante della scienza astronomica.

  20. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  1. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  2. Obtención de ácido acético a partir de alcohol etílico en un solo paso y en fase vapor

    Directory of Open Access Journals (Sweden)

    Gerardo Rodríguez N.


    Full Text Available La obtención de ácido acético a partir de etanol en una sola etapa se estudió sobre un catalizador de paladio, 0.5% en peso de paladio, soportado en alfa-alúmina. Los ensayos se realizaron en un reactor diferencial a temperaturas entre 150 y 300°C y con una relación molar oxígeno/etanol= 1.25.

  3. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica


    Ranz Guerra, Carlos; Cobo, Pedro


    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  4. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)



    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  5. Mapa acústico parcial de Benetusser




    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  6. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  7. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash


    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  8. Tratamiento conservador en pacientes con retinoblastoma bilateral


    Juan C. Suárez; Mabel C. Ospina; Sandra A. Arias; González, María E


    OBJETIVO: comparar el tratamiento convencional del retinoblastoma bilateral, usado hasta hace algunos años, consistente en radioterapia o enucleación bilateral, con el tratamiento conservador actual que incluye termoterapia transpupilar (TTT) o TTT/quimioterapia al menos en un ojo, en niños con diagnóstico de retinoblastoma bilateral. DISEÑO: estudio retrospectivo descriptivo. MUESTRA: 20 pacientes con diagnóstico de retinoblastoma bilateral que consultaron al Hospital Universitario San Vicen...

  9. Depresion en pacientes con alteraciones del tiroides


    Ljiljana Radanovic-Grguric´; Pavo Filakovic´; Jelena Barkic´; Nikola Mandic´; Ivan Karner; Juraj Smoje


    Nuestro estudio fue realizado en un grupo de 53 mujeres con disfunción tiroidea y 28 mujeres con depresión mayor. Empleamos la Escala de la Depresión de Hamilton, la Escala de Autoevaluación de la Depresión de Zung y la Escala sobre la Impresión Clínica Global. Los resultados del estudio demuestran que la mayoría de los pacientes con disfunción tiroidea se mostraron clínicamente significativos en cuanto al trastorno depresivo. Los episodios depresivos son más frecuentes en pacientes con hipot...

  10. Informe acústico. Mediciones de aislamiento acústico para la obtención de licencia de 1ª ocupación. Viviendas sitas en la ciudad de Valencia.




    La contaminación acústica que soportan los ciudadanos en los edificios es un importante obstáculo para disfrutar de una vivienda digna, así como el derecho a un ambiente adecuado. La exposición constante al ruido es además una fuente de enfermedades físicas y psíquicas. Por ello las Administraciones con objeto de mejorar la calidad de la edificación y promover la innovación y la sostenibilidad regulan las exigencias básicas de calidad e edificios y sus instalaciones El objetivo del pres...

  11. Cefalea cervicogénica: Tratamiento con estimulación eléctrica subcutánea periférica C1-C2-C3 Cervicogenic headache: Treatment with peripheral C1-C2-C3 subcutaneous electrostimulation

    Directory of Open Access Journals (Sweden)

    M. D. Rodrigo


    Full Text Available Introducción: Presentamos siete pacientes con dolor cervicogénico (C1-C2-C3 de larga evolución, persitente, severo, no controlado, de diferentes etiologías, en los que se habían agotado otras posibilidades terapéuticas, tratados con una técnica de estimulación eléctrica extraespinal periférica occipital (C1-C2-C3, mediante implante quirúrgico de electrodo cérvico-occipital uni- o bilateral. Material y método: Se trata de siete pacientes, mujeres, edad media de 50,5 años, con los siguientes diagnósticos: en 3 pacientes cefalea cervicogénica (migraña transformada; otros dos casos se tratan de un síndrome de dolor regional complejo, uno localizado cervical tipo 2 post-siringomielia C2-D1 + malformación de Arnold Chiari + cirugía y en otro de hemicara/cuello/occipital y EESS izqda. postcirugía de carótida; un caso de neuralgia postherpética C1-C2-C3 izquierda; y otro caso de cefalea cervicogénica secundaria a artrosis. Resultados: En todos los casos se ha obtenido un buen resultado analgésico. En la mayoría de las pacientes ha desaparecido el dolor continuo, ha disminuido el número de crisis y su severidad. Se ha normalizado su actividad física, y tres pacientes se han reincorporado al trabajo. El descanso nocturno que era malo en todas ha pasado a ser normal. En dos pacientes se ha retirado el tratamiento farmacológico y en el resto se ha reducido de forma considerable. El tiempo medio de seguimiento es de 16 meses, el máximo en el primer caso es de 33. Las complicaciones han sido en dos ocasiones migración del electrodo, una ocurrió a los 7 días del implante definitivo y en otra paciente después de un año. Discusión: La neuromodulación mediada por la estimulación eléctrica invasiva ha demostrado su utilidad terapéutica a lo largo de los últimos años, en pacientes con dolor neuropático refractario e intratable. Los avances recientes en neuroestimulación han permitido ampliar sus posibilidades terap

  12. Estudio acústico del Conservatorio de Piles




    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  13. AC Own Motion Percentage of Randomly Sampled Cases (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  14. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad


    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  15. Study of AC electrical conduction mechanisms in an epoxy polymer (United States)

    Jilani, Wissal; Mzabi, Nissaf; Gallot-Lavallée, Olivier; Fourati, Najla; Zerrouki, Chouki; Zerrouki, Rachida; Guermazi, Hajer


    The AC conductivity of an epoxy resin was investigated in the frequency range 10^{-1} - 106 Hz at temperatures ranging from -100 to 120 °C. The frequency dependence of σ_{ac} was described by the law: σ_{ac}=ω \\varepsilon0\\varepsilon^''_{HN}+Aωs. The study of temperature variation of the exponent (s) reveals two conduction models: the AC conduction dependence upon temperature is governed by the small polaron tunneling mechanism (SPTM) at low temperature (-100 -60 °C) and the correlated barrier hopping (CHB) model at high temperature (80-120 °C).

  16. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)


    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  17. An improved AC-amplifier for electrophysiology

    Directory of Open Access Journals (Sweden)

    Jorgovanović Nikola


    Full Text Available We present the design, simulation and test results of a new AC amplifier for electrophysiological measurements based on a three op-amp instrumentation amplifier (IA. The design target was to increase the common mode rejection ratio (CMRR, thereby improving the quality of the recorded physiological signals in a noisy environment. The new amplifier actively suppresses the DC component of the differential signal and actively reduces the common mode signal in the first stage of the IA. These functions increase the dynamic range of the amplifier's first stage of the differential signal. The next step was the realization of the amplifier in a single chip technology. The design and tests of the new AC amplifier with a differential gain of 79.2 dB, a CMRR of 130 dB at 50 Hz, a high-pass cutoff frequency at 0.01 Hz and common mode reduction in the first stage of the 49.8 dB are presented in this paper.

  18. Evaluación Objetiva y Subjetiva de la Aislación Acústica de Fachadas


    Ordoñez, Rodrigo; Visentin, Chiara; Markovic, Milos; Fausti, Patrizio


    La aislación acústica de fachadas de distintos tipos de construcciones fue evaluada subjetivamente utilizando tres métodos psicoacústicos: comparaciones en pares utilizando el paradigma de dos alternativas con escoja obligatoria (2-AFC two-alternative forced choice) y dos versiones de evaluación directa utilizando escalas de analogía visual VAS (Visual Analogue Scale). Los estímulos sonoros utilizados para evaluación fueron obtenidos filtrando grabaciones de ruido de tráfico utilizando las ca...

  19. Produtividade das culturas de alface e rabanete em função da época de estabelecimento do consórcio

    Directory of Open Access Journals (Sweden)

    Cecilio Filho Arthur Bernardes


    Full Text Available Avaliou-se a produtividade das culturas de rabanete e alface, e a qualidade de seus produtos, em função da época de estabelecimento do consórcio, na UNESP em Jaboticabal, de março a maio de 1999. Os tratamentos foram constituídos por consórcios estabelecidos aos 0; 7 e 14 dias após o transplantio (DAT da alface e monocultivos implantados nestas mesmas épocas. As cultivares de rabanete (Raphanus sativus L. e alface (Lactuca sativa L. utilizadas foram, respectivamente, Crimson Gigante e Carolina. Maior altura das plantas de rabanete foi observada quando consorciada com alface. As plantas de rabanete em monocultivo apresentaram acúmulo de massa seca da parte aérea (MSPA 29,4% menor do que em consorciação, independente da época de semeadura. Para massa seca de raízes tuberosas, maior acúmulo foi obtido na presença de alface, independentemente da época de instalação do consórcio. Quanto a MSPA de alface, maior acúmulo ocorreu em consórcio, quando a semeadura do rabanete foi realizada até 7 DAT. Além de menor acúmulo de MSPA, quando a semeadura do rabanete foi realizada aos 14 DAT, a alface apresentou perda na qualidade comercial. O maior valor da razão de área equivalente (1,6 no sistema de consórcio, foi obtido quando o rabanete foi semeado aos 7 dias após o transplantio da alface.

  20. Caracterización e inmunoreactividad de la proteína acídica Ribosomal P2ß de L. (V. braziliensis

    Directory of Open Access Journals (Sweden)

    Carlos Padilla R


    Full Text Available Introducción: El diagnóstico serológico de la leishmaniasis usando proteínas totales presenta reacciones cruzadas. La caracterización de nuevos antígenos de Leishmania mejorará el uso de herramientas serológicas en el diagnóstico de esta enfermedad. Objetivo: Caracterizar un nuevo antígeno de Leishmania. Materiales y métodos: Se seleccionó el bacteriófago T166-U19 de una biblioteca de cADN de L. (V. braziliensis el cual es reactivo a mezclas de sueros de leishmaniasis cutánea y mucocutánea. El cADN del clon T166-U19 fue subclonado en el plásmido pGEX, luego secuenciado y la proteína recombinante fue expresada. La reactividad de esta proteína recombinante se evaluó por ELISA. Resultados: El cADN del clon T166- U19 presentó un marco de lectura abierto de 318 pb que traduce una proteína de 105 aminoácidos con 81,1%, 82,9% y 60,7% de identidad total con la proteína acídica ribosomal LiP de L. (L. infantum, P2 de L. (L. donovani, y P2 de T. cruzi, respectivamente. Además, la proteína recombinante presentó baja reactividad (50% con sueros de pacientes con leishmaniosis, mientras que presentó reactividad cruzada con sueros de pacientes chagásicos. Conclusiones: Se caracterizó por primera vez la proteína acídica ribosomal P2B de L. (V. braziliensis, y presentando baja reactividad con sueros de pacientes con leishmaniasis.

  1. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  2. Influencia de la cantidad de O2 adicionado al CO2 en el gas de protección sobre la microestructura del metal depositado en uniones soldadas de bordes rectos en aceros de bajo contenido de carbono con el proceso GMAW Influence of O2 content, added to CO2 in the shielding gas, on the microstructure of deposited metal in butt welded joint with straight edges, in low carbon steels using GMAW process

    Directory of Open Access Journals (Sweden)

    Eduardo Díaz-Cedré


    Full Text Available La presencia de ferrita acicular (FA en la microestructura del cordón de soldadura, dentro de determinado rango de valores, eleva considerablemente la tenacidad de las uniones soldadas. Es por ello, que el presente trabajo trata sobre un estudio que relaciona la cantidad de ferrita acicular en el cordón en función del contenido de oxígeno presente en la mezcla activa CO2+O2, durante la realización de uniones soldadas de bordes rectos en aceros de bajo carbono con el proceso con electrodo fusible y protección gaseosa (GMAW en condiciones invariables de parámetros de proceso (corriente de soldadura, voltaje de arco, velocidad de soldadura, longitud libre y flujo de gas protector. Como resultado del trabajo se estableció la relación gráfica existente entre la ferrita acicular y el contenido de oxígeno en la mezcla.The presence of acicular ferrite (AF in the microstructure of weld bead, in a specified range of values, increase considerably the toughness of welded joints. The present paper, for that reason, study the relationship between the acicular ferrite quantity in the deposited metal and the oxygen present in the active gas mixture of CO2+O2, during the execution of butt welded joints with straight edges, in low carbon steels with consumable electrode and gas protection (GMAW in invariable conditions of process parameters (welding current, arc voltage, welding speed, electrode extension, and gas flow. The graphic relation between the acicular ferrite and the oxygen content was established, as result of the research work.

  3. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub


    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  4. Bases tratadas con cemento, en California

    Directory of Open Access Journals (Sweden)

    Chinchilla, M.


    Full Text Available El uso de bases tratadas con cemento para autopistas se inició en el Estado de California en 1938, empleándose para carreteras con determinadas condiciones de tráfico. Inicialmente, se especificó el uso obligatorio de plantas mezcladoras para asegurar el debido control de las proporciones adecuadas.

  5. Adiciones y cementos con adiciones

    Directory of Open Access Journals (Sweden)

    Calleja, José


    Full Text Available The present paper deals with aspects concerning the conditions to be fulfilled by raw materials and manufacturing process of cements containing components other than clinker and setting regulator. It deals also with proper conditions for the utilization of these cements, as well as with the knowledge of the interrelation between manufacture and use of them, in order to aid the manufacturers and the users in the better profit o such energy saving blended cements in optimal technical and economical conditions.

    Se tratan en este trabajo aspectos relativos a las condiciones exigibles a las materias primas y a los procesos de fabricación de los cementos que contienen constituyentes distintos del clínker y del yeso. Se tienen también en cuenta las condiciones adecuadas para utilizar estos cementos, así como el conocimiento de las relaciones entre la fabricación y el empleo de los cementos con constituyentes secundarios que ahorran energía, a fin de ayudar a fabricantes y usuarios en su mejor aprovechamiento en condiciones técnicas y económicas óptimas.

  6. Itinerari Musicali con la Wiild

    Directory of Open Access Journals (Sweden)

    Elisabetta Nanni


    Full Text Available La Wiild, acronimo di Wiimote Lavagna Digitale, è uno strumento didattico che utilizza il telecomando della Wii, il famoso gioco della Nintendo, insieme a un software libero, rendendolo così estremamente versatile. Non vincolato a software proprietario, il suo utilizzo è legato alla capacità dell’insegnante di ripartire dalla didattica, dalle risorse selezionate e dall’epistemologia di ogni singola disciplina, trovando così nel proprio contesto un ruolo per le tecnologie. Il contributo presenta ipotesi di lavoro per l’educazione musicale nella scuola secondaria di primo grado che si sviluppano sia attraverso lo studio del rapporto suono/segno con affinità pittoriche e successiva codificazione grafica, sia attraverso un’attività di laboratorio in cui co-costruire percorsi storico-musicali. La Wiild diventerà davvero utile ed efficace nel momento in cui, affiancando le risorse selezionate dal docente, verrà utilizzata senza essere notata, giocando un ruolo di strumento tecnologico «normale e trasparente».

  7. [Intestinal occlusion and abdominal compartment syndrome (ACS)]. (United States)

    Stagnitti, Franco


    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  8. La palatalización de las velares. Análisis acústico

    Directory of Open Access Journals (Sweden)

    Mónica Tapia-Ladino


    Full Text Available Uno de los rasgos más característicos del español de Chile es el alto grado de palatalización de las consonantes velares cuando van seguidas de yod o de vocal anterior. Este fenómeno articulatorio se manifiesta acústicamente como una elevación de la frecuencia de ruido de fricción en el caso de la áfona fricativa. Mediante un análisis acústico se ha medido la duración y la frecuencia del ruido en las realizaciones de /x/ extraídas de una muestra del habla de la televisión con el propósito de examinar en qué medida este rasgo aparece en esa variedad de habla. Las mismas mediciones se han efectuado en el habla de los locutores de la televisión española con el fin de efectuar una comparación. (One of the most salient features of Chilean Spanish is the high degree of velar consonant palatalization when followed by yod or a frontal vowel. The acoustic correlate of this articulatory phenomenon is the frequency increase of friction noise in the case of the voiceless fricative. The realizations of /x/ in a sample of Chilean television speech have been measured acoustically, focusing on the duration and frequency noise. The aim was to find out to what extent palatalization appears in that speech variety. For comparative purposes, the same measures have been made in the speech of Spanish television.

  9. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.; Nasirian, Vahidreza; Davoudi, Ali


    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... different control parameters. This paper introduces a cooperative algorithm that regulates the system frequency while maintaining the power sharing properties of droop control. Dynamic consensus protocol is used to estimate the average of normalized active powers in the entire MG. This estimation is then...... added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...

  10. Mapa Acústico del Gran Madrid


    Santiago Páez, José Salvador; Perera, P


    El desarrollo urbanístico de Madrid desde los años 1980 a finales de la década de los 90 hizo que su Ayuntamiento, que ya había promovido la realización entre 1985 y 1991 de un Mapa Acústico parcial de la ciudad, pensase en extender el ámbito de éste a todo el término municipal. Siguiendo el mismo criterio anterior, se superpuso una cuadrícula sobre el plano de Madrid, y se llevaron a cabo registros sonoros de 5 minutos en cada vértice de la misma, en los puntos de medición fuera del área ant...

  11. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  12. An ac bridge readout for bolometric detectors (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.


    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  13. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented and...... analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  14. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)


    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  15. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.


    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and The objective of the project is to investigate the accuracy of most up to date...... cable models, perform highly accurate field measurements for validating the model and identifying possible disadvantages of the cable model. Furthermore the project suggests and implements improvements and validates them against several field measurements. It is shown in this paper how a new method for...... calculating the frequency dependent cables impedance greatly improves the modeling procedure and gives a highly accurate result for high frequency simulations....

  16. Nonlinear ac conductivity of interacting 1d electron systems


    Rosenow, Bernd; Nattermann, Thomas


    We consider low energy charge transport in one-dimensional (1d) electron systems with short range interactions under the influence of a random potential. Combining RG and instanton methods, we calculate the nonlinear ac conductivity and discuss the crossover between the nonanalytic field dependence of the electric current at zero frequency and the linear ac conductivity at small electric fields and finite frequency.

  17. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division


    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  18. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application (United States)


    ... will transfer to AWN all remaining tangible and intangible assets owned, leased or held by ACS Wireless.... \\6\\ ACS Group will cause certain of its other subsidiaries to transfer wireless spectrum licenses and...'' as the power to exercise a controlling influence over the management or policies of a company,...

  19. Operation of AC Adapters Visualized Using Light-Emitting Diodes (United States)

    Regester, Jeffrey


    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  20. Search for β-delayed fission of 228Ac

    International Nuclear Information System (INIS)

    Radium was radiochemically separated from natural thorium. Thin 228Ra→β-228Ac sources were prepared and exposed to mica fission track detectors, and measured by an HPGe γ-ray detector. The β-delayed fission events of 228Ac were observed and its β-delayed fission probability was found to be (5±2)x10-12

  1. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion...

  2. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. (United States)


    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  3. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝


    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  4. Development of YBCO HTS cable with low AC loss

    International Nuclear Information System (INIS)

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s

  5. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;


    performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...... bladder 18 ± 3% (15–21%). The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of...... the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction....

  6. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang


    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  7. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU


    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  8. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R


    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  9. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François


    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  10. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.


    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not...

  11. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica


    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel


    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  12. Fonones en cristales con estructura de diamante


    F. L. Pérez Sánchez; F. Pérez Rodríguez


    Se presenta un estudio de los modos vibracionales de cristales con estructura de diamante. En este estudio aplicamos el modelo de Keating para describir las interacciones de corto alcance entre los átomos e incorporar, en la forma más simple, las interacciones de tres cuerpos asociadas con la deformación del ángulo entre dos enlaces covalentes. En el marco de la aproximación armónica, se obtienen expresiones analíticas para las relaciones de dispersión de fonones con vectores de onda a lo lar...

  13. Miasis en paciente con Carcinoma Basocelular


    Dr. Hugo Pérez Vedia; Claudia Mariela Cruz Copa; Daphne Ingrid Pérez López


    Paciente de sexo masculino, de 71 años de edad, proveniente de la provincia Chapare, Cochabamba, es remitido por sus familiares al servicio de Infectologíadel Hospital Obrero Nº2 Caja Nacional de Salud, tras presentar cuadro clínico de varios días de evolución, caracterizado por lesión ulcerada de bordes irregulares, con secreciónserosanguinolenta localizada en hemicara derecha, con extensión a tejidos profundos y destrucción ósea con pérdida del pabellón auricular derecho,destrucción de la f...

  14. Posicionamiento WIFI con variaciones de fingerprint


    Kornuta, Carlos; Acosta, Nelson; Toloza, Juan Manuel


    Los sistemas de posicionamiento Indoor estiman la posición de un dispositivo móvil en un entorno cerrado con una precisión relativa. Existen diversas técnicas de posicionamiento, donde el parámetro mayormente utilizado es el RSSI (Received Signal Strength Indicator). En este artículo se analiza la técnica Fingerprint con la finalidad de estimar el margen de error obtenido con la distancia euclidiana como métrica principal. Se presentan variantes de la construcción de la base de datos Fingerpr...

  15. Portal de compraventa con red social


    Montero Vegas, Toni


    Este proyecto ha sido diseñado con la intención de añadir una aplicación a la red en la que un usuario que disponga de una necesidad, ya sea de compra o de venta, de un articulo pueda disponer de un medio más para vender en el que además, pueda hacer amistad con otros usuarios y que pueda interaccionar con todos estos usuarios, tanto amigo como simples usuarios bajo su punto de vista. Para poder realizar el proyecto, se han utilizado frameworks existentes como por ejemplo Ibatis, para la c...

  16. Reflexiones de un objeto con mente


    Viader Junyent, Manel


    A estas alturas, y conociendo en parte su trayectoria, no resulta ninguna sorpresa para el lector avezado o al menos interesado en la problematica de la psicologia cognitiva que el profesor Ángel Riviere nos presente un libro como Objetos con mente. Por el contrario, se trata de un trabajo coherente con las reflexiones que viene aportando desde hace años a la tematica, y comparte con sus libros anteriores altos niveles de rigor y profundidad. Desde luego, los trabajos de Riviere rompen totalm...

  17. Salud familiar en familias con adolescente gestante


    Veloza Morales, Martha Cecilia


    La investigación se basó en la teoría de organización sistémica de Marie Louse Friedemann; el objetivo fue describir el grado de salud familiar de familias con adolescente gestante. Estudio Descriptivo transversal comparativo, con abordaje cuantitativo donde se evaluó el grado de salud familiar a 100 familias atendidas en dos instituciones prestadoras de Salud (IPS) en Bogotá, Colombia; se organizaron en dos grupos: la mitad de las familias con adolescentes gestantes que presentaron morbilida...

  18. Tratamiento conservador en pacientes con retinoblastoma bilateral

    Directory of Open Access Journals (Sweden)

    Juan C. Suárez


    Full Text Available OBJETIVO: comparar el tratamiento convencional del retinoblastoma bilateral, usado hasta hace algunos años, consistente en radioterapia o enucleación bilateral, con el tratamiento conservador actual que incluye termoterapia transpupilar (TTT o TTT/quimioterapia al menos en un ojo, en niños con diagnóstico de retinoblastoma bilateral. DISEÑO: estudio retrospectivo descriptivo. MUESTRA: 20 pacientes con diagnóstico de retinoblastoma bilateral que consultaron al Hospital Universitario San Vicente de Paúl, de Medellín, Colombia, entre 1997 y 2007. MÉTODO: se hizo enucleación del ojo con el tumor de mayor tamaño. En el otro ojo se hizo tratamiento con TTT, con el láser diodo (810 nm, spot amplio, solo o combinado con otras terapias. RESULTADOS: se dividió a los pacientes en dos grupos: 16 pacientes (32 ojos en el grupo 1 tratados conservadoramente y 4 pacientes (8 ojos en el grupo 2 con tratamiento convencional. El rango de edad fue de 1-72 meses en el grupo 1 y de 1-12 meses en el grupo 2. El tiempo de seguimiento fue de 7-67 meses para el grupo 1 y de 13-73 meses para el grupo 2. En el grupo 1 se hizo enucleación de 16 ojos (50%, radioterapia externa de uno (3,1%, quimioterapia más termoterapia de 5 (15,6% y quimioterapia más termoterapia más crioterapia de 10 (31,3%. En todos los pacientes se logró preservar al menos un ojo. En el grupo 2, se enuclearon 7 ojos (87,5% y se hizo radioterapia externa más enucleación en un paciente (12.5%. Además, todos los pacientes recibieron quimioterapia. CONCLUSIÓN: la terapia conservadora actual consistente en tratamiento local (termoterapia, crioterapia o braquiterapia y quimiorreducción permite preservar al menos un ojo y en algunos casos de los dos, muchas veces con buena agudeza visual, en niños con retinoblastoma bilateral; se evitan así la enucleación bilateral y la radioterapia externa usada en el tratamiento convencional con todos sus efectos secundarios. La enucleación contin

  19. Numerical estimation of AC loss in superconductors with ripple current

    International Nuclear Information System (INIS)

    Highlights: •The loss energy density with ripple current is numerically calculated. •Irie–Yamafuji model is used for magnetic field dependence of critical current. •Calculated result of cylindrical superconductor agrees with theoretical result. •AC loss of strip superconductor becomes large at small ripple current amplitude. •Strip superconductor should be used as a form of hollow cylinder to reduce AC loss. -- Abstract: The loss energy density (AC loss) with ripple current is numerically calculated by finite element method for cylindrical and strip superconductors based on Irie–Yamafuji model in which the magnetic field dependence of the critical current density is taken into account for design of DC transmission cable system. It is confirmed that calculated result of the AC loss in the cylindrical superconductor with the ripple current agrees well with theoretical estimation which was reported in the previous work. On the contrary, the AC loss in the strip superconductor with the ripple current is obtained only by numerical calculation. It is found that the AC loss in the strip superconductor of the ripple current becomes larger than that without DC current at small ripple current amplitude, since the penetration depth of magnetic field becomes large. Therefore, it is recommended that strip superconductor is better to use as cylindrical hollow superconductor for DC transmission cable system to reduce the AC loss

  20. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali


    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  1. Presa con revestimiento asfáltico

    Directory of Open Access Journals (Sweden)

    Proudfit, D. P.


    Full Text Available La presa denominada Montgomery se halla situada sobre el río South Platte River, a unos 8 km aguas arriba de la ciudad de Alma, del Estado de Colorado (EE. UU., y en la ladera oriental de la cordillera Continental Divide. El cuerpo o dique de esta presa está constituido por piedra, revestida con una capa de hormigón asfáltico en el paramento de contacto con el agua.

  2. Moneda ibérica y gens mariana (107-90 a.C.

    Directory of Open Access Journals (Sweden)

    López Sánchez, Fernando


    Full Text Available The division between domi/rider reverses with a palm and armed militiae/rider in (Celtiberian currency leads us to establish a link between certain mints and military camps. An example of this can be found in the Ikale (n sken denarii, which must be related to the troops sent in the direction of Córdoba by Kese, in support of Sertorius (97-93 B.C.. The Sekobirikes denarii, on the other hand, were the coins used by the troops of Sekaisa while in the territory of the Arevaci with T. Didius and V. Flaccus (98-92 B.C., and all of the bronze Catalan series corresponds with the start of the Bellum Sociale (90 B.C.. During the second century B.C., Rome waged war in Hispania on the invitation of cities such as Osca, Turiasu or Segeda-Sekaisa, which were threatened by powerful enemies. In the period of Marius the (Celtiberian armies adopted a Roman approach to warfare. All of the (Celtiberian currency was minted between the years 107 and 90 B.C., and as such it reflects not the Roman conquest of Hispania, but the formation of a Hispanic branch of the Roman army.La división entre reversos domi/jinete con palma y militiae/jinete armado en la moneda (celtibérica permite afi rmar que algunas cecas hispanas se corresponden con campamentos militares. Así, los denarios Ikale(nsken deben ponerse en relación con las tropas enviadas por Kese hacia Córdoba en apoyo de Sertorio (97-93 a.C.. Los denarios Sekobirikes, por su parte, son las monedas de las tropas de Sekaisa en territorio arévaco con T. Didio y V. Flaco (98-92 a.C.. Las series catalanas en bronce se corresponden todas con el inicio del Bellum Sociale (90 a.C.. Roma luchó en Hispania durante el siglo II a.C. por invitación de ciudades como Segeda-Sekaisa, amenazadas por enemigos demasiado poderosos. Los ejércitos (celtibéricos combatían a la romana en tiempos de Mario. La moneda (celtibérica clásica fue toda ella acuñada entre los años 107 y 90 a.C. Refleja, no la conquista romana de

  3. Analytical description of AC losses for high temperature superconductors

    International Nuclear Information System (INIS)

    Full text: AC losses for high temperature superconductors have been calculated by considering the effects of the temperature distribution and the flux flow resistance. Maxwell's equations and thermal diffusion equation are used to calculate the distribution of magnetic field and the temperature inside the superconductors, respectively. The flux flow effect on the AC losses is calculated by using the extended critical state model. An analytical expression of the AC losses is obtained using a superposition approximation in which the cases of complete and incomplete magnetic field penetration have been distinguished. The expression can well explain the experimental observations of the frequency dependence of the AC losses per cycle in high temperature superconductors. It is clearly shown from the analytical expression that the effect of the thermal distribution inside the superconductors is different from the effect caused by flux flow resistance. In the case of incomplete magnetic penetration, the temperature distribution results in the increase of the AC losses per cycle upon frequency whereas the flux flow leads to the decrease of the AC losses per cycle upon frequency. In the case of complete magnetic penetration the results are opposite to those in the previous case. Due to the extremely strong flux flow in high temperature superconducting materials, the effect of the flux flow on the AC losses is dominant, and the overall dependence of AC losses per cycle upon frequency is controlled by the flux flow. On the other hand, because the inhomogeneous distribution of the temperature inside the superconductors which is normal higher in the center than near the edge, there is an upper limit for the frequency beyond which the superconductivity will be totally destroyed by AC losses. Analytical expressions for the critical frequency, distributions of magnetic field and critical current density are also obtained

  4. La atención odontológica del paciente geriátrico con deterioro cognitivo

    Directory of Open Access Journals (Sweden)

    M.C. Haya Fernández


    Full Text Available La investigación clínica ha demostrado que una mejor función cognitiva se relaciona con un mejor estado de salud oral. Y, de la misma manera, los pacientes mayores institucionalizados con deterioro cognitivo presentan una pobre salud oral con mayor número de dientes ausentes, caries, acúmulo de placa y enfermedad periodontal. El diagnóstico precoz del paciente con deterioro cognitivo es fundamental para mejorar el pronóstico de la enfermedad y poder plantear un tratamiento odontológico preventivo que pueda mejorar su salud y su calidad de vida. Por este motivo, todo el personal sanitario, incluido el odontólogo, tiene que ser determinante en este proceso valorando los cambios conductuales y las pérdidas de memoria de sus pacientes. El objetivo de este artículo es realizar una visión geriátrica de las enfermedades que con mayor frecuencia van a provocar deterioro cognitivo. Así como revisar que cambios se producen en estos pacientes, en cuanto a su salud oral, debido a las alteraciones producidas en el desarrollo de la enfermedad. Para concluir recopilando las pautas de cómo y cuándo debería de realizarse el tratamiento odontológico dependiendo de la fase del deterioro cognitivo.

  5. RadCon: A Radiological Consequences Model

    International Nuclear Information System (INIS)

    RadCon estimates the dose received by user selected groups in the population from an accidental release of radionuclides to the environment. The exposure pathways considered are external exposure from the cloud and ground and internal exposure from inhalation and ingestion of contaminated food. Atmospheric dispersion modelling is carried out externally to RadCon.Given a two dimensional time varying air and ground concentration of radioactive elements, RadCon allows the user to: view the air and ground concentration over the affected area, select optional parameters and calculate the dose to people,display the results to the user, and change the parameter values. RadCon offers two user interfaces: 1) the standard graphical user interface which is started using Java DoseApp at the command line, or by setting up a shortcut to this command (particularly when RadCon is installed on a PC) and 2) the text based interface used to generate information for the model inter-comparison exercise . This is initiated using Java BIOMASS at the command line, or an equivalent shortcut. The text based interface was developed for research purposes and is not generally available. Appendices A, B and C provide a summary of instructions on setting up RadCon. This will generally be carried out by the computer support personnel

  6. Operation of AC Adapters Visualized Using Light-Emitting Diodes (United States)

    Regester, Jeffrey


    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current (AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For educational purposes, however, an LED-based rectifier is ideal because it allows students to literally see the rectifier operating. Here I'll discuss the practical aspects of building a full AC adapter incorporating an LED-based rectifier and ideas on how to use it in class.

  7. Theoretical analysis of ac losses in high temperature superconducting bulks

    International Nuclear Information System (INIS)

    Ac loss behavior in HTS bulk materials is studied by developing an analytic method. The self-heating effect on the distributions of temperature in HTS bulks has been calculated. A critical frequency which sets the upper limit for driving frequency of the external field in sustaining a superconducting state is obtained. Our model provides useful information of understanding the experimental phenomena, including an anomalous ac loss behavior, a retardation of the inner field respect to the external ac field, etc., in HTS bulk materials

  8. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin


    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  9. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono


    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  10. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen


    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  11. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  12. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  13. Stochastic Dynamics of DC and AC Driven Dislocation Kinks (United States)

    Vardanyan, A.; Kteyan, A.


    Dynamics of a pinned dislocation kink controlled by the acting DC and AC forces is studied analytically. The motion of the kink, described by sine-Gordon (sG) equation, is explored within the framework of McLaughlin-Scott perturbation theory. Assuming weakness of the acting AC force, the equation of motion of the dislocation kink in the pinning potential is linearized. Based on the equations derived, we study stochastic behavior of the kink, and determine the probability of its depinning. The dependencies of the depinning probability on DC and AC forces are analyzed in detail.

  14. Observation of β-delayed fission from 230Ac

    International Nuclear Information System (INIS)

    β-delayed fission for 230Ac was searched. 230Ra was produced via multinucleon transfer reaction by 60 MeV/u 18O ion irradiation of 232Th target. Thin 230Ra→230Ac sources of 108 atoms were acquired through radiochemical separations. The mica track detectors were used to record the fission events. The β-delayed fission nucleus 230Ac was identified via the observed two fission events and the measured γ-ray spectra. Its β-delayed fission probability was obtained to be (1.19 +- 0.85) x 10-8

  15. Atenuación natural en suelos contaminados con hidrocarburos


    Lilia Corona Ramírez; Rosario Iturbe Argûelles


    Se realizó un experimento con suelo contaminado proveniente de una refinería, el cual contaba con hidrocarburos derivados de petróleo, específicamente con concentraciones elevadas de hidrocarburos poliaromáticos (HAP). El estudio consistió en preparar 7 cajones con 7 kg de suelo, cada uno con las siguientes condiciones: S1 suelo contaminado con hidrocarburos y 15% de contenido de agua. S2 suelo contaminado con hidrocarburos y adición de Nitrógeno y Fósforo (N y P) con 15% de contenido de agua...

  16. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo


    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  17. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN


    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  18. Placa de pila de combustible con geometría de flujo en forma de "espina de pez"


    Lincheta Mesa, Eduardo; Barreras Toledo, Félix; Lozano Fantoba, Antonio; Valiño García, Luis; Mustata Oroviceanu, Radu


    La placa de pila de combustible, que se utiliza generalmente para distribuir de forma homogénea los fluidos reactantes sobre las áreas de reacción química correspondientes a las capas catalíticas (electrodos), presenta en cada una de estas áreas de reacción química una geometría de flujo en forma de “espina de pez” que comprende canales 10 delimitados por unos nervios, dispuestos de tal forma que el canal de entrada se bifurca en canales que ocupan dos estructuras laberíntic...

  19. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  20. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  1. RadConEd: A Graphical Data Editor for the Radiological Consequences Model, RadCon

    International Nuclear Information System (INIS)

    This document describes the application, RadConEd, which has been designed and implemented to enable users of the RadCon system to update these parameter files. The RadCon system is written in the Java programming language, and as such provides portability across computer platforms. The software described in this report was developed in line with the portability requirements of RadCon, thus providing a uniform user interface across computer platforms and bypassing the need of using system editors. In addition a number of data integrity measures were implemented



    Pablo Valenzuela F; Sandra Ahumada G.; Ana María González A; Carmen Quezada V; Sergio Valenzuela P; Ana María Sougarret S; Luis Martínez M


    El Consultorio de Asistencia Perinatal atiende a padres de embarazos con fetos en riesgo vital, malformados complejos y nacidos con problemas graves que impliquen impacto familiar, basados en la hipótesis de que la atención de los padres incide en el bienestar del feto y del recién nacido. Se ha construido un protocolo multiprofesional con participación de pediatra, psicóloga, matronas, obstetra y servicio social que sigue el caso con reuniones grupales y de especialidad desde antes del parto...

  3. Absorption and Attenuation Coefficients Using the WET Labs ac-s in the Mid-Atlantic Bight: Field Measurements and Data Analysis (United States)

    Ohi, Nobuaki; Makinen, Carla P.; Mitchell, Richard; Moisan, Tiffany A.


    Ocean color algorithms are based on the parameterization of apparent optical properties as a function of inherent optical properties. WET Labs underwater absorption and attenuation meters (ac-9 and ac-s) measure both the spectral beam attenuation [c (lambda)] and absorption coefficient [a (lambda)]. The ac-s reports in a continuous range of 390-750 nm with a band pass of 4 nm, totaling approximately 83 distinct wavelengths, while the ac-9 reports at 9 wavelengths. We performed the ac-s field measurements at nine stations in the Mid-Atlantic Bight from water calibrations to data analysis. Onboard the ship, the ac-s was calibrated daily using Milli Q-water. Corrections for the in situ temperature and salinity effects on optical properties of water were applied. Corrections for incomplete recovery of the scattered light in the ac-s absorption tube were performed. The fine scale of spectral and vertical distributions of c (lambda) and a (lambda) were described from the ac-s. The significant relationships between a (674) and that of spectrophotometric analysis and chlorophyll a concentration of discrete water samples were observed.

  4. Enfermedad coronaria en pacientes con psoriasis

    Directory of Open Access Journals (Sweden)

    Walter Masson


    Full Text Available Comunicaciones previas asociaron la psoriasis con la enfermedad coronaria. Desconocemos si en nuestro país o región existe dicha asociación. Se realizó un estudio transversal analizando los datos de la historia clínica electrónica de un sistema de salud de Buenos Aires. Analizamos todos los pacientes mayores de 18 años con diagnóstico de psoriasis entre el 1 de enero de 2003 y el 31 de julio de 2011 y los comparamos con un grupo control, en una relación 2:1, obtenido en forma aleatoria del mismo sistema de salud, apareados por edad y sexo. Determinamos la prevalencia de los factores de riesgo cardiovascular y de enfermedad coronaria. Analizamos la asociación entre la enfermedad coronaria y la psoriasis mediante análisis uni y multivariado. Se incluyeron 3 833 sujetos (1 286 pacientes con psoriasis y 2 547 controles. La prevalencia de hipertensión arterial (50% vs. 38%, p < 0.001, tabaquismo (25% vs. 17%, p < 0.001, diabetes (12% vs. 8%, p < 0.001 y enfermedad coronaria (4.98% vs. 3.06%, p = 0.003 fue mayor en los sujetos con psoriasis en comparación con el grupo control. Independientemente de la edad, la presencia de diabetes, hipertensión arterial o tabaquismo, hubo una asociación significativa entre la enfermedad coronaria y la psoriasis (OR 1.48, IC95% 1.04-2.11, p = 0.03. En conclusión, en esta población de Buenos Aires, los pacientes con psoriasis tuvieron una mayor prevalencia de diabetes, hipertensión arterial, tabaquismo y enfermedad coronaria. La asociación entre la psoriasis y la enfermedad coronaria fue independiente de los factores de riesgo explorados.

  5. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)


    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  6. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    Directory of Open Access Journals (Sweden)

    H. Salamati


    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  7. Performance of an x-ray microcalorimeter under ac biasing

    International Nuclear Information System (INIS)

    Frequency domain multiplexing (FDM) is an attractive option for the readout of imaging arrays of microcalorimeters. Implementation of FDM requires ac biasing of the individual microcalorimeters. In this letter we present a small signal model for the behavior of a microcalorimeter under ac bias. Moreover, we have measured the behavior of the same microcalorimeter under ac (at 46 kHz) and dc bias. These experiments show that the performance of the device is very similar in terms of energy resolution, pulse shapes, and current-voltage characteristics. The measured energy resolution at 5.89 keV is 6.9 eV for ac bias and 5.5 eV for dc bias. The effective time constant in both cases is 100 μs

  8. Dc to ac converter operates efficiently at low input voltages (United States)


    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  9. Ferromagnetic resonance driven by an ac current: a brief review

    International Nuclear Information System (INIS)

    Excitation of ferromagnetic resonance (FMR) by an ac current has been observed in macroscopic ferromagnetic films for decades and typically relies on the ac Oersted field of the current to drive magnetic moments into precession and classical rectification of ac signals to detect the resonance. Recently, current-driven ferromagnetic resonances have attracted renewed attention with the discovery of the spin-transfer torque (STT) effect due to its potential applications in magnetic memory and microwave technologies. Here STT associated with the ac current is used to drive magnetodynamics on the nanoscale that enables FMR studies in sample volumes smaller by a factor of 1000 compared to conventional resonance techniques. In this paper, we briefly review the basics of STT-FMR technique and the results of various STT-FMR experiments.

  10. c-axis ac susceptibility in high-Tc superconductors

    International Nuclear Information System (INIS)

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi2Sr2CaCu2O8 and YBa2Cu3O7 single crystals at low external fields. The ac field was applied perpendicular to the CuO2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO2 planes passes a threshold field Hth. Hth is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  11. Fabrication of alumina films with laminated structures by ac anodization

    International Nuclear Information System (INIS)

    Anodization techniques by alternating current (ac) are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials. (paper)

  12. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  13. Variables socionutricionales de hogares mazahuas integrados por preescolares desnutridos con madres con obesidad y sin obesidad

    Directory of Open Access Journals (Sweden)

    Conzuelo González, Viridiana Vanessa


    Full Text Available El primer objetivo fue conocer cuántos menores de cinco años con diferentes grados de desnutrición tienen una madre con sobrepeso/obesidad/ en una comunidad indígena que vive en extrema pobreza y bajo condiciones de migración masculina internacional. El segundo fue comparar tres variables socionutricionales (ingreso familiar, educación de la madre y adecuación nutrimental de la dieta diaria entre estos hogares y los hogares con desnutrición infantil y madres sin obesidad. Se realizó un estudio transversal (2006-2007, en la comunidad mazahua de San Francisco Tepeolulco, Municipio de Temascalcingo; que incluyó a 85 hogares integrados por preescolares con desnutrición inscritos al programa Oportunidades. Se determinó el estado nutrición de los preescolares con indicadores antropométricos y se obtuvo el IMC de las madres de estos infantes. Se aplicó una encuesta socionutricional, incluida el recordatorio de 24 horas, y complementado con la observación participante (cualitativa. Se encontró que 83% de las madres mazahuas presentaron sobrepeso u obesidad. El estado de nutrición de los preescolares con madres con obesidad presentó un porcentaje mayor de desnutrición (76%. En la variable género, se encontró que 54% de los niños con madres con obesidad tenía baja talla. Al relacionar el nivel educativo de la madre, esta variable resultó ser estadísticamente significativa (p=0.015, donde el analfabetismo está más relacionado con la desnutrición infantil que tienen madres de bajo y/o peso normal. La elevada prevalencia de hogares conformados con preescolares con desnutrición y madres con obesidad, es un síntoma más de la pobreza en zonas indígenas en México, con bajo índice de desarrollo humano.

  14. Evolution of ConAl clusters and chemisorption of hydrogen on ConAl clusters

    International Nuclear Information System (INIS)

    The growth behavior of ConAl (n = 1–15) and the chemisorptions of hydrogen on the ground state geometries have been studied using the density functional theory (DFT) within the generalized gradient approximation (GGA). The growth pattern for ConAl is Al-substituted Con+1 clusters, and it keeps the similar frameworks of the most stable Con+1 clusters except for n = 2, 3, and 6. The Al atom substitutes the surface atom of the Con+1 clusters for n ≤ 13. Starting from n = 14, the Al atom completely falls into the center of the Co-frame. The dissociation energy, the second-order energy differences, and the HOMO–LUMO gaps indicate that the magic numbers of the calculated ConAl clusters are 7, 9, and 13, corresponding to the high symmetrical structures. To my knowledge, this is the first time that a systematic study of chemisorption of hydrogen on cobalt aluminum clusters. The twofold bridge site is identified to be the most favorable chemisorptions site for one hydrogen adsorption on ConAl (n = 1–6, 8, 10), and two hydrogen adsorption on ConAl (n = 1–7), while threefold hollow site is preferred for one hydrogen adsorption on ConAl (n = 7, 9, 11–15) and two hydrogen adsorption on ConAl (n = 8–10, 12–15) clusters. The ground state structure of two hydrogen adsorption on Co11Al is exceptional. In general, the binding energy of both H and 2H of ConAl (n = 1–12) is found to increase with the cluster size. And the result shows that large binding energies of the hydrogen atoms and large fragmentation energies for Co11AlH and Co12AlH make these species behaving like magic clusters.

  15. Muc5ac mucin expression during rat skin development


    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.


    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  16. Dynamics of a nanowire superlattice in an ac electric field


    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen


    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  17. Fractal AC circuits and propagating waves on fractals

    CERN Document Server

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander


    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  18. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;


    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  19. AC resistivity of d-wave ceramic superconductors


    Li, Mai Suan; Dominguez, Daniel


    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  20. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe


    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments....

  1. Modelo de optimización con restricciones de equilibrio para el control de semáforos


    Pedreira Andrade, Luís P.; Lema Fernández, Carmen S.; Blanco Louro, Amalia; Allende, Sira


    En este trabajo analizamos un problema de control óptimo de semáforos para un cruce de dos carreteras con los dos sentidos de circulación. Exponemos primero, un modelo exacto y acíclico que describe la evolución de las longitudes de las colas como una función del tiempo y de los instantes de cambio (“switching”). Para obtener un modelo simplificado (más manejable para el análisis matemático) hacemos algunas hipótesis simplificadoras. Pretendemos calcular una sucesión temporal switching p...



    Carlos Mauricio Hurtado Clavijo; Myriam Gutiérrez de Salazar


    Un gran número de insecticidas organofosforados se usan en todo el mundo a diario. Las intoxicaciones ocurren generalmente de forma accidental por exposición laboral, o intencional, con fines suicidas. Los organofosforados producen sus efectos tóxicos a través de la inhibición de la acetilcolinesterasa, la enzima responsable de la hidrólisis del neurotransmisor acetilcolina, produciendo ácido acético y colina, productos químicamente inertes. La unión entre los organofosforados y la acetilcoli...

  3. ISTTOK upgrade towards AC and remote operation

    International Nuclear Information System (INIS)

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed.In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented.The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat

  4. ISTTOK upgrade towards AC and remote operation (United States)

    Fernandes, H.; Silva, C.; Carvalho, B.; Sousa, J.; Valcárcel, D.; Neto, A.; Fortunato, J.; Carvalho, I.; Varandas, C. A. F.


    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed. In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented. The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat.

  5. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar


    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  6. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi; /Texas U.


    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f {approx} 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  7. en pacientes con demencia tipo Alzheimer

    Directory of Open Access Journals (Sweden)

    Manuel Alejandro Cruz-Aguilar


    Full Text Available El objetivo del presente estudio fue determinar los efectos de 5 mg. de melatonina de liberación inmediata sobre la macro-arquitectura del sueño en ocho pacientes con diagnóstico de Demencia Tipo Alzheimer (DTA de media a moderada. Utilizando la técnica polisomnográfica (PSG se realizó un estudio simple ciego, no aleatorio, controlado con placebo. Los registros PSG se llevaron a cabo de la siguiente manera: Noche 1: administración de placebo; noche 2 y 3: administración continua de melatonina (5 mg. Observamos que el tratamiento con melatonina durante la primera noche de administración disminuyó significativamente la latencia de la fase 2, del sueño de ondas delta y el sueño de MOR al ser comparadas con el placebo (P ≤.05. No se observaron diferencias significativas en el tiempo total de cada fase de sueño; tampoco se observaron diferencias en la eficiencia del sueño en presencia de la melatonina. Sin embargo se observó una tendencia a la disminución del tiempo total de vigilia y un aumento del tiempo total de sueño, principalmente durante la segunda noche de tratamiento. Concluimos que la melatonina puede mejorar el sueño en pacientes con DTA de media a moderada.

  8. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG


    Bulhosa, João Paulo Rodrigues


    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  9. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.


    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  10. Tomate industrial con riego por cinta


    Adán Fimbres-Fontes


    La región agrícola de Caborca cuenta con una superficie de 40 000 ha, las cuales se riegan con agua proveniente de aproximadamente 700 pozos. El abatimiento del manto acuífero es, en promedio, de 0.82 m año-1 y, en 25 años, ha sido de 20.50 m, medidos al nivel estático. El agua es uno de los factores más importantes en la producción de cualquier cultivo en la región. El objetivo del presente trabajo fue optimizar la cantidad de agua por aplicar al tomate industrial cultivado con riego por cin...

  11. Evolución histórica y comportamiento acústico a ruido aéreo y de impacto de los forjados de edificación en la Ciudad Universitaria de Madrid


    Caballol Bartolomé, David; Diaz Sanchidrian, Cesar; Rodriguez Sanchez, Antonio


    Es conocida la existencia de numerosos trabajos que analizan el aislamiento acústico de recintos superpuestos, relacionando de distintos modos los resultados obtenidos con la composición y disposición de los elementos constructivos que componen ambos recintos. Sin embargo, en el caso de grandes recintos de los años 30 a 50 del pasado siglo, realizados con hormigón no es posible encontrar un estudio que aborde el problema y que además lo haga teniendo en cuenta tres puntos de vista diferentes ...

  12. Evaluación de ácido acético como fumigante de mosquita blanca Bemisia tabaci (Gennadious) en laboratorio y campo Assessment of acetic acid like fumigant of silverleaf whitefly Bemisia tabaci (Gennadious) in laboratory and field


    José Alfredo Samaniego Gaxiola; José Emmanuel Amaya Carrillo; José Luis Puente Manríquez


    El objetivo de este trabajo fue evaluar la capacidad del ácido acético (AA) como fumigante en contra de Bemisia tabaci (moquita blanca) que es un plaga de importancia nacional. En el laboratorio, se fumigó el insecto con tres regímenes de dosis - tiempo: (ambos medios), baja - largos y altas - cortos. En el campo, las hojas de calabaza de cuatro variedades fueron fumigadas con 8, 16 y 32 µg ml-1 de AA en tiempos de 20, 40 y 60 min; adicionalmente, se evaluó el daño en las hojas (fitotoxicidad...

  13. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Indian Academy of Sciences (India)

    Manoj Chugh; B R Gulati; S K Gakhar


    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  14. IoT con IBM y NI


    Larrañaga Fuerte, Jon


    Trabajo realizado en la empresa ULMA Embedded Solutions El Internet of Things, abreviado IoT, es el concepto de dar conectividad a la red a cualquier objeto y poder capturar, almacenar y gestionar toda la información emitida por dichos objetos con la finalidad de automatizar procesos, permitiendo además la comunicación entre todos los objetos conectados. Este proyecto se centra en crear una solución IoT, logrando además la integración de dispositivos de National Instruments con software...

  15. Ortopedia maxilar en clases III con miniplacas


    Murillo Prieto, Noemí


    Las maloclusiones esqueléticas de clase III, pese a ser de las menos prevalentes, suponen un reto en ortodoncia por su tendencia a empeorar con el tiempo. Cuando su causa principal es debida a un maxilar deficiente, a menudo se lleva a cabo la protracción del mismo con una máscara facial (MF) acompañada de una disyunción rápida del maxilar. La mayoría de los estudios avala la eficacia de la máscara facial y de la disyunción para inducir un movimiento hacia abajo y hacia delante del maxilar me...

  16. Sarcoma de Kaposi en paciente con SIDA


    Jesús Ramón León Polanco; Tereza Rodríguez Feliz; Ángel Franco Yee


    Se presenta el caso de un paciente masculino de 33 años de edad, con antecedentes de VIH-SIDA desde hace 10 años, que se mantiene en tratamiento con antirretrovirales. Durante todo este tiempo ha presentado varios episodios de infecciones respiratorias, incluyendo tuberculosis pulmonar 5 años atrás. Acude a consulta refiriendo edemas en miembros inferiores acompañado de lesiones en piel de color violáceo de un año de evolución, previamente interpretado como linfangitis rebelde al tratamiento ...

  17. API REST con MEAN para contenidos multimedia


    López Jurado, Francisco Carlos


    Memoria de Proyecto Fin de Grado API REST con MEAN para Contenidos Multimedia. En ella se especifica todo el proceso de elaboración del proyecto, desde la confección de la idea, pasando por el análisis y la definición de requisitos de elaboración, hasta la entrega definitiva del producto final. El proyecto consta de dos bloques claramente diferenciados: Una documentación extensa de la línea de trabajo, con apoyo de diagramas, imágenes, descripciones y metodologías. Implementación de la líne...

  18. Hiperalgesia asociada al tratamiento con opioides

    Directory of Open Access Journals (Sweden)

    A. Gil Martín


    Full Text Available La hiperalgesia inducida por opioides es una reacción paradójica caracterizada por una percepción intensificada de dolor relacionada con el uso de estos medicamentos en ausencia de progresión de la enfermedad o de síndrome de retirada. A diferencia de los casos de tolerancia, definida como pérdida de potencia analgésica durante el uso prolongado de opioides, no se produce mejoría con el escalado de dosis. La hiperalgesia inducida por opioides se ha manifestado en pacientes con dosis de mantenimiento y retirada, pacientes con dosis elevadas o escalado de dosis y pacientes con dosis ultra bajas. Para establecer un diagnóstico diferencial es importante tener en cuenta que un incremento de dosis puede producir una mejoría temporal en pacientes con tolerancia pero no en los que han desarrollado hiperalgesia. La prevalencia de dicho fenómeno es desconocida, pero puede ser más frecuente de lo esperado y muchas veces no reconocido. El mecanismo subyacente no está bien definido, pero existen diversos estudios experimentales tanto en modelos animales como en humanos en los que se observa que la hiperalgesia no está desencadenada por un único factor, sino que son muchos los implicados. Entre los mecanismos propuestos destacan: la mediación del receptor NMDA (N-metil-D-aspartato activado por la liberación presináptica de glutamato, la modulación por la proteína-kinasa de calcio/calmodulina, el aumento en el número de nociceptores o la liberación de neurotransmisores excitadores. Se han realizado diversos estudios para describir la expresión y la relevancia de la hiperalgesia inducida por opioides en distintos grupos de pacientes: ex-adictos a opioides en tratamiento de mantenimiento con metadona, en exposición perioperatoria, en voluntarios sanos o en dolor crónico. Existen diferentes estrategias de tratamiento disponibles; entre las más aceptadas se encuentra la reducción en la dosis del opioide utilizado, la rotación del

  19. Compuestos bioactivos en bebidas con capacidad antioxidante


    López Froilán, Rebeca


    El consumo de bebidas no alcohólicas en España está constituido principalmente, además del agua mineral, y las bebidas refrescantes, por los zumos y las bebidas estimulantes con predominio del café. Estas bebidas, especialmente los zumos de frutas y el café, son una importante fuente de compuestos bioactivos. Concretamente el café es la mayor fuente de polifenoles en la dieta española, mientras que los zumos de frutas, junto con las frutas cítricas, constituyeron el 43 % de ingesta de vitamin...



    Tomillo-Sánchez, Rosa Isabel


    La presente investigación tiene una doble finalidad, por un lado analizar las dificultades de aprendizaje que manifiestan alumnos diagnosticados con el Trastorno con déficit de atención e hiperactividad (TDAH), profundizando en los procesos implicados en la lectura. Por otra parte, reflexionar sobre el papel y la formación de los profesionales de la educación sobre dicho trastorno. Para el desarrollo de la misma, se ha utilizado una metodología descriptiva a través de la herramienta psicom...

  1. Competencias socioemocionales en alumnado con altas capacidades


    Camús Ferri, María del Mar


    Competencias socio-emocionales en el alumnado con necesidades específicas de apoyo educativo. Descripción de la línea: Se pretende revisar y/o emplear, de manera científica y sistemática, los recursos didácticos y metodológicos principales para una intervención eficaz que permita la mejora de las competencias socio-emocionales en el alumnado con necesidades específicas de apoyo educativo.

  2. El apoyo social con pacientes de Leucemia


    López Avilés, Maria del Carmen


    El apoyo social a personas con enfermedades graves y en tratamiento hospitalario ha sido desarrollado en buena parte por organizaciones sociales, siendo un ejemplo de ello ASLEUVAL. En este sentido se ha desarrollado un trabajo social con características propias, impulsando la acción social en las entidades para permitir generar una red de protección social a los pacientes y sus familias complementarias e imprescindibles de la actuación desde los hospitales. Es fundamental d...

  3. Pensamiento divergente y creatividad con personas mayores


    Modino Catalán, Natalia


    Este trabajo revisa la información existente sobre el pensamiento divergente y la creatividad considerando estos aspectos muy importantes dando importancia a la neuroeducación como la mejor manera de transmitir los conocimientos para un aprendizaje a largo plazo. Se propondrá un proyecto de intervención para realizar con personas mayores que mejore estos valores y así su vida, ralentizando así el deterioro cognitivo asociado a la edad y se fomentan valores relacionados con la sociali...

  4. La Meseta de Requena-Utiel entre los siglos II-I a.C.: La Romanización del territorio ibérico de Kelin


    Quixal Santos, David


    En la presente Tesis Doctoral se aborda el tema general de la romanización de los pueblos ibéricos en la fachada mediterránea peninsular a partir del caso concreto del territorio de una ciudad ibérica, Kelin – Los Villares (Caudete de las Fuentes, València). Dicha ciudad, ocupada entre los siglos VII-I a.C., sabemos que al menos desde el s. V a.C. organizó un territorio a su alrededor, con unos límites muy similares a los de la actual comarca de Requena-Utiel. Ha sido excavada desde los años ...

  5. Unidad didáctica sobre el sistema de medida NetdB aplicado a prácticas de acústica arquitectónica


    Sotorríos Rubio, Ana


    El objetivo principal perseguido en este proyecto es el estudio del sistema NetdB mediante la medida de diferentes parámetros de acústica arquitectónica. El proyecto se estructura en cinco partes bien diferenciadas que se comentarán a continuación. La primera parte, fundamentos teóricos, se centrará en explicar los distintos parámetros medidos y su relación con la acústica, tanto de forma teórica como práctica. Todo ello se hará mediante la definición de los conceptos teóricos básico...

  6. Temas de Física para Ingeniería: Acústica


    Beléndez Vázquez, Augusto


    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  7. Analysis of AC loss in superconducting power devices calculated from short sample data


    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.


    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  8. Behaviour analysis of AC-600 passive safety systems

    International Nuclear Information System (INIS)

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  9. Adenoma ceruminoso con extensión intracraneal. Comunicación de un caso y revisión de la bibliografía


    Ana Fernanda Hernández Moreno; Francisco Manuel Sánchez Ortega; Joel Cruz Hernández


    Se comunica el caso de un paciente de 59 años de edad con padecimiento de un año de evolución, caracterizado por dolor en la región retroauricular derecha, de tipo punzante, con irradiación a la hemicara, el oído y el hombro ipsilaterales. Refirió acúfeno de tonalidad aguda, intermitente, con duración de segundos, aumento del volumen de tres meses de evolución en la cara lateral derecha del cuello, y extensión a la región mastoidea e hipoacusia derecha lentamente progresiva. Acudió al servici...

  10. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede


    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...


    Directory of Open Access Journals (Sweden)

    Enrique Alexis García Moya


    Full Text Available Se presenta un estudio sobre la reducción catalítica selectiva (RCS de NOx con metano en presencia de oxígeno en exceso con varios catalizadores a base de las zeolitas mordenita, ferrierita y ZSM-5 intercambiadas con diferentes cargas de cobalto y con las correspondientes zeolitas en forma acida. Cuando la mezcla reactiva contenía mayormente NO2 en lugar de NO, los catalizadores ácidos mostraron las más altas velocidades de formación de N2 en condiciones secas. Las mayores actividades se obtuvieron con los catalizadores Co-mordenita, siguiendo en orden de actividad los catalizadores Co-Ferrierita y Co-ZSM-5. El catalizador Co-Mordenita más activo se ensayó con una mezcla reactiva donde predominó el NO en lugar del NO2 bajo condiciones secas e hidrotérmicas y en presencia de SO2. Con la adición de 8% de agua a la mezcla de reacción se observó desactivación reversible, especialmente a bajas temperaturas. La adición de 60 ppm de SO2 disminuyó la velocidad de reacción aproximadamente a la mitad debido posiblemente al envenenamiento de algunos sitios activos.

  12. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)



    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  13. Sarcoma de Kaposi en paciente con SIDA

    Directory of Open Access Journals (Sweden)

    Jesús Ramón León Polanco


    Full Text Available Se presenta el caso de un paciente masculino de 33 años de edad, con antecedentes de VIH-SIDA desde hace 10 años, que se mantiene en tratamiento con antirretrovirales. Durante todo este tiempo ha presentado varios episodios de infecciones respiratorias, incluyendo tuberculosis pulmonar 5 años atrás. Acude a consulta refiriendo edemas en miembros inferiores acompañado de lesiones en piel de color violáceo de un año de evolución, previamente interpretado como linfangitis rebelde al tratamiento y que se extendió a la cara interna de los muslos y a los miembros inferiores. Con pérdida de peso, no prurito en las lesiones, fiebre, lesiones en la mucosa oral. Se determinó hemoglobina 89 g/L, leucocitos 4,5 x 109 /L, se estudiaron las funciones hepática y renales resultando normales. Radiografías de tórax y ultrasonido abdominal normales. Se realizó estudio anatomopatológico de piel que informó Sarcoma de Kaposi. Se impuso tratamiento con quimioterapia

  14. Biosensor con nanoparticulas metálicas


    Pino González de la Higuera, Pablo del; Pelaz, Beatriz; Polo, Ester; Grazú Bonavia, Valeria; MARTÍNEZ DE LA FUENTE, Jesús; Parro-García, Víctor


    La presente invención se refiere a un biosensor donde la detección del analito se realiza de forma visual por el cambio de color en las zonas del soporte en que el analito esté presente producido por las nanopartículas al ser irradiadas con una fuente de luz externa

  15. IoT con Raspberry Pi


    García Muelas, Carlos


    Estudio de diferentes plataformas software y hardware del internet de las cosas. Aplicación real con Raspberry Pi. Estudi de diferents plataformes programari i maquinari de l'internet de les coses. Aplicació real amb Raspberry Pi. Bachelor thesis for the Telecommunication Technologies program on Telematics.

  16. InterCon Travel Health: Case B (United States)

    Truman, Gregory E.; Pachamanova, Dessislava A.; Goldstein, Michael A.


    InterCon provides services to health insurers of foreign tourists who travel to the United States and Canada. Management wants to implement a new information system that will deal with several operational problems, but it is having difficulty securing the capital resources to fund the system's development. After an initial failure, the chief…

  17. Modelling ac ripple currents in HTS coated conductors (United States)

    Xu, Zhihan; Grilli, Francesco


    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc


    Directory of Open Access Journals (Sweden)

    Aveliano Mercedes Fernández


    Full Text Available

    Los rasgos morfológicos y citogenéticos de los híbridos artificiales entre cuatro especies diploides (2n = 10: T.concinna, T.Krapovickasii, T.scabra y T.subulata han sido estudiados. Los híbridos fueron intermedios en varios caracteres, como el color de las flores, la longitud, la anchura y forma de las semillas, en algunos rasgos se parecían a uno o al otro padre.
    Todos los híbridos interespecíficos mostraron un alto porcentaje de PMC con cinco bivalentes. La meiosis de T.subulata x T.scabra fue regular (5 II. En los otros híbridos fue grabada una baja frecuencia de trivalentes o cuadrivalentes; estos trivalentes y cuadrivalentes son evidencia de translocaciones recíprocas. Puentes y fragmentos en anafase I y II muestran la presencia de inversiones paracéntricas.
    Los análisis morfológicos y citogenéticos de los híbridos indican una estrecha relación entre T.scabra y T.subulata y entre T.concinna y T.Krapovickasii respectivamente. Esta última especie tiene un par de cromosomas con satélites grandes. T.scabra y T.concinna están más alejadas.
    El estudio citogenético de todos los híbridos entre estas especies confirmaría que son taxones independientes. Ellos tienen el mismo genoma básico, que designamos Asu Asu de T. subulata, Asc Asc para T.scabra, Ak Ak para T. Krapovickasii y Ac Ac para T.concinna.

  19. Variables socionutricionales de hogares mazahuas integrados por preescolares desnutridos con madres con obesidad y sin obesidad


    Conzuelo González, Viridiana Vanessa; Vizcarra Bordi, Ivonne


    El primer objetivo fue conocer cuántos menores de cinco años con diferentes grados de desnutrición tienen una madre con sobrepeso/obesidad/ en una comunidad indígena que vive en extrema pobreza y bajo condiciones de migración masculina internacional. El segundo fue comparar tres variables socionutricionales (ingreso familiar, educación de la madre y adecuación nutrimental de la dieta diaria) entre estos hogares y los hogares con desnutrición infantil y madres sin obesidad. Se realizó un est...

  20. Cambios psicológicos en pacientes con espondiloartritis axial tratados con infliximab


    Morlà Novell, Rosa M.


    Es conocido que los pacientes con enfermedades reumáticas presentan alteraciones psicológicas relacionadas con su enfermedad articular crónica. Algunos estudios reportan el beneficio de las terapias biológicas en las espondiloartritis (EsP), pero son pocos los datos acerca del impacto de los fármacos biológicos en los síntomas psicológicos. El objetivo del estudio fue el de analizar la influencia del tratamiento con un fármaco biológico anti-TNFα, infliximab (IFX), en los síntomas de ansi...

  1. El empleo con apoyo como indicador de calidad de vida en personas con discapacidad intelectual


    Santamaría Domínguez, Mónica


    [ES]Esta tesis doctoral se desarrolló en el Instituto Universitario de Integración en la Comunidad (INICO) de la Universidad de Salamanca, como parte de una de sus principales líneas de investigación dedicada a la Inclusión Laboral, Empleo con Apoyo y Políticas Sociales. Cuya finalidad fue profundizar en el conocimiento de la calidad de vida de las personas con discapacidad intelectual que se encontraban trabajando a través de la metodología del empleo con apoyo. Para la evaluación de la cali...

  2. Evaluación del funcionamiento de una familia con un adolescente con Trastorno Afectivo Bipolar


    Angélica María Restrepo Rivera; Victoria Eugenia Acevedo Velasco


    El artículo describe la evaluación del funcionamiento de una familia con un miembro adolescente con diagnóstico de trastorno afectivo bipolar. La información recogida se analizó utilizando una matriz con cuatro categorías: límites interpersonales, comunicación, ciclo vital individual y familiar y creencias familiares. Los principales hallazgos evidencian alteraciones en las cuatro áreas evaluadas. Se encontraron límites rígidos y cohesión baja entre los miembros, altos niveles de conflicto...

  3. Terapias alternativas con animales para niños con necesidades especiales


    Cea-Chueca, Aihnoa


    El presente trabajo de fin de grado consiste en la realización de un análisis y descripción de la literatura acerca de las distintas terapias animales, destinadas a niños con necesidades especiales: cómo y por qué surgieron, en qué consisten las terapias, cómo podemos utilizarlas, etc. Las terapias alternativas con animales se conocen como una alternativa terapéutica, donde se utiliza a un animal como co-terapeuta para poder desarrollar diferentes capacidades de los niños con necesidades espe...

  4. AC Zeeman potentials for atom chip-based ultracold atoms (United States)

    Fancher, Charles; Pyle, Andrew; Ziltz, Austin; Aubin, Seth


    We present experimental and theoretical progress on using the AC Zeeman force produced by microwave magnetic near-fields from an atom chip to manipulate and eventually trap ultracold atoms. These AC Zeeman potentials are inherently spin-dependent and can be used to apply qualitatively different potentials to different spin states simultaneously. Furthermore, AC Zeeman traps are compatible with the large DC magnetic fields necessary for accessing Feshbach resonances. Applications include spin-dependent trapped atom interferometry and experiments in 1D many-body physics. Initial experiments and results are geared towards observing the bipolar detuning-dependent nature of the AC Zeeman force at 6.8 GHz with ultracold 87Rb atoms trapped in the vicinity of an atom chip. Experimental work is also underway towards working with potassium isotopes at frequencies of 1 GHz and below. Theoretical work is focused on atom chip designs for AC Zeeman traps produced by magnetic near-fields, while also incorporating the effect of the related electric near-fields. Electromagnetic simulations of atom chip circuits are used for mapping microwave propagation in on-chip transmission line structures, accounting for the skin effect, and guiding impedance matching.

  5. Aragonite coating solutions (ACS) based on artificial seawater (United States)

    Tas, A. Cuneyt


    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  6. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred; Olsen, Søren Krüger; Tønnesen, Ole

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  7. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;


    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  8. Factores de Accesibilidad Relacionados con Muerte Perinatal

    Directory of Open Access Journals (Sweden)

    Vilma del Socorro Catalán Álvarez


    Full Text Available Introducción: Objetivo Describir diferencias de factores relacionados con accesibilidad a servicios de salud, entre un grupo de mujeres que tuvieron parto en instituciones prestadoras de servicios de salud de Bucaramanga, cuyos productos sufrieron muerte perinatal y otro grupo con productos vivos, procedentes de Lebrija Santander año 2004. Materiales y métodos: estudio de caso descriptivo, retrospectivo. De 15 muerte perinatal reportadas, sólo 7 cumplían criterios de inclusión. Por cada muerte perinatal, se seleccionaron por conveniencia, 3 madres con niños vivos. Las variables estudiadas, mediante frecuencia absoluta y relativa, fueron: Características de la madre, del niño, Oportunidad, Percepción de atención, Funcionalidad, Costos. Resultados: 6 muerte perinatal previsibles, 1 no previsible. 3 pertenecían al régimen subsidiado, 1 al contributivo, 3 no aseguradas. Se observó, falta de oportunidad para remisión de madres e intervención del parto. Mujeres con 3 ó más controles, presentaron mayor frecuencia relativa de muerte perinatal. También se observó insatisfacción en la percepción de atención, en 3 aspectos estudiados, en 3 niveles de atención. Discusión y Conclusiones: Implementar políticas encaminadas a mejorar la oportunidad de atención materna-perinatal, facilitando acceso oportuno para prestación de servicios de salud. Controles prenatales enfocados en búsqueda de factores relacionados con muerte perinatal. Fortalecer Sistemas de Vigilancia Epidemiológica y Centro Regulador de Urgencias. (Rev Cuid 2010;1(1:26-34.Palabras clave: Mortalidad perinatal, Accesibilidad, Servicios de Salud. (Fuente DeCs, BIREME.

  9. Manejo de conductos radiculares con curvatura marcada

    Directory of Open Access Journals (Sweden)

    Jorge Mario Nuñez Duran


    Full Text Available Las variaciones anatómicas en dientes con conductos que poseen dilaceraciones hacen del tratamiento de endodonciaun reto o una complicación relativa, en donde el clínico debe desarrollar toda su habilidad y el uso de instrumentosespeciales que faciliten u optimicen la terapia de conductos radiculares. La toma de radiografías previas con diferentesangulaciones y el estudio minucioso de ellas, darán una ayuda fundamental para conocer más detalladamente estacomplicación anatómica, que en algunos casos es muy frecuente. El uso de instrumental más flexible y resistentepermite llegar con mayor precisión y seguridad a la parte apical sin que se corra el riesgo de fracturar los instrumentos,limpiándolos y modelándolos en toda su extensión para poder obturarlos de una manera correcta.El uso de limas de menor calibre, precurvadas, permite acceder a la porción dilacerada de la raíz. Este es un métodoeficaz para prevenir la perdida de longitud de trabajo y evitar así las perforaciones de las raíces durante la preparación.Dentro de los errores más comunes durante la instrumentación de los conductos está la perdida de longitud detrabajo, junto con la transportación del foramen apical, ya sea de manera externa o interna. En el presente artículose menciona el uso de nuevas y mejores técnicas usadas para poder evitar este tipo de errores y se muestra un casoclínico del manejo de un molar superior con una curvatura de 40 grados que fue preparado y obturado exitosamentecon el sistema Protaper (Dentsply- maillefer.

  10. Caracterización anual del metabolismo de las acículas de Pinus pinaster (Aiton) mediante procedimientos transcriptómicos y metabolómicos


    Cañas, Rafael A.; Canales, Javier; Muñoz, C; Ávila, Concepción; García-Martin ML; Cánovas, Francisco M.


    El presente trabajo pretende iniciar una serie de estudios sobre el metabolismo nitrogenado en árboles adultos de la conífera Pinus pinaster (Aiton) en condiciones naturales. Durante un año completo se ha caracterizado el metabolismo de las acículas de árboles de P. pinaster que crecen en el paraje natural de Los Reales de Sierra Bermeja, Estepona (Málaga). Para ello se han seguido dos aproximaciones diferentes. En primer lugar se ha analizado la expresión génica mediante el em...


    Directory of Open Access Journals (Sweden)

    Alexandra Pérez Idárraga


    Full Text Available Objetivo: comparar la efectividad rehidratante del agua de coco fresca, con el agua embotellada y una bebida deportiva. Metodología: once participantes de 22,0 ± 1,9 años y 65,6 ± 13,0 kg de masa corporal (promedio ± D.E, asistieron al laboratorio en tres ocasiones, separadas entre sí por una semana. En cada sesión se deshidrataron por ejercicio en el calor hasta perder 1,84 ± 0,2% de la masa corporal. Luego fueron rehidratados en una hora, con agua comercial embotellada (AE, una bebida deportiva (BD o agua de coco (AC, utilizando un volumen equivalente al 120% del peso perdido. Se evaluaron las sensaciones percibidas relacionadas con la tolerancia y la aceptación de las bebidas. Se recolectó la orina eliminada durante tres horas post-rehidratación. Resultados: Hubo interacción entre las bebidas y el tiempo sobre la orina excretada (p=0,003, siendo el AE estadísticamente diferente al AC y la BD a los 30 y 60 min post-rehidratación (p0,05. Esto produjo porcentajes de conservación de líquido diferentes para AE (56%, con respecto a BD (71% y AC (71% (p0,05. La percepción de la dulzura fue menor para AE (p= 0,024. BD obtuvo mejores puntajes de sabor y aceptación general (p<0,05. Conclusiones: el agua de coco fresca resulta tan efectiva como una bebida deportiva para conservar el líquido consumido, teniendo una buena tolerancia y aceptación. Podría ser usada como una bebida rehidratante, cuando la persona la tenga disponible y le agrade su sabor.

  12. Prueba de inmunodifusión radial con hapteno nativo para diferenciar bovinos con revacunaciones repetidas con la cepa S19 de Brucella abortus


    Esperanza González Miranda; Laura Hernández Andrade; Efrén Díaz Aparicio


    El objetivo del estudio fue establecer la capacidad de la inmunodifusión radial (IDR) con hapteno nativo, para diferenciar anticuerpos post-vacunales de anticuerpos por infección, en bovinos con revacunaciones repetidas de cepa S19. Se trabajó en un establo del estado de México, con presencia de abortos, retención de placenta, expulsiones y fetos momificados. Las becerras se vacunaban con dosis clásica de cepa S19 de B. abortus, y ya adultas revacunaciones anuales repetidas con dosis reducida...

  13. Estudio observacional prospectivo con insulina detemir en pacientes con diabetes mellitus tipo 2 mal controlados que inician por primer vez tratamiento con insulina (estudio SOLVE)


    Domingo Orozco-Beltrán; Sara Artola-Menéndez


    Objetivo: Describir la experiencia en atención primaria con insulina detemir en pacientes con diabetes mellitus tipo 2 mal controlados con antidiabéticos orales que necesitan incorporar una insulina a su terapia antidiabética. Métodos: Estudio observacional prospectivo de 6 meses de seguimiento realizado en 10 países. En España participaron solo centros de atención primaria. Se reclutaron pacientes con diabetes mellitus tipo 2 mal controlados a cuyo tratamiento con antidiabéticos orales se...

  14. System and method for determining stator winding resistance in an AC motor using motor drives

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Bin; Habetler, Thomas G; Zhang, Pinjia


    A system and method for determining the stator winding resistance of AC motors is provided. The system includes an AC motor drive having an input connectable to an AC source and an output connectable to an input terminal of an AC motor, a pulse width modulation (PWM) converter having switches therein to control current flow and terminal voltages in the AC motor, and a control system connected to the PWM converter. The control system generates a command signal to cause the PWM converter to control an output of the AC motor drive corresponding to an input to the AC motor, selectively generates a modified command signal to cause the PWM converter to inject a DC signal into the output of the AC motor drive, and determines a stator winding resistance of the AC motor based on the DC signal of at least one of the voltage and current.

  15. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione


    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  16. Voltage drop of the SACLA AC power supply

    International Nuclear Information System (INIS)

    We installed the AC power supply of SACLA by construction. The AC power supply is connected to an inverter power supply. Because of charge and discharge to a modulator, it is necessary to supply pulsatile electricity. The total consumption electricity of approximately 70 modulators extends to 5,000kVA. A severe electric current flows, and repeats relaxing. The influence of the voltage change by the impedance of the distribution system grows big, too. In SACLA, we designed the voltage regulation at less than 10%. SACLA succeeded in laser oscillation in this June. Because we was able to put it in the predetermined voltage regulation in the machine AC power supply, I report the details. (author)

  17. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna


    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  18. Microdischarges of AC-coupled silicon strip sensors

    International Nuclear Information System (INIS)

    Microdischarge at the edges of strips in AC-coupled silicon strip sensors has been investigated. A steep increase in the leakage current (breakdown) and a sudden onset of burst noise were observed at a low reverse-bias voltage when the bias potential was across the AC-coupling capacitor. This can be explained by the occurrence of microdischarges along the edges of strips. These discharges have been confirmed by observing IR light emission. A calculation of the field strength at the strip edge suggests that a fringe field of the external electrode generates the microdischarge at the strip edge when the bias voltage is 50-80 V. This is consistent with our observations. We discuss a design for AC-coupled sensors that eliminates this discharge problem. (orig.)

  19. Reliability of emergency ac power systems at nuclear power plants

    International Nuclear Information System (INIS)

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project

  20. Analysis of ac Surface Photovoltages in Accumulation Region (United States)

    Munakata, Chusuke


    Equations for ac surface photovoltages (SPVs) excited with a chopped photon beam (PB) in the accumulation region are proposed for such semiconductors as silicon and germanium. Following the previously reported half-sided junction model for the depleted or inverted region, equations for photocurrent density and surface impedance per unit area have been newly deduced. When the surface potential is highly negative in p-type semiconductors, the maximum ac SPV in the accumulation region is limited by the conductance due to majority carrier diffusion flow. This is compared with the strong inversion region, where the mathematically maximum SPV depends upon the minority carrier diffusion flow. The voltage ratio between the two maximum ac SPVs is the same as that previously reported using the different models for dc SPVs excited with a continuous PB.

  1. Experiments on Corona Discharge Under AC and DC Composite Voltage

    Institute of Scientific and Technical Information of China (English)

    ZHU Zhengyi; LI Ruihai; WANG Guoli; CHEN Can; JIA Zhidong; GUAN Zhicheng


    Converter transformers are one of the most important electrical apparatuses in the ultra high voltage(UHV) DC transmission systems.The valve side and the low voltage(LV) bushing are stressed by long-term AC and DC composite voltage leading to significant partial discharge(PD) and posing great danger to the insulation system.In this paper AC and DC composite voltage is applied on a metal needle-plate model to produce PD signal sequences,and then the pulse waveshape and frequency spectrum are analyzed and compared with PD signals under conventional AC or DC voltage.In the end,the phase-resolved distribution is analyzed to depict the new characteristics of PD under this composite voltage.

  2. Encapsulation of α-Particle–Emitting 225Ac3+ Ions Within Carbon Nanotubes (United States)

    Matson, Michael L.; Villa, Carlos H.; Ananta, Jeyarama S.; Law, Justin J.; Scheinberg, David A.; Wilson, Lon J.


    225Ac3+ is a generator of α-particle–emitting radionuclides with 4 net α-particle decays that can be used therapeutically. Targeting 225Ac3+ by use of ligands conjugated to traditional bifunctional chelates limits the amount of 225Ac3+ that can be delivered. Ultrashort, single-walled carbon nanotubes (US-tubes), previously demonstrated as sequestering agents of trivalent lanthanide ions and small molecules, also successfully incorporate 225Ac3+. Methods Aqueous loading of both 225Ac3+ ions and Gd3+ ions via bath sonication was used to construct 225Ac@gadonanotubes (225Ac@GNTs). The 225Ac@GNTs were subsequently challenged with heat, time, and human serum. Results US-tubes internally loaded with both 225Ac3+ ions and Gd3+ ions show 2 distinct populations of 225Ac3+ ions: one rapidly lost in human serum and one that remains bound to the US-tubes despite additional challenge with heat, time, and serum. The presence of the latter population depended on cosequestration of Gd3+ and 225Ac3+ ions. Conclusion US-tubes successfully sequester 225Ac3+ ions in the presence of Gd3+ ions and retain them after a human serum challenge, rendering 225Ac@GNTs candidates for radioimmunotherapy for delivery of 225Ac3+ ions at higher concentrations than is currently possible for traditional ligand carriers. PMID:25931476

  3. Esporotricosis cutánea diseminada con compromiso articular en una mujer con diabetes tipo 2

    Directory of Open Access Journals (Sweden)

    Sendy Solorzano


    Full Text Available La esporotricosis diseminada es una presentación infrecuente de esta micosis. Aunque ha sido descrita en sujetos inmunocompetentes, con frecuencia existe compromiso de la inmunidad mediada por células T. Reportamos el caso de una mujer con diabetes tipo 2 no controlada que desarrolló esporotricosis cutánea diseminada. El curso de la enfermedad presentó varias complicaciones que incluyeron hepatitis secundaria a itraconazol y artritis de la rodilla con cultivo positivo para Sporothrix schenckii durante el tratamiento con solución saturada de ioduro de potasio. La discusión del caso incluye aspectos de la patogénesis de la esporotricosis diseminada y el manejo de la infección y sus complicaciones.

  4. Esporotricosis cutánea diseminada con compromiso articular en una mujer con diabetes tipo 2

    Directory of Open Access Journals (Sweden)

    Sendy Solorzano


    Full Text Available La esporotricosis diseminada es una presentación infrecuente de esta micosis. Aunque ha sido descrita en sujetos inmunocompetentes, con frecuencia existe compromiso de la inmunidad mediada por células T. Reportamos el caso de una mujer con diabetes tipo 2 no controlada que desarrolló esporotricosis cutánea diseminada. El curso de la enfermedad presentó varias complicaciones que incluyeron hepatitis secundaria a itraconazol y artritis de la rodilla con cultivo positivo para Sporothrix schenckii durante el tratamiento con solución saturada de ioduro de potasio. La discusión del caso incluye aspectos de la patogénesis de la esporotricosis diseminada y el manejo de la infección y sus complicaciones.

  5. Guía de recursos para alumnos con discapacidad




    Ha sido política del Ministerio de Educación y Ciencia, mantener una estrecha colaboración con las entidades que desarrollan su labor en el ámbito de las personas con discapacidad, con objeto de prestar al alumnado con necesidades educativas especiales una atención educativa de calidad y propiciar los recursos materiales y personales necesarios. En esta línea de actuación, el Ministerio, de acuerdo con el Comité Español de Representantes de Personas con Discapacidad (CERMI), constituyó el ...

  6. AC power losses in Bi-2223/Ag HTS tapes

    International Nuclear Information System (INIS)

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude Im of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ Imn for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  7. Medidas de amplitud y frecuencia con el osciloscopio. Resonancia con ondas sonoras


    Miret Marí, Juan José; Caballero Caballero, María Teresa; Espinosa Tomás, Julián; Pérez Rodríguez, Jorge


    Guión de la práctica de Física de primero de grado en Óptica y Optometría "MEDIDAS DE AMPLITUD Y FRECUENCIA CON EL OSCILOSCOPIO. RESONANCIA CON ONDAS SONORAS" Objetivos: Adquirir unos conocimientos generales sobre el funcionamiento del osciloscopio y visualizar una señal, midiendo su amplitud y frecuencia. Utilizar el osciloscopio para visualizar ondas sonoras y estudiar de forma práctica el fenómeno de resonancia.

  8. Aligned Immobilization of Proteins Using AC Electric Fields. (United States)

    Laux, Eva-Maria; Knigge, Xenia; Bier, Frank F; Wenger, Christian; Hölzel, Ralph


    Protein molecules are aligned and immobilized from solution by AC electric fields. In a single-step experiment, the enhanced green fluorescent proteins are immobilized on the surface as well as at the edges of planar nanoelectrodes. Alignment is found to follow the molecules' geometrical shape with their longitudinal axes parallel to the electric field. Simultaneous dielectrophoretic attraction and AC electroosmotic flow are identified as the dominant forces causing protein movement and alignment. Molecular orientation is determined by fluorescence microscopy based on polarized excitation of the proteins' chromophores. The chromophores' orientation with respect to the whole molecule supports X-ray crystal data. PMID:26779699

  9. AC transport in graphene-based Fabry-Perot devices


    Rocha, Claudia G; Torres, Luis E. F. Foa; Cuniberti, Gianaurelio


    We report on a theoretical study of the effects of time-dependent fields on electronic transport through graphene nanoribbon devices. The Fabry-P\\'{e}rot interference pattern is modified by an ac gating in a way that depends strongly on the shape of the graphene edges. While for armchair edges the patterns are found to be regular and can be controlled very efficiently by tuning the ac field, samples with zigzag edges exhibit a much more complex interference pattern due to their peculiar elect...

  10. A.C. losses in current-carrying superconductors

    International Nuclear Information System (INIS)

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  11. AC Loss Analysis on the Superconducting Coupling Magnet in MICE

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Hong; Wang, Li; Green, Michael; Li, LanKai; Xu, FengYu; Liu, XiaoKun; Jia, LinXinag


    A pair of coupling solenoids is used in MICE experiment to generate magnetic field which keeps the muons within the iris of thin RF cavity windows. The coupling solenoids have a 1.5-meter inner diameter and will produce 7.4 T peak magnetic field. Three types of AC losses in coupling solenoid are discussed. The affect of AC losses on the temperature distribution within the cold mass during charging and rapid discharging process is analyzed also. The analysis result will be further confirmed by the experiment of the prototype solenoid for coupling solenoid, which will be designed, fabricated and tested at ICST.

  12. Interplay between electron overheating and ac Josephson effect (United States)

    De Cecco, A.; Le Calvez, K.; Sacépé, B.; Winkelmann, C. B.; Courtois, H.


    We study the response of high-critical-current proximity Josephson junctions to a microwave excitation. Electron overheating in such devices is known to create hysteretic dc voltage-current characteristics. Here we demonstrate that it also strongly influences the ac response. The interplay of electron overheating and ac Josephson dynamics is revealed by the evolution of the Shapiro steps with the microwave drive amplitude. Extending the resistively shunted Josephson junction model by including a thermal balance for the electronic bath coupled to phonons, a strong electron overheating is obtained.

  13. Geodetska dela pri izgradnji AC priključka Naklo


    Pavc, Iztok


    V diplomski nalogi sem predstavil geodetska dela pri izgradnji AC priključka Naklo. Opisana so dela pred, med in po izgradnji objekta. V prvem poglavju sem predstavil smernice in načrte nove ureditve priključka na avtocesto ter obseg gradnje AC priključka Naklo. Nadaljeval sem z geodetskimi deli pred gradnjo, ki so potrebni za pripravo dobrega izhodišča za nadaljnja delo med gradnjo. Opisani so vsi postopki, ki so bili opravljeni pred pripravo projekta za gradbeno dovoljenje (PGD) in tudi pre...

  14. Dynamic conductivity of ac-dc-driven graphene superlattice (United States)

    Kukhar', E. I.; Kryuchkov, S. V.; Ionkina, E. S.


    The dynamic conductivity of graphene superlattice in the presence of ac electric field and dc electric field with longitudinal and transversal components with respect to superlattice axis was calculated. In the case of strong transversal component of dc field conductivity of graphene superlattice was shown to be such as if the electrons had got the effective mass. In the case of weak transversal component of dc field conductivity was shown to change its sign if the frequency of ac field was an integer multiple of half of Bloch frequency.

  15. Development of an AC Module System: Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Suparna Kadam; Miles Russell


    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  16. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens


    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are...... stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function...

  17. L’acétaminophène chez les enfants (United States)

    Goldman, Ran D.


    Résumé Question Je suggère fréquemment aux parents d’utiliser de l’acétaminophène comme traitement de la fièvre et de la douleur pour leurs enfants. J’ai récemment reçu un enfant à mon cabinet qui s’est présenté avec une éruption cutanée sous forme de lésions en cibles une journée après avoir pris de l’acétaminophène. L’éruption s’est résorbée 3 jours après qu’on ait arrêté l’administration d’acétaminophène. L’acétaminophène comporte-t-elle des risques d’événements indésirables comme celui-ci? Réponse Comme les autres médicaments ou substances actives, les préparations d’acétaminophène pourraient poser des risques d’événements indésirables. Au cours des dernières années, on a procédé à une investigation concernant une association potentielle entre l’acétaminophène et l’asthme et la Food and Drug Administration des États-Unis a récemment publié un avertissement à propos de réactions cutanées éventuelles, graves mais rares, associées à l’acétaminophène. Même si l’acétaminophène est principalement un médicament sûr, les professionnels de la santé devraient être alertes et informer les parents à propos de la possibilité d’événements indésirables rares mais sévères.

  18. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung


    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  19. Modulación adaptativa y diversidad en canales de comunicaciones acústicas subacuáticas


    Clemente Medina, María del Carmen


    El objetivo general de la tesis es evaluar las técnicas de transmisión de datos a alta velocidad más adecuadas para canales de comunicaciones acústicas subacuáticas. Se centra en la técnica madura de modulación adaptativa, donde el canal se estima en recepción. Esta técnica adaptativa se puede combinar con la codificación de canal que desarrolla y analiza códigos orientados a facilitar la detección y corrección de los errores originados a causa del paso de las señales por el medio de transmis...

  20. Proyecto de instalación solar para ACS, calefacción y piscina en un edificio de viviendas


    Relaño Peña, Antonio Luis


    Con arreglo al nuevo Código Técnico de la Edificación, en el que se establece unos niveles mínimos de contribución solar para ACS en los edificios de nueva construcción y rehabilitación, por el interés por las energías renovables y la eficiencia energética el alumno ha realizado el siguiente proyecto. En este proyecto se ha pretendido realizar un diseño de la instalación que sea por una parte lo más eficiente posible desde el punto de vista energético y por otra parte que su utilización sea l...

  1. Dicty_cDB: FCL-AC27 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tnkqktsdesashkylc kiyi**iliflfilfsc*slsdfpnikkkkkkkk Homology vs CSM-cDNA Score E Sequences pr... Representativ...e seq. ID FCL-AC27Z (Link to Original site) Representative DNA sequence >FCL-AC27 (FCL-AC27Q) /CSM/FCL/FCL-A...VDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tnkqktsdesas.../CSM/SF/SFJ3-A/SFJ302Q.Seq.d/ 1045 0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing sig

  2. Dicty_cDB: FCL-AC10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Representativ...e seq. ID FCL-AC10Z (Link to Original site) Representative DNA sequence >FCL-AC10 (FCL-AC10Q) /CSM/FCL/FCL-A...LTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesashtnkyi* my...GNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesashtnkyi* mynnnki....00 m_ : 1.00 40.0 %: nuclear 36.0 %: cytoplasmic 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> pre

  3. Impacts on Power Factor of AC Voltage Controllers Under Non-Sinusoidal Conditions

    Directory of Open Access Journals (Sweden)

    Mukhtiar Ahmed Mahar


    Full Text Available AC-AC conversion is obtained with the help of Cyclo-converters, DC Link converters and AC Voltage Controllers. AC voltage controllers are also referred to as voltage regulators. Main issue concerned to these converters is that they generate harmonics due to periodic variable structure system. The generated harmonics create disturbances and degrade the performance of converter. The power factor of supply side is affected due to these harmonics. This paper focuses on source side power factor of ac voltage controllers under nonsinusoidal conditions. In order to observe the power factor, measurement tool of power factor and simulation model of ac voltage controller is also developed in MATLAB software.

  4. de Madrid: Metodología de análisis y diagnóstico con SIG

    Directory of Open Access Journals (Sweden)

    Pedro Martínez Suárez


    Full Text Available La conveniencia de que ciertas actividades se desarrollen en un ambiente apropiado, particularmente en materia de ruido, se ha ido asentando racional y normativamente de manera inequívoca, debido a las repercusiones que tienen sobre el bienestar o salud humanas. La disponibilidad reciente de mejores datos sonoros sobre el ámbito urbano está abriendo la posibilidad de determinar las características acústicas de los entornos exteriores que envuelven a diversas instalaciones y equipamientos, y valorar luego su adecuación. Esta investigación, a través de las herramientas que ofrecen los sistemas de información geográfica, avista analizar el ambiente sonoro urbano asociado a los centros hospitalarios de la ciudad de Madrid, cuya función les hace recaer en la categoría de «áreas acústicas de silencio (Tipo I» según la ordenanza municipal de Madrid. A tal fin se establece primero la noción de entorno acústico de un equipamiento y luego se formula y aplica, con el soporte de SIG y técnicas estadísticas, una metodología de análisis espacial adecuada para este tipo de instalaciones urbanas, con su propia valoración crítica. Se configura así una herramienta efectiva para el diagnóstico de situaciones ambientales urbanas y para suscitar ulteriores medidas de control sobre las fuentes o paliación de las inmisiones sonoras.

  5. Evaluation of the behavior of PtPd/MWCNT electrocatalysts as ethylene glycol-tolerant electrodes for oxygen oxidation reaction (ORR); Evaluacion del comportamiento de electrocatalizadores tipo PtPd/MWCNT como electrodos para la reaccion de oxidacion del oxigeno (ORR) tolerantes al etilenglicol

    Energy Technology Data Exchange (ETDEWEB)

    Morales-Acosta, D.; Arriaga, L.G. [Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Pedro Escobedo, Queretaro (Mexico)]. E-mail:; Alvarez-Contreras, L. [Centro de Investigacion en Materiales Avanzados S. C., Chihuahua, Chihuahua (Mexico); Fraire Luna, S.; Rodriguez Varela, F.J. [Cinvestav, Unidad Saltillo, Ramos Arizpe, Coahuila, (Mexico)


    Pt-Pd/MWCNTs (atomic ratio Pt:Pd 43:57) and Pt/MWCNTs electrocatalysts were synthesized and evaluated as cathodes for oxygen reduction reaction (ORR) with the application of direct ethylene glycol fuel cells (DEGFC). A commercial PtC material was also evaluated as a reference. It was found that Pt-Pd/MWCNT has a capability for high tolerance to ethylene glycol (EG) and higher selectivity for ORR compared to a single Pt- cathode. As a result, the change in onset potential of the ORR, Eonset, in Pt-Pd/MWCNTs was considerably less than the change in Pt/MWCNTs or Pt/C. The average particle size (XRD) was 3.5nm and 4nm for Pt/MWCNTs and Pt-Pd/MWCNTs, respectively. A moderate degree of alloying was determined for the material. The application of Pt-Pd electrocatalysts in DEGFCs should be advantageous. [Spanish] Electrocatalizadores Pt-Pd/MWCNTs (relacion atomic Pt:Pd 43:57) y Pt/MWCNTs fueron sintetizados y evaluados como catodos para la reaccion de reduccion del oxigeno (ORR) con aplicacion del celdas de consumo directo de etilenglicol (Direct Ethylene Glycol Fuel Cells, o DEGFC). Como referencia, un material comercial tipo Pt/C fue tambien evaluado. Se encontro que Pt-Pd/MWCNTs tiene una alta capacidad de tolerancia al etilenglicol (EG) y una selectividad mayor hacia la ORR comparado con el catodo basado en Pt-solo. Como resultado, el cambio en potencial de inicio de la ORR, Eonset, en Pt-Pd/MWCNTs fue considerablemente menor que el cambio en Pt/MWCNTs o Pt/C. La talla de particula promedio (de XRD) fue 3.5 nm y 4 nm para Pt/MWCNTs y Pt-Pd/MWCNTs, respectivamente. Un moderado grado de aleacion fue determinado para el material. Una aplicacion ventajosa para electrocatalizadores tipo Pt-Pd debe ser en DEGFCs.

  6. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  7. Reclutando profesionales con deseos de empleo.

    Directory of Open Access Journals (Sweden)

    Teresa Farfán Cabrera


    Full Text Available En los últimos años la vinculación retórica de la globalización con el empleo ha creado una serie de retos y prejuicios respecto a la forma en que la primera ha afectado la organización y producción del conocimiento dentro de las instituciones de educación superior públicas, lo que llevó a tomar caminos separados, pero ya es tiempo de generar nuevas formas de acercamiento que vinculen a los profesionistas con el actual mercado laboral y sus formas de contratación como un ejerció donde ambas partes puedan generar soluciones a problemas comunes.

  8. Traducir utilizando Internet, Traducir con Speechy Project

    Directory of Open Access Journals (Sweden)

    Nicolás Fermín Pino James


    Full Text Available Speechy Project surgió el pasado otoño de 2009 con la intención de ayudar a estudiantes de nivel avanzado de lengua inglesa a sacarle partido a Internet. Desde entonces, este sitio web ha “tamizado” la red con el objetivo de seleccionar los mejores recursos online y clasificarlos ordenadamente en sus listas a posteriori.  En esta corriente, varias filtraciones se han llevado a cabo en diferentes campos de la lengua inglesa. Este artículo se centrará en el campo de la Traducción que se proyecta en Speechy Project como una organizada red cooperativa formada (y mantenida por seis voluntarios.

  9. Monitoreo de PostgreSQL con Munin

    Directory of Open Access Journals (Sweden)

    Gunnar Eyal Wolf Iszaevich


    Full Text Available Una de los principales tareas del trabajo diario de un administrador de sistemas, redes o bases de datos es el monitoreo de recursos. Con herramientas adecuadas de monitoreo, el administrador puede no sólo detectar un problema antes de que cause interrupciones en la operación de los sistemas, sino que puede prevenir que ocurran, conociendo la evolución histórica de los valores relevantes. En el presente trabajo presento el marco de recopilación y graficación de datos Munin, enfocándome a su uso para monitorear el gestor de base de datos relacional PostgreSQL, así como en la flexiblilidad y facilidad con que administradores y programadores pueden adecuarlo para desarrollar plugins específicos para el monitoreo de sus necesidades puntuales.


    Directory of Open Access Journals (Sweden)

    Jorge Hasbún H.


    Full Text Available El propósito del estudio es la detección de trombofilia hereditaria en pacientes con antecedente de trombosis y la evaluación de la profilaxis secundaria con Heparina de bajo peso molecular en el embarazo siguiente, en un diseño observacional prospectivo. Pacientes y Método. En once pacientes con Trombosis reciente se investigó Trombofilias: Antitrombina III, Proteína C, Proteina S, Factor V Leiden (Resistencia a la proteina C activada, Hiperhomocisteinemia (Mutación de la metiltetrahidrofolato reductasa MTHFR del gen C677T, Mutación G20210A de la Protrombina y Sindrome Antifosfolípidos (anticuerpos anticardiolipina y anticoagulante lúpico mediante determinación plasmática de los factores de coagulación. En el embarazo siguiente fueron tratadas desde el primer trimestre con Dalteparine sódica 2500 - 5000 U sbc/día, en forma continua durante la gestación y en los dos meses de puerperio, con suspensión periparto. Los embarazos fueron vigilados en forma estricta con evaluación clínica, ecográfica y controles de coagulación. Resultados: Se confirmó Trombofilia en todos los casos. Ocho pacientes tuvieron Trombofilia aislada: tres Deficiencia Prot S, dos Def Prot C, dos Factor V de Leiden y un caso de Mutación MTHF Gen C677T. Tres pacientes presentaron Trombofilia combinada: un caso con GenP 20210A + Def Prot S + Mutación MTHF Gen C677T y dos casos con Factor V + Mutación MTHF Gen C677T. En la evolución de la gestación hubo once embarazos de término sin complicaciones obstétricas ni secundarias a la tromboprofilaxis y tres abortos espontáneos. Se concluye que la detección de Trombofilias es muy importante en mujeres en riesgo y que la Dalteparine es segura en la profilaxis de trombosis durante el embarazo. Se discuten los hallazgos clínicos y su significado, el riesgo trombótico y se hacen consideraciones sobre la pesquisa y el tratamientoDetection of inherited thrombophilia in patients with recient thrombosis and

  11. VANET Routing Protocols: Pros and Cons

    CERN Document Server

    Paul, Bijan; Bikas, Md Abu Naser


    VANET (Vehicular Ad-hoc Network) is a new technology which has taken enormous attention in the recent years. Due to rapid topology changing and frequent disconnection makes it difficult to design an efficient routing protocol for routing data among vehicles, called V2V or vehicle to vehicle communication and vehicle to road side infrastructure, called V2I. The existing routing protocols for VANET are not efficient to meet every traffic scenarios. Thus design of an efficient routing protocol has taken significant attention. So, it is very necessary to identify the pros and cons of routing protocols which can be used for further improvement or development of any new routing protocol. This paper presents the pros and cons of VANET routing protocols for inter vehicle communication.

  12. Comunicándonos con las cosas

    Directory of Open Access Journals (Sweden)

    Miguel Delgado


    Full Text Available Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  13. Intervista con Fabiola Gianotti, Portavoce esperimento ATLAS

    CERN Multimedia

    CERN Video Productions


    Domande : 1. Come ci si sente come Portavoce di un grande esperimento internazionale come ATLAS nel momento in cui LHC sta per produrre i primi dati? 2. Il rivelatore è pronto per i dati? 3. Quindi l'anno di arresto non è stato inutile? 4. Cosca cisi può aspettare da LHC con l'energia di 3,5 TeV per fascio? 5. Cosa succederà il giorno delle prime collisioni in sala di controllo di ATLAS?

  14. Bibliotecari con Moodle, su Moodle, per Moodle


    Boscaro, Elena; Cognola, Ruben; De Robbio, Antonella


    This is the presentation of the poster "Bibliotecari con Moodle, su Moodle, per Moodle" shown at Moodlemoot Italia 2008, forth edition of the users of Moodle's annual meeting held at the University of Padua in May 9-10, 2008. Nowadays, one of the fundamental missions of a university digital library is to cooperate and integrate with e-learning: academic digital libraries are asked to support the new ways and models of contemporary didactics through the use of training and educational mater...

  15. Comunicándonos con las cosas


    Miguel Delgado; Sergio Ciruela; Nicolás Marín


    Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  16. Bacteriemia en pacientes internados con celulitis

    Directory of Open Access Journals (Sweden)

    Juan S. Lasa


    Full Text Available La celulitis es una inflamación aguda de la dermis y tejido celular subcutáneo de causa bacteriana, que generalmente complica a heridas, úlceras y dermatosis, aunque de manera frecuente no existe sitio de entrada. Se recomienda la realización de cultivo de punción de piel y partes blandas (PPB. Los hemocultivos raramente dan resultados positivos. El objetivo de este trabajo fue determinar la prevalencia de bacteriemia en pacientes internados en nuestra institución con diagnóstico de celulitis. Se analizaron retrospectivamente los registros clínicos de los pacientes con este diagnóstico al ingreso entre junio de 2007 y marzo de 2010. Se evaluaron los datos poblacionales, presencia de comorbilidades, y resultados de los cultivos. En ese período, se internaron 140 pacientes con diagnóstico de celulitis y a todos ellos se les realizó hemocultivo y cultivos de PPB. Setenta y cuatro eran varones (52.8%. La edad promedio: 47.5 ± 19.7 años (rango 16-94. El 40% tuvo cultivos positivos de PPB, en los que el Staphylococcus aureus meticilino resistente (SAMR fue el germen más frecuentemente aislado (35.7%; la prevalencia de bacteriemia fue del 8.6%, en donde el germen más frecuente fue Streptoccocus Beta hemolítico, grupo G (33% del total de hemocultivos positivos. La bacteriemia se asoció significativamente a mayor estadía hospitalaria (10.5 ± 8.9 vs. 4.9 ± 6, p = 0.004. Se asoció con mayor riesgo de hemocultivo positivo a ser diabético, tener cultivo de PPB positivo, consumo de alcohol y/o enfermedad pulmonar obstructiva crónica.

  17. Miasis en paciente con Carcinoma Basocelular

    Directory of Open Access Journals (Sweden)

    Dr. Hugo Pérez Vedia


    Full Text Available Paciente de sexo masculino, de 71 años de edad, proveniente de la provincia Chapare, Cochabamba, es remitido por sus familiares al servicio de Infectologíadel Hospital Obrero Nº2 Caja Nacional de Salud, tras presentar cuadro clínico de varios días de evolución, caracterizado por lesión ulcerada de bordes irregulares, con secreciónserosanguinolenta localizada en hemicara derecha, con extensión a tejidos profundos y destrucción ósea con pérdida del pabellón auricular derecho,destrucción de la fosa nasal derecha, exposición de globo ocular por destrucción de tejido,destrucción del paladar duro y blando del lado derecho, lengua saburral, faringe hiperémica,acompañado de dolor intenso y signos de un procesoinfeccioso-inflamatorio en la zona, además de presentar larvas en dicha lesión, y antecedentes de carcinoma basocelular de 20 añosde evolución.

  18. Effect of combining a DC bias current with an AC transport current on AC losses in a High Temperature Superconductor


    Dolez, Patricia; Ligneris, Benoit des; Aubin, Marcel; Zhu, When; Cave, Julian


    Creating complex flux configurations by superposing a dc current or magnetic field onto the ac current in a type II superconducting tape should lead to a variety of peculiar behaviors. An example is the appearance of the Clem valley, a minimum in the ac losses as a function of the dc bias amplitude, which has been theoretically studied by LeBlanc et al., in the continuation of Clem's calculations. These situations have been investigated by applying a dc current to a silver-gold sheathed Bi-22...



    Wang, Kunrong


    The generic concept of quasi-single-stage (QSS) power conversion topology for ac-dc rectification and dc-ac inversion is proposed. The topology is reached by direct cascading and synchronized switching of two variety of buck or two variety of boost switching networks. The family of QSS power converters feature single-stage power processing without a dc-link low-pass filter, a unidirectional pulsating dc-link voltage, soft-switching capability with minimal extra commutation circuitry, simple...

  20. Uso de la estimulación espinal en pacientes con dolor crónico intratable en la Clínica del Dolor del C.M.N "20 de Noviembre" del ISSSTE: Nuestra experiencia Use of the Spinal Cord Stimulation in patients with severe chronic pain in the C.M.N "20 of November" Pain Unit: Our experience

    Directory of Open Access Journals (Sweden)

    A. A. Medina-Gutiérrez


    Full Text Available Introducción y objetivos: El manejo de los pacientes con dolor crónico, se basa en la terapéutica multimodal... La neuroestimulacíon espinal es parte de este manejo en pacientes con dolor crónico intratable. El objetivo del trabajo es conocer la utilidad de la estimulación para el control del dolor y su impacto en la calidad de vida en pacientes del CMN 20 de noviembre. Material y métodos: 31 pacientes con dolor crónico intratable y discapacidad, evaluados mediante escala visual análoga, índice de Oswestry previo a la colocación del electrodo de estimulación espinal con seguimiento de 3 meses hasta 3 años. Evaluación estadística mediante pruebas de tendencia central y ANOVA (p significativa: =0.005. Resultados: Se encontraron 31 pacientes, con edad promedio de 53.7 años, sexo femenino 67.74%, sexo masculino 32.26%, portadores de Sx postlaminectomía 67.74 %, EVA (media previo a la implantación de 8.3 (DS 0.877. Se reportó un Oswestry inicial de 31.9 (DS 3.714 equivalente a un 63.6 de discapacidad. Posterior a 3 meses de la implantación se observó reducción media del EVA a 2.81, (DS 1.166 la cual fue estadísticamente significativa (p=0.003 y se reportó un Oswestry media de 18.29 (DS 1.918 equivalente a 36.58% de discapacidad. El 6.45% de los pacientes (2 presentó complicaciones menores posteriores a la implantación. Así mismo se encontró en 2 pacientes (6.45% migración del electrodo en los estudios de control, 2 pacientes (6.45% reportaron complicaciones relacionas al equipo. Discusión: Los resultados obtenidos son similares a lo reportado por otros autores. Encontramos una reducción estadísticamente significativa en el EVA aun y el pequeño numero de pacientes en nuestro estudio. Las complicaciones presentadas son similares y dentro de lo reportado. Consideramos que la estimulación espinal es una opción en el manejo intervencionista de pacientes con dolor crónico intratable cuando se realiza una adecuada selecci