WorldWideScience

Sample records for ac con electrodos

  1. Comportamiento del tiempo de duración, la frecuencia de los cortocircuitos y la conductividad eléctrica durante el reencendido del arco en la soldadura SMAW (AC con electrodos E6013 Behavior of short-circuit frequency and duration time and electrical conductivity on arc turn- on during SMAW (AC with E6013 electrodes

    Directory of Open Access Journals (Sweden)

    Alejandro García Rodríguez

    2009-03-01

    Full Text Available El presente trabajo tiene como objetivo la evaluación del comportamiento del tiempo de duración, la frecuencia de los cortocircuitos y la conductividad durante el reencendido del arco en el proceso de soldadura SMAW (Shielded Metal Arc Welding, con corriente alterna y electrodos E6013. El análisis estadístico no-paramétrico garantiza un procesamiento robusto de los datos, atenuando la influencia de valores atípicos y errores derivados del empleo de aproximaciones a distribuciones continuas conocidas. La mediana y la mediana de la desviación absoluta (MAD, respecto a la mediana de los datos, constituyen los estimadores de localización y dispersión utilizados, respectivamente. El electrodo, en el régimen de 160 A, presenta una mayor estabilidad, en el aporte metálico, dada por el menor valor del MAD promedio del período de cortocircuito (39,36 ms y de la duración del cortocircuito (1,43 ms, reafirmada con la presencia de una mayor conductividad eléctrica durante el reencendido (1766,17x10-3 S·s-1.The objective of this work is the valuation of the behavior of short-circuits frequency and duration time and electrical conductivity on arc reigniting in SMAW (Shielded Metal Arc Welding process with alternate current and E6013 electrodes. The non parametric statistic analysis realize a robust data processing, minimizing the outliers influence and mistakes derivates about employ of approximations to well know continues distributions. The median and the median absolute deviation (MAD respect to median of the data are the localization and dispersion estimators used, respectively. The electrode at 160 A present a better stability on metal transference supported on the most little value of MAD for the period of transference (39,36 ms, and the MAD of the short-circuit duration (1,43 ms, according with the presence of a major electric conductivity during the arc reigniting (1766,17x10-3 S·s-1.

  2. Aplicación de técnicas voltamperométricas con electrodos serigrafiados a la especiación de metales pesados en muestras naturales

    OpenAIRE

    Sosa Gómez, Velia Ruth

    2015-01-01

    El principal objetivo de esta Tesis es el estudio de la viabilidad analítica de nuevos dispositivos electródicos como son los electrodos serigrafiados modificados con bismuto o antimonio como materiales alternativos al mercurio en la determinación y especiación de metales pesados mediante técnicas voltamperométricas. La tecnología del serigrafiado permite la fabricación de dispositivos económicos y desechables de sistemas electródicos como alternativa a los electrodos clásicos que se pue...

  3. Efecto de la pirolusita, la caliza+fluorita y el ferrocromomanganeso en un electrodo básico con revestimiento periférico

    Directory of Open Access Journals (Sweden)

    Amado Cruz-Crespo

    2015-12-01

    Full Text Available Se evaluó el comportamiento de electrodos revestidos AWS E 7018, en función del contenido de los componentes en el revestimiento periférico aplicado, con el objetivo de mejorar su desempeño. Las proporciones en las mezclas para los revestimientos se establecieron con base en un diseño experimental de tipo Mc Lean Anderson, donde las variables de entrada son: X1- la pirolusita, X2- la caliza+fluorita (para relación caliza: fluorita=1 y X3- el FeCrMn. Las mezclas homogenizadas fueron aglomeradas con silicato de sodio y agua para conformar las pastas que se aplicaron por inmersión sobre el revestimiento básico de los electrodos de 3,2 mm de diámetro del núcleo metálico. Para evaluar los electrodos fueron obtenidas las isolíneas de comportamiento de las tasas de fusión y deposición, de la eficiencia de deposición y de la geometría de los cordones. Se concluye que la composición del revestimiento de mejor desempeño condiciona cambios favorables frente al electrodo sin revestimiento periférico, ya que aumenta la profundidad de penetración del cordón, el cual adquiere un perfil más estrecho.

  4. Influencia de los parámetros de corte con electrodo en las características de la zona de influencia térmica (ZIT). // Influence of cutting electrode parameters in the termic zone characteristics.

    OpenAIRE

    R. Batista Sánchez; R. Collazo Carceller; Fraga, E.; C. Figueroa Hernández

    2001-01-01

    El presente trabajo trata sobre las características microestructurales de la zona de influencia térmica con el uso del electrodoBISECOR, así como el régimen óptimo de trabajo.Palabras claves: Características microestructurales, zona de influencia térmica, electrodos , régimen detrabajo.__________________________________________________________________________________AbstractThe present paper deals with microestructural characteristics in the termic influence zone by means of the BISECORelectr...

  5. Energía de ionización simple en la soldadura con electrodo revestido Simple ionization energy in coated electrode welding

    OpenAIRE

    Alejandro García Rodríguez

    2013-01-01

    El objetivo del presente trabajo es presentar, a la comunidad científica internacional, la concepción de un método de estimación de la energía de ionización simple, indispensable para el establecimiento del plasma térmico necesario para realizar el proceso de soldadura con electrodo revestido. A partir de la síntesis y el análisis de resultados teóricos y experimentales establecidos en la literatura especializada, fue deducido un método de estimación de la energía invertida en el proceso de i...

  6. Materiales híbridos basados en nanocarbones y polioxometalatos para aplicación como electrodos en supercondensadores con mecanismo dual de almacenamiento de energía

    OpenAIRE

    Suárez Guevara, Jullieth Gabriela

    2015-01-01

    Baterías y supercondensadores son dos tipos de dispositivos de almacenamiento de energía con mecanismos y prestaciones complementarios. Las baterías, con mecanismos de reacciones redox faradaicas presentan alta densidad de energía y baja densidad de potencia mientras que el mecanismo electrostático de los supercondensadores (doble capa eléctrica) les confiere una alta densidad de potencia con densidad de energía limitada. El diseño de materiales y electrodos híbridos que combin...

  7. Estudio de la reacción de reducción electroquímica de CO2 sobre electrodos sólidos modificados con Poli-(3,4-etilendioxitiofeno) (PEDOT) Poli-(3,4-etilendioxitiofeno) (PEDOT)

    OpenAIRE

    Molina Osorio, Andres Felipe

    2014-01-01

    En este trabajo se presentan los resultados del estudio de la reducción electroquímica de CO2 en medio acuoso, CH3CN y mezclas de CH3CN:H2O ricas en CH3CN, utilizando electrodos de Au y Au recubierto con poli-(3,4- etilendioxitiofeno) (PEDOT) y PEDOT-Óxido de Grafeno Reducido. Los estudios se llevaron a cabo por voltamperometría cíclica, electrólisis en condiciones galvanostáticas y potenciostáticas y técnicas cuantitativas como Cromatografía de Gases. Los resultados en el m...

  8. Diseño Mc. Lean‐Anderson aplicado para obtener recubrimientos de electrodos aleados con carbono, cromo y titanio//Mc. Lean‐Anderson design applied for recovered electrodes obtaining with carbon, chrome and titanium alloys

    Directory of Open Access Journals (Sweden)

    Carlos René Gómez-Pérez

    2013-05-01

    Full Text Available En el trabajo se estudia el comportamiento de electrodos recubiertos destinados al relleno superficial con el proceso de soldadura manual (SMAW, Shielded Metal Arc Welding. Para el diseño experimental se aplican un procedimiento de cálculo para el revestimiento y un plan de mezclas del tipo Mc. Lean-Anderson. En el diseño se conjuga una matriz compuesta por Calcita (26,73 %, Ferrosilicio (19,02 %,Ferromanganeso (16,58 %, Rutilo (26,69 %, Silicato de Potasio (11,70 % y diferentes cargas de aleación conformadas por Grafito (2 ≤ X1 ≤ 10 %, Ferro Cromo (5 ≤ X2 ≤ 35 %, ferrotungsteno (5 ≤ X3 ≤ 10 % y matriz (60 ≤ X4 ≤ 80 %. En el trabajo se ofrecen criterios sobre la selección de los niveles límites a explorar durante el plan experimental, a partir de consideraciones sobre los materiales empleados, sus rangos y el procedimiento de fabricación de los electrodos.Palabras claves: electrodos recubiertos, recubrimientos de electrodos, smaw, diseño de experimentos, relleno superficial._______________________________________________________________________________AbstractIn the present work the behavior of recovered electrodes for superficial filler with Shielded Metal Arc Welding (SMAW process is study. For the experimental design a coating calculation procedure and a Mc. Lean- Anderson type experimental plan are used. On the experimental design a matrix, composed by Calcite (26,73 %, Ferrosilicio (19,02%, Ferromanganese (16,58%, Rutile (26,69%, Potassium Silicate (11,70 %, and a alloy, conformed by Graphite (2 ≤ X1 ≤ 10, Ferro Chromium (5 ≤ X2 ≤ 35 %, ferrotungsteno (5 ≤ X3 ≤ 10 % and matrix (60 ≤ X4 ≤ 80 % is conjugated. In the work some criteria on the selection of the levels limits to explore during the experimental plan are offer, starting from considerations on the materials employees, their ranges and the procedure of production of the electrodes.Key words: recovered electrodes, electrodes coating, smaw

  9. Bifunctional electrodes with ir and Ru oxide mixtures and pt for unified regenerative cells; Electrodos bifuncionales basados en mezclas de oxidos de Ir y Ru con Pt para celdas regenerativas unificadas

    Energy Technology Data Exchange (ETDEWEB)

    Duron-Torres, S.M.; Escalante-Garcia, I.L. [Universidad Autonoma de Zacatecas, Zacatecas (Mexico); Cruz, J. C.; Arriaga-Hurtado; L.G. [Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Pedro Escobedo, Queretaro (Mexico)]. E-mail: duronsm@prodigy.net.mx

    2009-09-15

    reaccion de evolucion de oxigeno (OER) en el PEMWE son las etapas limitantes de las URFC segun sea el modo de operacion. La obtencion de electrocatalizadores bifuncionales que se desempenen de manera satisfactoria en ambas reacciones del oxigeno y que soporten las diferentes condiciones de trabajo encontradas en una celda de combustible y un electrolizador, es el enfoque principal de las investigaciones relacionadas con las URFC. El presente trabajo es una contribucion a la investigacion de electrocatalizadores bifuncionales y muestra algunos resultados preliminares del estudio electroquimico de diferentes mezclas de Pt gcc, IrO{sub 2} y RuO{sub 2} soportadas en Ebonex® como electrodos de oxigeno. La caracterizacion electroquimica por voltamperometria ciclica (CV), Voltamperometria lineal (LV) y Espectroscopia de Impedancia electroquimica (EIS) en H{sub 2}SO{sub 4} 0.5 M, en ausencia y presencia de oxigeno revela que los electrodos bifuncionales IrO{sub 2}-Pt y RuO{sub 2}-Pt soportados en Ebonex® presentan propiedades electrocataliticas razonables para las reacciones de evolucion y reduccion de oxigeno y presentan posibilidad para su uso en una URFC. Los electrodos basados en el oxido de Ir muestran una mayor estabilidad que los correspondientes electrodos basados en oxido de rutenio.

  10. Estudio de la reacción de reducción de oxígeno sobre electrodos mono cristalinos de platino modificados con películas delgadas de polianilina

    OpenAIRE

    Silva Olaya, Alex Ricardo

    2012-01-01

    Se sintetizaron películas de polianilina por voltamperometría cíclica y por cronopotenciometría sobre electrodos de platino de bajo índice de Miller. Las propiedades de estas películas se analizaron mediante voltamperometría cíclica, voltamperometría de onda cuadrada y cronoamperometría. Se observó que las propiedades de estas películas difieren dependiendo del electrodo cristalino de Pt que se use para su electro síntesis, lo que evidencia que la superficie funciona como una plantilla para l...

  11. Microscale adaptation of the potentiometric method with ion-selective electrode for the quantification of fluoride; Adaptacion a microescala del metodo potenciometrico con electrodo ion selectivo para la cuantificacion de fluoruro

    Energy Technology Data Exchange (ETDEWEB)

    Guevara Ruiz, Paulina; Ortiz Perez, Maria Deogracias [Laboratorio de Bioquimica, Facultad de de Medicina, Universidad Autonoma de San Luis Potosi, San Luis Potosi, San Luis Potosi, (Mexico)]. E-mail: mdortiz@uaslp.mx

    2009-05-15

    muestra necesarios, disminuya costo y substancias de desecho. Se valido el metodo potenciometrico establecido en la NMX-AA-077-SCFI-2001, asi como el metodo a microescala propuesto en este trabajo; posteriormente, se compararon ambos metodos mediante graficos y calculos estadisticos. Ademas se analizaron por ambos metodos 125 muestras de agua embotellada de venta en la ciudad de San Luis Potosi. Los datos de la validacion del metodo fueron optimos para su desempeno. Los resultados de la determinacion en las muestras de agua embotellada por ambos metodos, indican que la modificacion a microescala es estadisticamente comparable al metodo potenciometrico con electrodo ion selectivo. El metodo propuesto a microescala es apropiado para su utilizacion, con una reduccion de 95 % en costo y desechos generados.

  12. Comportamiento acústico de espacios cubiertos con estructuras textiles

    OpenAIRE

    Maya Simoes, Flavio

    2000-01-01

    En el presente trabajo estudiamos el comportamiento acústico de espacios cubiertos con textiles. Presentamos una reseña histórica de usos de textiles en la arquitectura, de la prehistoria hasta hoy. Realizamos una búsqueda bibliográfica y presentamos los resultados encontrados. Presentamos la metodología actual de análisis acústico que se utiliza en ensayos de laboratorio, simulaciones y mediciones. Estudiamos la absorción sonora de los materiales de las cubiertas textiles, en ensayos de labo...

  13. Modelado acústico de silenciadores con material absorbente

    OpenAIRE

    TORRES PICAZO, MARÍA ISABEL

    2008-01-01

    Esta Tesis se centra en el desarrollo e implementación de métodos para el diseño y modelado acústico de silenciadores de motores de combustión interna, a través de herramientas basadas en soluciones analíticas y numéricas de la ecuación de ondas. La necesidad de técnicas de diseño que proporcionen rápida y eficazmente resultados precisos incluso a altas frecuencias ha aumentando con el tiempo, debido a que el ruido de los vehículos se ha convertido en una fuente importante de contaminación am...

  14. Propuesta para la recuperación de los machetes Zuazaga de los centrales azucareros con electrodos de acero al cromo. // Proposal for Recuperation of Sugar Mill Cut Cane by Using Chromium Steel Electrodes.

    Directory of Open Access Journals (Sweden)

    R. Collazo-Carceller

    2009-09-01

    Full Text Available El trabajo resume el estudio y análisis desarrollado, para la presentación de una propuestatecnológica de recuperación de los machetes Zuazaga, en nuestros centrales azucareros. Sedeterminó la influencia de los parámetros, energía introducida (Hi, número de capas (Nc y anchodel depósito (Ad, en la morfología y el incremento de la resistencia al desgaste abrasivo, utilizandoel electrodo de acero al cromo DUR 600. Se realizó una valoración económica de la propuestatecnológica.Palabras claves: morfología, desgaste abrasivo, parámetro de soldadura, dendrites._____________________________________________________________________________AbstractThis work, sumarises the study and the analisys developed, to prupose the Zuazaga cut canethecnology recuperation, in aur sugar mills. The parameters influency was determinated, Heatinput (Hi, Number of layers (Nc and the Cord whith (Ad, in the mofology and the abrasive wearresistance increase, using the cromiun steel UTP DUR - 600. The economical calculation of thethecnology was done.Key words: morphology abrasive wear, welding parameters. dendrites, modeling

  15. Elaboración y prueba de un electrodo para la cuantificación de cloruro de potasio y bromuro de potasio

    Directory of Open Access Journals (Sweden)

    José de Jesús Pérez-Saavedra

    2014-09-01

    Full Text Available Con la idea de mejorar el método potenciométrico para cuantificar cloruro de potasio y bromuro de potasio, se diseñó un electrodo combinado de plata como indicador y cobre/nitrato de cobre como referencia, donde los electrolitos del electrodo no interfieren en la cuantificación y al mismo tiempo se pueden disminuir los volúmenes por valorar (Arnaiz, 2005; Rincón y Pérez 2003, además de eliminar el puente de agar. A los resultados de los volúmenes de punto de equivalencia, con el montaje convencional y el electrodo elaborado, se les aplica la prueba estadística de t de Student con un 95% de confianza (Harris, 1991, dando como resultado que no hay diferencia significativa, con ese nivel de confianza, entre ambos métodos.

  16. Selección de Electrodos Basada en k-means para la Clasificación de Actividad Motora en EEG

    OpenAIRE

    R. Lemuz-López; W. Gómez-López; I. Ayaquica-Martínez; C. Guillén-Galván

    2014-01-01

    Se presenta un algoritmo para la selección del grupo de electrodos relacionados con la imaginación de movimiento. El algoritmo utiliza la técnica de agrupamiento llamada kmeans para formar grupos de sensores y selecciona el grupo que corresponde a la actividad correlacionada más alta. Para evaluar la selección de electrodos, se calcula el indice de clasificación aplicando la descomposición proyectiva llamada patrones espaciales comunes y un discriminante lineal en una prueba de una sola época...

  17. Membranas poliméricas basadas en líquidos iónicos : aplicaciones en electrodos selectivos de iones y procesos de separación

    OpenAIRE

    Martínez Rubio, Aurora

    2015-01-01

    El objetivo global de esta Tesis Doctoral fue la evaluación del uso de membranas poliméricas basadas en líquidos iónicos en el desarrollo de electrodos selectivos de iones y en procesos de separación de metales (Zn2+, Fe3+, Cu2+ y Cd2+) y compuestos orgánicos (α-pineno e ibuprofeno). Para alcanzar dicho objetivo se estudió, en primer lugar, la respuesta potenciométrica de un número de electrodos selectivos de iones basados en membranas poliméricas construidas con policloruro de vinilo (PVC) y...

  18. Endocarditis por infección de electrodos de marcapasos. Reporte de dos casos.

    Directory of Open Access Journals (Sweden)

    Rodrigo Chamorro Castro

    2006-01-01

    Full Text Available Se presentan 2 casos de infección de marcapasos permanentes con endocarditis bacteriana con vegetaciones en los electrodos y uno de ellos con destrucción de la válvula tricúspide. Se extrajeron los sistemas bajo circulación extracorpórea, encontrándose tejido fibroso firme que los adhería fuertemente a las paredes atriales, aparato valvular y endocardio ventricular. En un paciente se realizó reemplazo valvular tricuspídeo.We present 2 cases of bacterial endocarditis with vegetations in the pacemaker pockets and electrodes and in one of them, tricuspid valve involvement. The Pacing systems were removed under extracorporeal circulation. The leads were surrounded by fibrinous material and by firm fibrous tissue that fixed them to the atrial and ventricular walls and to the valvular apparatus. One patient underwent tricuspid valve replacement.

  19. Procedimiento para diseñar una cámara acústica reverberante para ensayos auditivos con animales

    OpenAIRE

    Cobo, Pedro; Varela-Nieto, Isabel; Murillo-Cuesta, Silvia; Cediel, Rafael

    2008-01-01

    Procedimiento para diseñar una cámara acústica reverberante para ensayos auditivos con animales. El objeto principal de la presente invención es procedimiento para diseñar una cámara acústica reverberante de dimensiones (L1, L2, L3) cuyo campo acústico sea homogéneo espacial y espectralmente; las operaciones del procedimiento son: elegir una de las dimensiones L3; obtener las funciones (valor medio del campo acústico) y (desviación cuadrática media del campo acústico);...

  20. Fabricación de electrodos para control de transporte y alineamiento a micro y nanoescalas usando técnicas bottom-up y top-down

    Directory of Open Access Journals (Sweden)

    Darwin Rodríguez

    2014-12-01

    Full Text Available El continuo avance de aplicaciones en dispositivos de autoensamble, posicionamiento, sensores, actuadores, y que permitan controladamente la manipulación de micro y nanoestructuras, han generado amplio interés en el desarrollo de metodologías que permitan optimizar la fabricación de dispositivos para el control y manipulación a micro y nanoescalas. Este proyecto explora técnicas de fabricación de electrodos con el fin de encontrar una técnica óptima y reproducible. Se compara el rendimiento de cada técnica y se describen protocolos de limpieza y seguridad. Se diseñan e implementan tres geometrías para movilizar y posicionar micro y nanopartículas de hierro en una solución de aceite natural. Finalmente se generan campos eléctricos a partir de electroforesis, con el fin de encontrar la curva que describe el desplazamiento de las partículas con respecto al potencial aplicado. Estos resultados generan gran impacto en los actuales esfuerzos de fabricación bottom-up (controlando con campos la ubicación y la movilidad en dispositivos electrónicos. El hecho de fabricar geometría planar con electrodos genera la posibilidad de que se pueda integrar movimiento de partículas a los circuitos integrados que se fabrican en la actualidad.

  1. Electrodo capacitivo de alta sensibilidad para la detección de biopotenciales eléctricos

    OpenAIRE

    J.L. Varela-Benítez; J.O. Rivera-Delgado; J.H. Espina-Hernández; J. M. de la Rosa-Vázquez

    2015-01-01

    En este trabajo se presenta el diseño e implementación de un electrodo capacitivo de no contacto para la detección de biopotenciales en el cuerpo humano. Se presentan los circuitos eléctricos, el criterio de selección del amplificador operacional en base al análisis de la resistencia óptima de ruido, se describe el montaje físico, se presentan las señales obtenidas con este y la evaluación de su desempeño en base a la relación señal a ruido S/N. Se muestra el desempeño de diversos amplificado...

  2. Electrodos austeníticos inoxidables semisintéticos para la soldadura manual por arco eléctrico: Una variante económica para las pequeñas y medianas empresas (PIME. // Semi-synthetic austenitics stainless steel electrodes for shielded metal arc welding: A

    Directory of Open Access Journals (Sweden)

    A. Paz Iglesias

    2002-09-01

    Full Text Available En el presente trabajo se brinda una valoración económica para la producción de electrodos austeníticos inoxidables tiposE308L, E309, E312 y E316L en las pequeñas y medianas empresas (PIME. Lo significativo de la presente valoración esque se brindan los resultados obtenidos al fabricar los electrodos de forma semisintética; es decir, utilizando un solo tipo dealambre inoxidable (308L y añadiendo las ferroaleaciones necesarias en el revestimiento. Los resultados que se muestranestán basados en las experiencias de investigación, producción y comercialización de una planta con capacidad para 200toneladas al año, a la cual le es muy difícil insertarse en el mercado utilizando los mismos procedimientos tecnológicos yfinancieros de una gran empresa con grandes capitales y recursos.Palabras claves: Electrodos austeníticos inoxidables, electrodos sintéticos, ferroaleaciones, electrodossemisintéticos, electrodos convencionales, metal depositado.___________________________________________________________________Abstract.This paper offers an economic valuation for the production of stainless electrodes type E308L, E309, E312 and E316L,for small and middle companies (PIME. The significant part of the present valuation gives the results obtained in theproduction of semi-synthetic electrodes; using just one type of stainless wire (308L and adding the ferroalloys neededin the coat. The results shown are based on investigation experiences, production and trading of companies with acapacity for 200 T/year, so it is very difficult to enter in the market using the same technological procedures of a bigcompany with higher capital and financial resources.Key words: Nonrusting austenistic electrodes, sintetic electrodes, semisintetic electrodes, iron alloy,conventional electrodes, metal deposition.

  3. Posicionamento ectópico de eletrodo de marcapasso Posicionamiento ectópico de electrodo de marcapaso Ectopic positioning of pacemaker electrode

    Directory of Open Access Journals (Sweden)

    Gildo Mota

    2010-05-01

    Full Text Available Apresentamos o caso de um paciente portador da forma cardíaca da doença de Chagas com disfunção ventricular esquerda e bloqueio atrioventricular de 2º grau Mobitz II, associados a vários episódios de síncope. Foi submetido a implante de marcapasso artificial definitivo dupla câmara. Após um ano do implante foi diagnosticado deslocamento de eletrodo atrial, sendo submetido a reimplante de eletrodo atrial. Após dois anos do primeiro procedimento cirúrgico, apresentava dispneia aos grandes esforços. Durante a avaliação, foi solicitado ecocardiograma, que detectou a presença de corpo estranho de características metálicas em câmaras cardíacas esquerdas, consistente com eletrodo de marcapasso ectópico.Referimos el caso de un paciente portador de la forma cardíaca de la enfermedad de Chagas con disfunción ventricular izquierda y bloqueo atrioventricular de 2° grado Mobitz II, asociados a varios episodios de síncope. Fue sometido a implante de marcapaso artificial definitivo doble cámara. Tras un año del implante se diagnosticó desplazamiento de electrodo atrial, con la sumisión del paciente a reimplante de electrodo atrial. Tras dos años del primer procedimiento quirúrgico, presentaba disnea a los grandes esfuerzos. Durante la evaluación, se solicitó ecocardiograma, que detectó presencia de cuerpo extraño de características metálicas en cámaras cardíacas izquierdas, de acuerdo con electrodo de marcapaso ectópico.The present case reports on a patient presenting the cardiac form of Chagas disease, with left ventricular dysfunction and second-degree atrioventricular block Mobitz type II, associated with several syncope episodes. The patient underwent a double-chamber definitive artificial pacemaker implant. One year after the implant, the displacement of the atrial electrode was diagnosed and the patient was submitted to re-implantation of the atrial electrode. Two years after the first surgical procedure, the

  4. Ensayo de aislamiento acústico a ruido aéreo de los cerramientos exteriores y particiones realizados con paneles de madera

    Directory of Open Access Journals (Sweden)

    Pacios Álvarez, Antonia

    2007-06-01

    Full Text Available The house prototype of the Provisional Emergency House System uses wood and its derivatives for the facades, floor structure, roofing and partitions.  The extensive use of wooden panels for the construction and the lack of data, in Spain, about their acoustic behavior bring up the necessity to make in situ measurements of the acoustic isolation to airborne sound. Panels used for facades and partitions are built with a wooden framework and membrane of oriented strand board in both sides, for the facades, and of laminated plaster boards for the inner partitions. With the objective of verifying the sound insulation of the facades according to Spanish Standard UNE EN ISO 140-5, in situ measurements of airborne sound insulation of facade elements and facades have been made; according to Spanish Standard UNE EN ISO 140-4, in situ measurements of airborne sound insulation between rooms for internal walls have also been made. The procedure of the global insulation has been followed to measure the acoustic insulation of complete facades without making distinction between the elements that form it.El prototipo de vivienda del Sistema de Vivienda Provisional de Emergencia utiliza principalmente la madera y sus derivados tanto en los cerramientos y particiones como en el forjado y la cubierta. El empleo de soluciones constructivas ligeras y la falta de datos en España acerca del comportamiento acústico de los mismos plantea la necesidad de realizar mediciones in situ del aislamiento acústico a ruido aéreo. El panel base de cerramiento y particiones se construye partiendo de un entramado de montantes de madera con membrana en ambas caras de tableros de virutas de madera orientadas, para el caso de los cerramientos exteriores, y de tableros laminados de yeso para las particiones interiores. Con el objeto de comprobar el aislamiento acústico de dichos cerramiento se han realizado ensayos siguiendo la Norma UNE EN ISO 140-5 para la medición in situ del

  5. Manejo de los electrodos de agujas en el laboratorio de EMG. Experiencia practica de enfermería.

    OpenAIRE

    Padilla Puentes, E.; Gómez Fernández, L.; Sánchez Curuneaux, A.; Morales Chacón, L.; Peña, M. A.

    2008-01-01

    En la práctica, el personal de enfermería participa en el cuidado de los electrodos de agujas para los estudios electrofisiológicos, en especial de su esterilización y almacenamiento adecuado. Se debe de respetar la atención especial a la manipulación de los electrodos, la realización del lavado de manos, y al uso del material en buen estado. Estas prácticas repercuten positivamente en la calidad del servicio y benefician directamente al paciente. El objetivo de nuestro trabaj...

  6. Las monedas con nombres de étnicos del s. II a.C. en el nordeste peninsular. ¿Reflejo de posibles circunscripciones? ¿Civitates con doble nombre?

    Directory of Open Access Journals (Sweden)

    Pérez Almoguera, Arturo

    2008-12-01

    Full Text Available In the 2nd century BC coins were being minted in the northeast of Hispania with ethnic names known by written sources. This raises the problem of whether they are dependent upon a territorial organisation in districts that, interestingly, would be the regiones and major populi mentioned by Pliny in the 1st Century. On the other hand, these mints might correspond to places with their own city name.En el s. II a.C. se emiten en el nordeste de Hispania monedas con el nombre de étnicos conocidos por las fuentes escritas. Se plantea el problema de si responden a una organización territorial en circunscripciones que, curiosamente, corresponden con las regiones y principales populi que cita Plinio. Por otro lado estas cecas podrían corresponder a localidades que pudieran tener otro nombre.

  7. Evaluación de diferentes tipos de barnices en la protección de electrodos para la soldadura subacuática//Evaluation of different types of varnishs to protect underwater welding electrodes

    Directory of Open Access Journals (Sweden)

    Manuel Rodríguez-Pérez

    2012-05-01

    Full Text Available El artículo tiene como objetivo evaluar  las posibilidades de empleo de diferentes tipos de barnices como impermeabilizantes para los electrodos del tipo AWS E 6013, cuando se realiza la soldadura  en condiciones subacuática mojada. Los barnices evaluados son el Vinílico, Marítimo, base Poliuretano y una nueva variante base Isopor. Los métodos de evaluación incluye el comportamiento de la resistencia mecánica que le confiere al revestimiento a cada uno de los barnices, el agua adsorbida y el tipo de estructura en el cordón, utilizando microscopía óptica convencional. En este aspecto, la estructura en todos los cordones realizados con el electrodo E 6013, independientemente del impermeabilizante utilizado es similar, caracterizada por ferrita primaria o de contorno de grano y del tipo Widmanstätten, sin embargo, se determinó, que el impermeabilizante base Isopor, garantiza una mejor protección del electrodo en cuanto a la cantidad de agua adsorbida y adherencia del revestimiento.Palabras claves: soldadura subacuática, impermeabilizante, electrodos._______________________________________________________________________________The article aims to assess the potential use of different types of paints and waterproofing materials for the electrodes of type AWS E 6013, when performing underwater welding in wet conditions. The coatings evaluated are Vinyl, Maritime, polyurethane base and a new variant Isopor base. Evaluation methods include the behavior of the mechanical strength to the coating gives each of the varnishes, the adsorbed water and the type of structure in the welds, using conventional microscopy. In this sense, the structure in all the welds made with the electrode E 6013, regardless of waterproofed used is similar, characterized by primary or ferrite grain boundary and Widmanstätten type, however, it was determined that the base waterproofing Isopor, guarantees better protection of the electrode in terms of the amount of

  8. Efectos acústicos inmediatos de una secuencia de ejercicios vocales con tubos de resonancia Immediate effects of a vocal exercise sequence with resonance tubes

    Directory of Open Access Journals (Sweden)

    Marco Guzmán

    2012-06-01

    Full Text Available OBJETIVO: el propósito de este estudio es conocer el efecto acústico inmediato de una secuencia de ejercicios fonatorios utilizando tubos de resonancia en un grupo de sujetos disfónicos. MÉTODO: se aplicó una secuencia única de cuatro tareas fonatorias dentro de tubos de resonancia a veinticuatro profesores con voces disfónicas, evaluadas perceptualmente con la escala GRBAS. Las muestras de voz fueron grabadas antes y después de la secuencia de ejercicios. El análisis acústico incluyó Cepstrum, Jitter, Shimmer y relación armónico-ruido (NHR. Se solitó completar un protocolo de autovaloración vocal posterior a la secuencia de ejercicios para evaluar los efectos subjetivos. Se compararon los valores de los parámetros acústicos en las muestras pre y post entrenamiento. RESULTADOS: cambios significativos fueron obtenidos en el análisis Cepstral, Jitter y relación armónico-ruido. En la autovaloración, los efectos positivos predominaron sobre los negativos, siendo los principales: voz más estable, voz más clara y garganta más abierta. CONCLUSIÓN: el uso de tareas fonatorias dentro de tubos de resonancia puede tener un efecto fisiológico terapéutico inmediato en sujetos con voces disfónicas y una percepción subjetiva de mejoría en la producción de la voz posterior a la terapia.PURPOSE: the purpose of this study is to determine the immediately acoustic effect of phonatory exercise sequence using resonance tubes in a group of dysphonic subjects METHOD: a unique sequence of four phonatory tasks within resonance tubes was applied in twenty-four teachers with dysphonic voices, assessed perceptually with GRBAS scale. Voice samples were recorded before and after the exercise sequence. Acoustic analysis included the following items: Cepstrum, Jitter, Shimmer, noise-harmonic ratio (NHR. Subjects were asked to fill out a vocal self-assessment protocol after the exercise sequence in order to assess the subjective effects of these

  9. Diseño de una instalación solar térmica con aplicaciones para acs y calefacción en un bloque de viviendas ubicado en Pontevedra

    OpenAIRE

    Martínez Fontúrbel, Eduardo

    2009-01-01

    La realización del presente proyecto tenía como objetivo principal la de desarrollar una instalación solar para satisfacer la demanda de ACS y calefacción de la forma más eficiente posible teniendo en cuenta tanto la energía solar aprovechable del Sol y la viabilidad económica del proyecto. Además del diseño de la instalación se ha querido analizar de forma detallada los principales aspectos de funcionamiento de la instalación para buscar con ello la mejor respuesta posible ...

  10. Análisis de soldabilidad de aceros inoxidables con aceros de medio y bajo carbono por SMAW

    Directory of Open Access Journals (Sweden)

    José Luddey Marulanda Arevalo

    2013-12-01

    Full Text Available Se presenta un estudio de la soldabilidad de aceros inoxidables austeníticos AISI 304 y AISI 316 con aceros de bajo y medio carbono AISI 1020 – AISI 1045, empleando como materiales de aporte los electrodos EutecTrode® 52 NG, 54 NG y 57 NG, mediante el proceso de arco eléctrico con electrodo revestido (SMAW. Para analizar la soldabilidad de estos electrodos cuando se realiza la unión de aceros inoxidables con aceros al carbono, se practicaron pruebas metalográficas y ensayos mecánicos de dureza, doblez y tracción, con el fin de observar el comportamiento tanto de la zona afectada térmicamente como del cordón de soldadura, a partir del cambio en las propiedades mecánicas y metalúrgicas en las diferentes regiones de las uniones soldadas. Durante el proceso de soldadura se siguió una especificación del procedimiento de soldadura (WPS, para que los resultados fueran repetibles, minimizando los problemas de agrietamiento en caliente, agrietamiento en frío, formación de fase sigma y precipitación de carburos.

  11. Influencia del entorno acústico laboral en el comportamiento audiométrico y su correlación con el registro de otoemisiones acústicas de productos de distorsión

    OpenAIRE

    Burgos Sánchez, Antonio Jesús

    2015-01-01

    El ruido puede ser considerado el contaminante físico con mayor presencia en el mundo laboral. La exposición continuada sin la protección adecuada, a niveles sonoros de elevada intensidad constituye ineludiblemente un riesgo potencial para la salud. El efecto nocivo del ruido en el medio laboral se traduce en una pérdida auditiva o hipoacusia que generalmente es progresiva e irreversible, y que estaría encuadrada dentro de la denominada pérdida auditiva inducida por ruido (PAIR). La evaluació...

  12. RECTIFICADORES CA/CC TIRISTORIZADOS CON FORMAS DE ONDA DE ALTA CALIDAD THYRISTOR-BASED AC/DC RECTIFIERS WITH HIGH-QUALITY WAVEFORMS

    Directory of Open Access Journals (Sweden)

    Miguel Villablanca

    2010-04-01

    Full Text Available En este artículo un método y un aparato son aplicados a distintas configuraciones de rectificadores ca/cc tiristorizados para reducir la distorsión de las corrientes en el lado de C.A. La carga puede ser inductiva o capacitiva. La tecnología consiste en darle una adecuada forma de onda a la corriente en el lado de C.C. a través de dos interruptores de conmutación forzada. Esta forma de onda lograda en la corriente en el lado de C.C. se refleja en la forma de onda de las corrientes en el lado de C.A., las cuales se transforman en perfectas ondas senoidales. El circuito de control es simple y es también capaz de manejar variaciones rápidas de corriente de carga y fallas en los interruptores de conmutación forzada. La conducción simultánea de los tiristores del puente rectificador es eliminada completamente. La validación experimental de la tecnología es mostrada a través de un prototipo de laboratorio de 400 V, 50 Hz y 30 KVA.In this paper both a method and apparatus are applied to different configurations of thyristor-based ac/dc rectifiers to reduce the distortion of currents flowing from the ac supply. The load may be either inductive or capacitive. The technology involves an accurate shaping of the dc current by using two self-commutated switches. This dc-current shaping is reflected back into the shaping of the ac input currents, which become pure sine waves. The control circuit is simple, and also able to deal with both rapid load variations and failures in the self-commutated switches. Furthermore, the overlap conduction of bridge thyristors is eliminated completely. Experimental verification is provided from a 400-V 50-Hz 30-kVA laboratory prototype.

  13. Incertidumbre de la medición de masa en la determinación de los parámetros de consumo de electrodos de recargue Measurement uncertainty of mass in the determination of the consumption parameters of hardfacing electrodes

    Directory of Open Access Journals (Sweden)

    Rosenda Valdés Arencibia

    2013-06-01

    Full Text Available Este trabajo presenta la evaluación de la incertidumbre de las mediciones realizadas para la determinación de los parámetros de consumo de electrodos de recargue, dando énfasis a la medición de masa. Para ello fueron realizados tres depósitos a tres niveles de corriente (120 A, 145 A y 160 A, respectivamente, registrándose el tiempo de soldadura, la longitud del cordón, así como la masa inicial y final de las probetas y de los electrodos. A partir de los datos anteriores fueron determinados los parámetros de consumo. Fue calculada la incertidumbre asociada a la masa de las probetas, a la masa consumida del electrodo, a la masa depositada y a los parámetros de consumo. Al finalizar el trabajo se comprobó que el rendimiento del depósito muestra un comportamiento decreciente con la corriente, siendo el mejor resultado de (74,12 % para una corriente de soldadura de 120 A. Los valores de incertidumbre expandida para el rendimiento varían entre 1,47 % y 2,41 %, para la tasa de consumo fueron obtenidos valores entre 0,4 g/min y 0,6 g/min, mientras que para la tasa de deposición la incertidumbre varía de 0,6 g/min a 0,7 g/min.This work presents the evaluation of the uncertainty of the measurements to determine the consumption parameters of hardfacing electrode, emphasizing the mass measurement. The experimentation was carried out obtaining deposits at three levels of current (120 A, 145 A y 160 A and measuring the time spent in welding, the length of the welds the test plate and electrode mass (initial and final. Based on these results, the consumption parameters were also determined. The uncertainty related to the measurements the mass of the samples, the mass consumption of the electrode, the deposited mass and consumption parameters was determined. The results showed that the deposition efficiency increase as a function of the current, turning the best result (74.12 % at 120 A. The expanded measurement uncertainty associated to

  14. Comportamiento electroquímico del ion Ag (I) sobre electrodo de Pt en Cloruro de 1-Butil-3 Metil-Imidazolio (BMIMCl) entre 343-363 K

    OpenAIRE

    Sanz de Paz, Diego

    2015-01-01

    En este trabajo se investiga la reducción electroquímica sobre electrodo de Pt del ion Ag (I) disuelto en el líquido iónico Cloruro de 1-Butil-3-Metil-Imidazolio (BMIMCl), a temperaturas comprendidas entre 343 y 363 K, utilizando las técnicas de voltamperometría de onda cuadrada (SWV), voltamperometría cíclica (CV), voltamperometría convolutiva de potencial (CPSV), cronoamperometría (CA) y cronopotenciometría (CP). La reducción de Ag (I) a Ag (0) tiene lugar mediante un proceso reversible...

  15. Study for increasing the stabilization time of a catalytic dye to facilitate the fabrication of membrane electrode assemblies; Estudio para incrementar el tiempo de estabilizacion de una tinta catalitica para facilitar la fabricacion de ensambles membrana-electrodo

    Energy Technology Data Exchange (ETDEWEB)

    Flores Hernandez, J. Roberto [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)] e-mail: jrflores@iie.org.mx; Martinez Vado, F. Isaias [Facultad de Quimica, Universidad Nacional Autonoma de Mexico, Mexico D.F. (Mexico); Cano Castillo, Ulises, Albarran Sanchez, Lorena [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2009-09-15

    An infrastructure project has been underway for hydrogen technology and fuel cells at the Electrical Research Institute (IIE, Spanish acronym). Part of this project is an activity for the fabrication of membrane electrode assemblies (MEA). Currently, a fabrication process is well-established for the MEA using the spray technique. In addition, a catalytic dye base composition has been developed for use in the fabrication of high-quality MEA with a good degree of reproducibility. Nevertheless, the instability of the dye over time prevents continuous fabrication of MEA. This document presents the results obtained, to-date, of research conducted at the IIE aimed at increasing the stability of the catalytic dye by adding a surfactant with different concentrations and increasing the concentration of the Nafion® solution. It was found that the effect of adding the surfactant to the catalytic dye results in a qualitative decrease in the agglomerate sizes, while also decreasing the porosity of the dye once it has dried. In addition, it was found that increasing the amount of Nafion® in the catalytic die increases the porosity. [Spanish] En el Instituto de Investigaciones Electricas (IIE) se ha venido trabajando en un proyecto de infraestructura sobre la tecnologia de hidrogeno y celdas de combustible. Dentro de este proyecto se tiene una actividad orientada a la fabricacion de Ensambles Membrana-Electrodo (MEA's). Actualmente se tiene un proceso de fabricacion bien establecido para la elaboracion de MEA's utilizando la tecnica de rociado, asimismo, se tiene una composicion base de tinta catalitica con la cual se fabrican MEA's de buena calidad y con buen grado de reproducibilidad. Sin embargo, la inestabilidad de la tinta con respecto al tiempo impide tener una fabricacion continua de los MEA's. En este documento se presentan los resultados obtenidos hasta ahora de una investigacion que se realiza en el IIE orientada a incrementar la estabilidad de la

  16. Eletrodo de marca-passo mal posicionado no ventrículo esquerdo Electrodo de marcapasos mal posicionado en el ventrículo izquierdo Pacemaker electrode misplaced in the left ventricle

    Directory of Open Access Journals (Sweden)

    André Luiz Cerqueira de Almeida

    2010-09-01

    Full Text Available Relatamos caso de implantação anômala de eletrodo de marca-passo VVI no ventrículo esquerdo (VE, diagnosticada durante avaliação de rotina, dois anos pós-implante. Trata-se de mulher de 65 anos e soropositiva para doença de Chagas. O eletrocardiograma (ECG apresentava padrão de bloqueio do ramo direito. A radiografia de tórax em perfil mostrou trajeto com curvatura posterior do eletrodo. No ecocardiograma transtorácico, o diagnóstico final mostrou cateter que penetrava o átrio direito, atravessava o septo interatrial e descia pelo átrio esquerdo e orifício valvar mitral para se implantar na parede lateral do VE. Abordam-se os seguintes aspectos relacionados: possíveis trajetos de implantação, quadro clínico, radiológico, eletrocardiográfico, ecocardiográfico, complicações e opções terapêuticas.Relatamos caso de implantación anómala de electrodo de marcapasos VVI en el ventrículo izquierdo (VI, diagnosticada durante evaluación de rutina, dos años post implante. Se trata de mujer de 65 años y seropositiva para enfermedad de Chagas. El electrocardiograma (ECG presentaba estándar de bloqueo de rama derecha. La radiografía de tórax de perfil mostró trayecto con curvatura posterior del electrodo. En el ecocardiograma transtorácico, el diagnóstico final mostró catéter que penetraba el atrio derecho, atravesaba el septo interatrial y descendía por el atrio izquierdo y orificio valvar mitral para implantarse en la pared lateral del VI. Se abordan los siguientes aspectos relacionados: posibles trayectos de implantación, cuadro clínico, radiológico, electrocardiográfico, ecocardiográfico, complicaciones y opciones terapéuticas.This study reports the case of an anomalous implantation of VVI pacemaker electrode in the left ventricle (LV diagnosed during routine evaluation, two years after implantation. The patient is a 65-year-old woman with Chagas disease. Electrocardiogram (ECG revealed a pattern of right

  17. Apuntes de Acústica

    OpenAIRE

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  18. Implementación de un interferómetro de difracción puntual con un monopíxel de cristal líquido

    OpenAIRE

    Ramírez, Claudio; Otón Martínez, Eva; Iemmi, Claudio; Moreno Soriano, Ignacio; Bennis, Noureddine; Otón Sánchez, José Manuel; Campos, Juan

    2012-01-01

    En este trabajo se presenta la implementación de un interferómetro por difracción puntual construido con un monopíxel de cristal líquido. En primer lugar se ha fabricado un monopíxel de cristal líquido con alineamiento paralelo de unas dimensiones de 3x3 cm2, en el que el electrodo cubre toda la superficie excepto en un orificio central de unas 50 ?m. Este orificio es el que actuará como punto difractor. Aplicando diferentes tensiones se puede cambiar la fase de la onda que llega al píxel en ...

  19. Electrochemical performance in the hydrogen evolution reaction of Ni-TR (TR= La, Ce) materials synthesized using the solid state reaction method; Desempeno electroquimico en la reaccion de evolucion de hidrogeno de materiales de electrodo Ni-TR (TR = La, Ce) sintetizados por el metodo de reaccion de estado solido

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Huerta, A. M.; Dominguez-Crespo, M. A.; Ramirez-Meneses, E.; Yanez-Zamora, C. [CICATA, IPN, Altamira, Tamaulipas (Mexico); Avila-Garcia, I. [IPN, ESIQIE, UPALM, Mexico, D.F. (Mexico)]. E-mail: mdominguezc@ipn.mx; adcrespo2000@yahoo.com.mx

    2009-09-15

    relacionados con su operacion. El material de electrodo con mayor electroactividad es el Pt, pero debido a su costo elevado se han tenido que buscar electrocatalizadores alternativos con un balance entre costo y actividad. Uno de los materiales que mas se ha utilizado es el Niquel en conjunto con algunas de sus aleaciones. Este material ha demostrado un buen desempeno utilizando bajos sobrepotenciales en reacciones tradicionales como las reacciones de evolucion de hidrogeno (REH) y oxigeno (REO), asi como una alta resistencia a la corrosion y bajo costo. Particularmente, aleaciones binarias y ternarias han demostrado un incremento importante en la actividad de la REH al compararla con los materiales en su estado puro o masivo. Por esta razon, en la busqueda de nuevas alternativas con una aceptable eficiencia al compararla con los materiales a bajo costo, en este trabajo se obtuvieron materiales Ni-TR (TR = La, Ce) por el metodo de reaccion de estado solido, a partir de: a) acetilacetonatos metalicos y b) polvos metalicos. Estos materiales se sinterizaron durante 3 h a diferentes temperaturas (795 o 920 , 1000 y 1200 grados centigrados) a fin de evaluar su efecto en el desempeno electroquimico de los electrocatalizadores. La caracterizacion estructural y morfologica de materiales se realizo por las tecnicas de DRX y MEB, respectivamente. Asimismo, el desempeno electroquimico de los materiales de electrodo se evaluo en la REH utilizando voltametria ciclica (VC) y curvas potenciodinamicas. Los resultados obtenidos muestran que a bajas temperaturas se obtiene una mezcla de oxidos (NiO, CeO{sub 2} y LaNiO{sub 3}); sin embargo a medida que la temperatura de sinterizado se incrementa, se alcanza la formacion de las aleaciones NiO-CeO{sub 2} y NiO-LaNiO{sub 3}, respectivamente. Al mismo tiempo se observo una clara dependencia de la actividad electrocatalitica con la fuente obtencion de estos materiales (Ni-TR).

  20. Transformaciones Microestructurales en Soldaduras Disímiles de Acero Inoxidable Austenítico con Acero Inoxidable Ferrítico

    Directory of Open Access Journals (Sweden)

    Sara María Aguilar-Sierra

    2015-03-01

    Full Text Available En este trabajo se estudian los fenómenos metalúrgicos que ocurren en la soldadura SMAW de un acero inoxidable ferrítico AISI 430 con un acero inoxidable austenítico AISI 316L. Para el estudio se utilizaron dos tipos de electrodos: austenítico AWS E309L y dúplex AWS E2209-16, ambos con un diámetro de 3,2 mm. Las uniones soldadas se realizaron con un solo pase y se variaron simultáneamente la corriente y la velocidad de soldadura; las condiciones fueron 49 A y 2,4 mm.s–1como valores bajos y 107 A y 4,3 mm.s–1como valores altos. Se evaluó la influencia del tipo de electrodo y de los parámetros de soldadura en la evolución microestructural de las zonas afectadas por el calor y de las zonas de fusión, encontrando diferencias en la morfología y cantidad de ferrita delta para todas las condiciones estudiadas. Se evidenció crecimiento y refinación de grano ferrítico y formación de martensita en la zona afectada por el calor del metal base ferrítico. Se evaluó también la resistencia a la tensión hallando similitudes en todas las soldaduras.

  1. Evaluación de diferentes tipos de barnices en la protección de electrodos para la soldadura subacuática//Evaluation of different types of varnishs to protect underwater welding electrodes

    OpenAIRE

    Manuel Rodríguez-Pérez; Alexandre Queiroz-Bracarense; Lorenzo Perdomo-González; Rafael Quintana- Puchol; Alejandro Duffus-Scott

    2012-01-01

    El artículo tiene como objetivo evaluar  las posibilidades de empleo de diferentes tipos de barnices como impermeabilizantes para los electrodos del tipo AWS E 6013, cuando se realiza la soldadura  en condiciones subacuática mojada. Los barnices evaluados son el Vinílico, Marítimo, base Poliuretano y una nueva variante base Isopor. Los métodos de evaluación incluye el comportamiento de la resistencia mecánica que le confiere al revestimiento a cada uno de los barnices, el agua adsorbida y el ...

  2. Una plataforma MEMS para la medición in-situ y en tiempo real de la tensión/esfuerzo inducido electroquímicamente en el electrodo de una bateria de litio-ion

    OpenAIRE

    Barón, Sergio D.

    2015-01-01

    En este trabajo se reporta la primera demostración exitosa de las capacidades de sensado de una plataforma MEMS para la caracterización in-situ de los procesos de expansión/contracción reversible inducida electroquímicamente en electrodos de baterías de litio-ion (LIB). La plataforma consiste en un arreglo de membranas flexibles que cambian su forma dinámicamente debido al intercalado/expansión y extracción/contracción de litio. El cambio de curvatura de la membrana se mide por el principio d...

  3. Influencia de la cantidad de O2 adicionado al CO2 en el gas de protección sobre la microestructura del metal depositado en uniones soldadas de bordes rectos en aceros de bajo contenido de carbono con el proceso GMAW Influence of O2 content, added to CO2 in the shielding gas, on the microstructure of deposited metal in butt welded joint with straight edges, in low carbon steels using GMAW process

    OpenAIRE

    Eduardo Díaz-Cedré; Amado Cruz-Crespo; Félix Ramos Morales; Mauricio Tello Rico; Joel Chaparro Gonzáles; Manuel Rodríguez Pérez; Juan A. Pozo Morejón; Nancy M. Pérez Pino

    2010-01-01

    La presencia de ferrita acicular (FA) en la microestructura del cordón de soldadura, dentro de determinado rango de valores, eleva considerablemente la tenacidad de las uniones soldadas. Es por ello, que el presente trabajo trata sobre un estudio que relaciona la cantidad de ferrita acicular en el cordón en función del contenido de oxígeno presente en la mezcla activa CO2+O2, durante la realización de uniones soldadas de bordes rectos en aceros de bajo carbono con el proceso con electrodo fus...

  4. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  5. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  6. La conexión Levantino-Chipriota. Indicios de comercio Atlántico con el Mediterráneo Oriental durante el Bronce Final (1150-950 a.C.

    Directory of Open Access Journals (Sweden)

    Mederos Martín, Alfredo

    1996-12-01

    Full Text Available Starting from an analysis of the trade and the chronological sequence between the Iberian Peninsula and the Cypro-Philistinian area during part of the Late Bronze Age (1150-950 BC, we can recognize, in the most peripheral territories of the Eastern Mediterranean, the presence at least of some exports of manufactured products in the form of articulated spits and knobbed fibulas of the Huelva type, and imports of bronze bowls. These artefacts appear in small hoards (Berzocana, Spain or in tombs (Amathus, Cyprus, associated with members of the leading elites. This suggests an exchange of gifts in order to establish trade ties. We also evaluate the historic and economical aims of this trade.

    A partir de un análisis del comercio y de las secuencias cronológicas de la Península Ibérica y el área Chipro-Filistea durante parte del Bronce Final (1150-950 AC, se puede reconocer en los territorios más periféricos del Mediterráneo Oriental, la presencia de, al menos, algunas exportaciones de productos manufacturados como asadores articulados y fíbulas de codo tipo Huelva y de importaciones de vasos metálicos. Dichos productos aparecen en pequeños depósitos (Berzocana, España o enterramientos (Amathus, Chipre asociados a miembros de las élites dirigentes, insinuando un intercambio de regalos para establecer lazos comerciales. Se evalúan las implicaciones históricas y económicas que incentivaron dicho comercio.

  7. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  8. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  9. Identificación de una tradición tecnológica cerámica con desgrasante óseo en el Neolítico peninsular. Estudio arqueométrico de materiales cerámicos de Madrid (5300-3400 cal AC

    Directory of Open Access Journals (Sweden)

    Vírseda, Lydia

    2011-06-01

    Full Text Available The archaeometric characterization of a set of potsherds from six Neolithic sites from the Madrid region has allowed the identification of a new and time-persisting regional technological tradition, based on the deliberated addition of crushed bone as temper in most pottery containers. This is the first known case in Iberia, and is outstanding because of its early chronologies and persistence in time: from 5300 to perhaps 3400 cal BC. Samples were characterized by complementary mineralogical and geochemical techniques such as thin-section, conventional and grazing angle X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray fluorescence spectrometry (XRF. The addition of bone temper created a light and resistant ceramic material, with technological advantages for both the storage and transportation. Such advantages might be linked to mobile or semi-sedentary groups.

    La caracterización arqueométrica de un conjunto de materiales cerámicos procedentes de 6 yacimientos neolíticos de Madrid ha permitido identificar una nueva tradición tecnológica regional persistente en el tiempo, basada en la adición intencionada de hueso machacado como desgrasante en la mayoría de los recipientes cerámicos. Se trata del primer caso de la Península Ibérica en el que se documenta este tipo de desgrasante en cerámicas de estas cronologías con una continuidad temporal de entre el 5300/5200 hasta posiblemente el 3400 cal AC. Los materiales seleccionados se caracterizaron por técnicas mineralógicas y geoquímicas complementarias como lámina delgada, difracción de rayos X (DRX convencional y de ángulo rasante, microscopía electrónica de barrido (MEB y espectrometría de fluorescencia de rayos X (FRX. La adición de hueso produce un material cerámico ligero pero a su vez resistente, con ventajas tecnológicas para recipientes de almacenamiento y/o transporte. Dichas ventajas quizá podrían vincularse a grupos con hábitos m

  10. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  11. AC1 Wing

    OpenAIRE

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  12. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  13. Síndrome de Marcapaso en paciente con Síndrome de QT Prolongado

    Directory of Open Access Journals (Sweden)

    Sergio Siles Sainz

    2013-06-01

    Full Text Available El síndrome de marcapasos es generado por la desincronización de la actividad auricular con la ventricular durante el marcapaso ventricular VVI en pacientes portadores de enfermedad del nodo. La enfermedad evoluciona de meses hasta varios años después del implante del marcapaso, siendo más frecuente en pacientes adultos mayores.El único tratamiento es el implante de un electrodo auricular para una estimulación aurículo ventricularsincrónica.Se presenta el caso de una paciente diagnosticada con enfermedad del nodo sinusal asociada a un QT prolongado, a la cual se le implantó un marcapaso VVIR, luego de algunos meses comenzó a presentar síntomas de insuficiencia cardiaca, a los 3 años del implante presento un episodio sincopal, en cuya evaluación con Holter ECG se registró un episodio de una taquicardia ventricular no sostenida observándose la presencia de ondas P retrogradas tras cada estimulación ventricular con marcapasos. Se consideró la probabilidad de un síncope arrítmico, que se manejócon Amiodarona. Se diagnosticó síndrome de marcapaso, realizando un mejoramiento del marcapaso por un equipo bicameral, con lo cual todos los síntomas de insuficiencia cardiaca desaparecieron. No se repitió el evento sincopal y desde la época la paciente se maneja en una capacidad funcional normal.

  14. Modification of porosity in the catalyst layer of membrane electrode assemblies using pore-forming agents; Modificacion de la porosidad en la capa catalitica de ensambles membrana-electrodo empleando agentes formadores de poros

    Energy Technology Data Exchange (ETDEWEB)

    Flores Hernandez, J. Roberto [Instituto de Investigaciones Electricas Cuernavaca, Morelos (Mexico)] e-mail: jrflores@iie.org.mx; Reyes, Brenda [UNAM. Facultad de Quimica, Mexico D.F. (Mexico); Barbosa P., Romeli [Centro de Investigacion en Energia, UNAM, Temixco, Morelos (Mexico); Cano Castillo, Ulises; Albarran, Lorena [Instituto de Investigaciones Electricas Cuernavaca, Morelos (Mexico)

    2009-09-15

    Membrane electrode assemblies (MEA) are the most important part of PEM fuel cells since their interface results in the electrochemical reactions that make the generation of electricity possible. The MEA is composed of a proton exchange membrane, both sides of which are impregnated with a catalyst layer, normally of carbon-supported platinum. Depending on the technique used for its fabrication (atomization, serigraphy, brush methods, chemical reduction, etc.), the properties of the MEA can be different in terms of porosity, distribution of the catalyst, thickness and structure of the catalyst layer, and the quality of the union between the catalyst layer and the membrane, etc. Currently, the porosity of the electrodes is generated by isopropanol evaporation (solvent used in the dye) during the fabrication process conducted in the Instituto de Investigaciones Electricas (IIE). This document presents the results obtained from adding a porous agent to the catalytic dye base composition used in the fabrication of MEA at the IIE. [Spanish] Los Ensambles Membrana-Electrodo (MEA's) son la parte mas importante en las celdas de combustibles tipo PEM, ya que en su interfaz se llevan a cabo las reacciones electroquimicas que hacen posible la generacion de electricidad. El MEA esta compuesto de una membrana de intercambio protonico a la cual se le impregna en ambos lados una capa catalitica normalmente de platino soportado en carbon. Dependiendo de la tecnica empleada en su fabricacion (atomizado, serigrafia, brocha, reduccion quimica, etc.), las propiedades del MEA pueden ser diferentes en cuanto a porosidad, distribucion del catalizador, grosor y estructura de la capa catalitica, asi como la calidad de la union entre la capa catalizadora y la membrana, etc. Actualmente, la porosidad de los electrodos es generada por la evaporacion del isopropanol (solvente utilizado en la tinta) durante el proceso de fabricacion que se realiza en el Instituto de Investigaciones

  15. Cefalea cervicogénica: Tratamiento con estimulación eléctrica subcutánea periférica C1-C2-C3 Cervicogenic headache: Treatment with peripheral C1-C2-C3 subcutaneous electrostimulation

    OpenAIRE

    M. D. Rodrigo; J. M. Azcona; J. Quero; LORENTE, C; P. Acín; J. Azcona

    2005-01-01

    Introducción: Presentamos siete pacientes con dolor cervicogénico (C1-C2-C3) de larga evolución, persitente, severo, no controlado, de diferentes etiologías, en los que se habían agotado otras posibilidades terapéuticas, tratados con una técnica de estimulación eléctrica extraespinal periférica occipital (C1-C2-C3), mediante implante quirúrgico de electrodo cérvico-occipital uni- o bilateral. Material y método: Se trata de siete pacientes, mujeres, edad media de 50,5 años, con los siguientes ...

  16. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  17. Evaluación de un electrodo de carbón vítreo modificado con Zeolita tipo “A” en la adsorción de 2-clorofenol

    Directory of Open Access Journals (Sweden)

    Aurora Molina

    2009-10-01

    Full Text Available Glassy carbon electrodes modified with Zeolite “A” were studied in order to evidence the adsorption of 2-chlorophenol. Synthesis of zeolite was undertaken by a hydrothermal method using calcined kaolin as raw material. The zeolite was first exchanged with calcium ions. Then, it was modified with the cationic surfactant CTAB (cetyl trimethyl ammonium bromide or the non-ionic surfactant Triton X-100 (t-octylphenoxy-polyethoxyethanol. Adsorption of 2-chlorophenol was evaluated by cyclic voltammetry, once it was adsorbed onto the modified electrode. Electrochemical results indicated that the films surfactant-zeolites were able to adsorb the 2-chlorophenol from an aqueous alkaline medium. The best results were achieved when the cationic surfactant CTAB was used. The importance of electrode surface cleaning to guarantee the complete adherence between the vitreous carbon and the modified surfactant zeolite was determinated. Polishing and cleaning processes depend on the type of surfactant used.

  18. Efecto de la polietilenimina en la actividad catalítica de la peroxidasa de rábano (horseradish peroxidase inmovilizada en electrodos de oro modificados con monocapas autoensambladas de tioles (SAMs.

    Directory of Open Access Journals (Sweden)

    Pedro R. Matheus

    2009-05-01

    Full Text Available Effect of the Polyethyleneimine in the Activity Catalytic of the horseradish peroxidase Immobilized on Gold Electrodes Modified with a Self-assembled Monolayer of Thiols (SAMs. Studies were conducted bycyclic voltammetry (CV to investigate the effect of the polymer polyethyleneimine (PEI in the electrochemical reversibility of the mediator thionine and thus the catalytic activity of the enzyme horseradish peroxidase of recombinant HRP-NHis (horseradish peroxidase to the has been added to a chain of six histidine in the extreme N-terminal protein. This self produced monolayers of thiols (SAMS on gold electrodes, with chemical modifications obtained through successive stages in the solid phase of the electrode. The gold electrodes were modified with monolayer SAM-TOA-[ANTA/DADOO] -Co2+ [SAM: self-assembled monolayers of thiols, TOA: dithioctic acid, ANTA: nitrilotriacetic acid, DADOO: 1,8-diamino-3,6-dioxa octane]. The results showed that the presence of the polymer improves the electrochemical reversibility of the mediator to endure catalyticcurrents as high as those that are obtained with molar ratios ANTA:DADOO 10:1 in the absence of PEI, and improve the response voltammetric obtained.

  19. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  20. Electrocristalización de nanopartículas de Au sobre electrodos de polipirrol y su empleo en el sensado

    OpenAIRE

    Gutiérrez Pineda, Eduar; Rodríguez Presa, María J.; Bolzán, Agustín E.; Gervasi, Claudio Alfredo

    2014-01-01

    La electrodeposición de metales es uno de los métodos más extendidos en la obtención de capas metálicas para muchas aplicaciones decorativas e ingenieriles, principalmente debido a su bajo coste y fácil control. Este proceso involucra la formación de una nueva fase sobre el sustrato, lo que implica la participación de una serie de etapas relacionadas con el transporte de materia, la transferencia de carga y la formación de nuevas estructuras cristalinas [1]. La deposición de nanopartículas de...

  1. Interfaz humano-computadora basada en señales de electrooculografía para personas con discapacidad motriz

    Directory of Open Access Journals (Sweden)

    Daniel Pacheco Bautista

    2014-05-01

    Full Text Available En este trabajo se presenta el desarrollo de un prototipo que asiste, a personas con cierta discapacidad motriz, en la interacción con la computadora de una forma simple y económica, mediante señales de electrooculografía. Esta técnica permite detectar los movimientos oculares basada en el registro de la diferencia de potencial existente entre la córnea y la retina, tal propiedad es aprovechada en este proyecto para controlar el desplazamiento del cursor del ratón de una forma precisa sobre la pantalla de la computadora. El prototipo es un diseño compacto alimentado de una fuente única de 5V proveniente del puerto USB y utiliza la circuitería ya implementada en cualquier ratón electromecánico convencional con mínimas modificaciones. El uso de tales dispositivos así como de electrodos convencionales hace el producto de un costo relativamente bajo en relación a las propuestas en otros trabajos.

  2. Hermetisk AC-Krets

    OpenAIRE

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  3. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  4. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2010-01-01

    EHV AC Undergrounding Electrical Power discusses methods of analysis for cable performance and for the behaviour of cable, mixed and overhead lines. The authors discuss the undergrounding of electrical power and develop procedures based on the standard equations of transmission lines. They also provide technical and economical comparisons of a variety of cables and analysis methods, in order to examine the performance of AC power transmission systems. A range of topics are covered, including: energization and de-energization phenomena of transmission lines; power quality; and cable safety cons

  5. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  6. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  7. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  8. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  9. Operation Method for AC Motor Control during Power Interruption in Direct AC/AC Converter System

    Science.gov (United States)

    Shizu, Keiichiro; Azuma, Satoshi

    Direct AC/AC converters have been studied due to their potential use in power converters with no DC-link capacitor, which can contribute to the miniaturization of power converters. However, the absence of a DC-link capacitor makes it difficult to control the AC motor during power interruption. First, this paper proposes a system that realizes AC motor control during power interruption by utilizing a clamp capacitor. In general, direct AC/AC converters have a clamp circuit consisting of a rectifier diode(s) and a clamp capacitor in order to avoid over-voltages. In the proposed system, there is an additional semiconductor switch reverse-parallel to the rectifier diode(s), and the clamp capacitor voltage can be utilized for AC motor control by turning on the additional switch. Second, this paper discusses an operation method for AC motor control and clamp capacitor voltage control during power interruption. In the proposed method “DC-link voltage control”, the kinetic energy in the AC motor is transformed into electrical energy and stored in the clamp capacitor; the clamp capacitor is therefore charged and the capacitor voltage is controlled to remain constant at an instruction value. Third, this paper discusses a switching operation during power interruption. A dead-time is introduced between the operation of turning off all switches on the rectifier side and the operation of turning on the additional switch, which prevents the occurrence of a short circuit between the interrupted power source and the clamp capacitor. Finally, experimental results are presented. During power interruptions, an output current was continuously obtained and the clamp capacitor voltage was maintained to be equal to the instruction value of the capacitor voltage. These results indicate that both AC motor control and capacitor voltage control were successfully achieved by using the proposed system.

  10. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  11. Estudio del impacto acústico de la llegada del AVE a Alicante

    OpenAIRE

    Pamies Rodríguez, María Isabel

    2014-01-01

    Este estudio del impacto acústico de la alta velocidad en la ciudad de Alicante sirve para ver cómo ha afectado esta nueva línea a la ciudad, sus repercusiones acústicas. Se pretende evaluar el ruido ferreoviario antes y después de la llegada AVE comparando sus decibelios, sus frecuencias y los si los métodos de barrera son útiles y/o necesario. Para ello se van a emplear instrumentos de medida acústica así como el programa Cadna-A para la elaboración de los mapas de ruido junto con AutoCad....

  12. Actuación acústica en centro de arte contemporáneo

    OpenAIRE

    VAZQUEZ MARTINEZ, ALBERTO

    2011-01-01

    Trabajo científico técnico. El proyecto trata sobre una intervención acústica en un museo de arte contemporáneo de Valencia, y es un estudio sobre aislamiento y acondicionamiento acústico de las distintas salas del edificio, y que se realizó en colaboración con los autores del proyecto Vazquez Martinez, A. (2011). Actuación acústica en centro de arte contemporáneo. http://hdl.handle.net/10251/11934. Archivo delegado

  13. Estudio acústico del auditorio Rafael Frühbeck, Burgos

    OpenAIRE

    Pérez Cebrecos, Carlos

    2015-01-01

    El presente proyecto desarrolla un estudio acústico del recinto: Auditorio Rafael Frühbeck de Burgos, cumpliendo con las indicaciones exigidas por la norma UNE-EN ISO 3382-1: 2010, “Medición de parámetros acústicos en recintos, Parte 1: Salas de Espectáculos”. Se desarrollan dos estudios acústicos sobre el mismo recinto. En el primero de ellos, el recinto está configurado para la realización de eventos tales como conferencias o congresos, donde la inteligibilidad de la palabra es un factor...

  14. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  15. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  16. Cuidados con el anciano con tos productiva.

    OpenAIRE

    Costa de Moura, María Lucia

    2005-01-01

    A partir de las informaciones y con la motivación para hacer un estudio dirigido a los cuidados con el anciano, sigue la necesidad del desarrollo de acciones pertinentes para la práctica de cuidar, o sea, la asistencia de enfermería prestada directamente al anciano, principalmente a aquellos que llegan a la unidad de salud quejándose de tos. El objeto de este estudio es la asistencia de enfermería basándome en las cuestiones que rodean la percepción del enfermero y cómo el...

  17. Valoración del desempeño de un dispositivo de autoalimentación diseñado para la evaluación operativa de electrodos revestidos Self-feed device behaviour valuation designed for assessment of operability of covered electrodes

    Directory of Open Access Journals (Sweden)

    Alejandro García Rodríguez

    2009-03-01

    Full Text Available El presente trabajo tiene como objetivo valorar la efectividad de un dispositivo de autoalimentación para electrodos revestidos. El mismo es capaz de eliminar perturbaciones inherentes a operarios o sistemas de control automático, para el estudio del comportamiento de electrodos revestidos. La conjugación de diferentes métodos, tales como el análisis estadístico del tiempo de duración del cortocircuito, el análisis metalográfico ( penetración, zona afectada por el calor, coeficiente de forma y distancia promedio entre frentes de solidificación del cordón, junto al análisis del comportamiento de los parámetros eléctricos primarios del arco y los índices de consumo del electrodo, permiten obtener relaciones entre el comportamiento eléctrico del arco, el proceso de transferencia de masa y la apariencia del cordón. Esto permite extraer criterios sobre la estabilidad del proceso y el desempeño del dispositivo de alimentación empleado. Se obtiene una metodología estadística, apropiada para el procesamiento del parámetro "duración del cortocircuito", a partir de un adecuado ajuste de las distribuciones empíricas a un modelo Lognormal. El dispositivo de autoalimentación para electrodos revestidos, permite la ejecución repetible y reproducible de cordones de soldadura en posición plana, manteniendo la longitud del arco en función de las características físico-químicas del consumible evaluado en regímenes de trabajo de 125A, 140A y 160A.The objective of the present work is to evaluate the effectiveness of a self-feed device for covered electrodes. This device is able of eliminate disturbances from manual operation or the use of automatic control systems during the study of covered electrode behavior. The conjugation of different methods like short-circuit time statistical analysis, metallographic analysis (penetration, heat affected zone, shape and mean distance between successive solidification fronts together with the

  18. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  19. Improvement of the performance of a new type of single chamber microbial fuel cell compared to a conventional cell; Mejora del desempeno de un nuevo tipo de celda de combustible microbiana de una camara comparado con una celda convencional

    Energy Technology Data Exchange (ETDEWEB)

    Vazquez Larios, A.L.; Vazquez-Huerta, G.; Esparza-Garcia, F.; Solorza-Feria, O.; Poggi Varaldo, H.M. [Centro de Investigacion y de Estudios Avanzados del IPN, Mexico D.F. (Mexico)]. E-mail: hectorpoggi2001@gmail.com; linevazquez@yahoo.com.mx

    2009-09-15

    The objective of this work was to design, build and operate a new type of microbial fuel cell (MFC-A) and evaluate the architectural changes in the production of electricity. The results were compared with those of a standard fuel cell (MFC-B). The MFC-A consisted of a horizontal acrylate cylinder with two systems of sandwiched electrodes (each with a anode proton exchange membrane-cathode) separated by 78 mm. The MFC-B consisted of an anode and a cathode each in the opposite faces of the cell. The internal resistance of the cells were determined with polarization curves. The cells were operated in batch during 50 h at 30 degrees Celsius obtained with 38 mW/m{sup 2} and 5 mW/m{sup 2} for MFC-A and MFC-B, respectively. The changes in the architecture of the cell and design of the electrodes occurred at a power density 8 times greater, associated with the decrease in internal resistance of 1200 and 3900 {Omega} for MFC-A and MFC-B, respectively. The change in architecture (double electrode in the same volume for MFC-A) enabled obtaining a 13 times greater potential per unit volume, with 922 mW/m{sup 3} in the new MFC-A cell versus 69 mW/m{sup 3} in MFC-B. [Spanish] El objetivo de este trabajo fue disenar, construir y operar una celda de combustible microbiana de nuevo tipo (CCM-A), y evaluar los cambios de arquitectura en la produccion de electricidad. Los resultados fueron comparados con los de una celda de combustible estandar (CCM-B). La CCM-A consistio de un cilindro horizontal de acrilato, con dos sistemas de electrodos emparedados (cada uno con catodo/membrana de intercambio protonico/anodo) separados por 78 mm. La CCM-B consistio de un anodo y un catodo cada uno en las caras opuestas de la celda. Las Ri de las celdas fueron determinadas por curva de polarizacion. Las celdas fueron operadas en lote durante 50 h, a 30 grados centigrados, y fueron inoculadas con un inoculo sulfato reductor (In-SR) y cargadas con un extracto modelo similar al perfil de metabolitos

  20. Arquitectura teatral, historia y acústica: el sonido de los teatros

    Directory of Open Access Journals (Sweden)

    Arturo Barba Sevillano

    2013-01-01

    Full Text Available La evolución arquitectónica de los edificios teatrales a lo largo de la historia está intrínsecamente relacionada con el tipo de espectáculos representados en ellos y con sus necesidades acústicas. En este artículo se exponen cronológicamente los rasgos morfológicos y acústicos de los edificios teatrales, desde las tipologías iniciales de la antigüedad clásica hasta las diferentes propuestas de teatros de ópera a la italiana en los siglos XVIII y XIX. Se analiza la herencia formal que cada modelo teatral adeuda a sus predecesores y se señalan sus diferencias. En cada tipo teatral aportamos una síntesis de sus características acústicas explicando sus virtudes y defectos, y argumentamos las razones de su funcionamiento sonoro.

  1. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  2. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  3. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  4. Investigando con personas con dificultades de aprendizaje

    Directory of Open Access Journals (Sweden)

    Borja González Luna

    2013-12-01

    Full Text Available El artículo muestra los orígenes de lo que Walmsley (2008 denomina «investigación inclusiva». Para comprender qué se entiende por investigación inclusiva tenemos que remontarnos a los debates epistemológicos sobre las metodologías cuantitativas y cualitativas, acontecidos en la década de los 90, en torno a la revista Disability & Society. A partir de una síntesis de dichos debates, focalizados en el ámbito de la «discapacidad intelectual y del desarrollo», se exponen dos estrategias de colaboración con dicha población: a una aproximación etnográfica (de trabajo grupal, y b una aproximación biográfica (de trabajo individual. A continuación se esboza un posible diseño de trabajo de campo que intenta superar el paradigma cualitativo «clásico» con el objetivo de incluir a dicho colectivo más allá del rol de «sujetos de la investigación». Para finalizar se recoge el debate sobre la accesibilidad de los resultados de la investigación a los participantes en dichas investigaciones, y con ello la necesaria innovación en el ámbito de las «devoluciones» de los resultados, cuando se trata de incluir a personas que presentan limitaciones para la comprensión del lenguaje abstracto oral y/o escrito.

  5. SSTI Clark ACS Technology Demonstrations

    OpenAIRE

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  6. Energy saving in ac generators

    Science.gov (United States)

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  7. Atención conjunta y desarrollo léxico en niños con síndrome de Down y niños con desarrollo típico

    OpenAIRE

    Galeote, Miguel; Checa, Elena; Sánchez-Palacios, Concha; Gamarro, Antonio; Isequilla, Estela; Conesa, Macarena

    2013-01-01

    En este estudio se analiza la relación entre la atención conjunta (AC) y el desarrollo léxico temprano en niños con síndrome de Down (SD) y niños con desarrollo típico (DT). Diversos estudios han demostrado el papel facilitador de la AC sobre el desarrollo léxico en niños con desarrollo típico (Carpenter, Nagel y Tomasello, 1998; Masur, Flynn y Eichorst, 2005; Shimp y Huttenlocher, 2007; Tomasello y Farrar, 1986; Tomasello y Todd, 1983). Dicho aprendizaje se ve favorecido si la madre sigue el...

  8. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  9. Gestión del riesgo en la seguridad de la información con base en la Norma ISO/IEC 27005 de 2011, proponiendo una adaptación de la Metodología OCTAVE-S. Caso de estudio: proceso de inscripciones y admisiones en la división de admisión registro y control AC

    Directory of Open Access Journals (Sweden)

    Diego Espinosa T

    2014-12-01

    Full Text Available Este documento presenta la aplicación de la metodología OCTAVE-s para el análisis y gestión del riesgo en la seguridad de la información, adaptada al proceso Inscripciones y Admisiones, en la División de Admisión, Registro y Control Académico (DARCA de la Universidad del Cauca; siguiendo las directrices de la norma ISO/IEC 27005:2011. Además se incluye la estructura del proceso, y el procedimiento escogido como caso de estudio para aplicar el tratamiento del riesgo. Finalmente, se muestran los resultados obtenidos y las conclusiones de la gestión del riesgo con la metodología adaptada.

  10. Funcionando con la computadora

    OpenAIRE

    Álvarez, Eduardo; Astiz, Mercedes; Medina, Perla; Montero, Y.; Oliver, María; Rocerau, M. Cristina; Valdez, Guillermo; Vecino, María; Vilanova, Silvia

    2004-01-01

    En este trabajo se presenta la descripción y resultados de la segunda etapa de una experiencia planteada con el objetivo de indagar la manera en que los alumnos determinan e interpretan funciones que explican situaciones problemáticas valiéndose de una nueva forma de trabajo en el aula: la utilización de la computadora como herramienta y un programa asistente matemático. La primera etapa consistió en el desarrollo de un taller optativo con alumnos de entre 14 y 15 años de edad del Colegio Dr....

  11. en pacientes con obesidad

    Directory of Open Access Journals (Sweden)

    Alcia María Alvarado Sánchez

    2005-01-01

    Full Text Available El objetivo de este estudio fue evaluar la eficacia de una intervención psicológica en pacientes con obesidad. Se utilizó un diseño cuasiexperimental con un grupo de estudio y un grupo control. Después de la intervención, se encontró una diferencia significativa en la reducción de peso entre los grupos. Asimismo, hubo un incremento significativo en la autoestima del grupo estudiado.

  12. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  13. Evaluación acústica objetiva y subjetiva en salas y teatros de Andalucía

    OpenAIRE

    Bustamante Rojas, Pedro

    2016-01-01

    Falta palabras clave La tesis doctoral tiene como objetivo principal caracterizar la acústica de las principales salas de concierto de Andalucía. En concreto, el estudio abarca un total de nueve salas, entre teatros y auditorios de la comunidad autónoma, actualmente en uso. Para ello ha sido necesario realizar mediciones acústica in situ con el fin de obtener y valorar los parámetros acústicos objetivos que se utilizarán para la citada caracterización. Pero la tesis tiene también como f...

  14. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  15. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  16. AcEST: BP919701 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Mycob... 74 3e-12 tr|B2HMD5|B2HMD5_MYCMM Conserved hypothetical membrane protein O... 70 5e-11 tr|A0PTZ3|...VGLKKFMD 322 Query: 290 YLESVIPLWKEY 255 YL+SV+PLW Y Sbjct: 323 YLDSVLPLWLRY 334 >tr|B2HMD5|B2HMD5_MYCMM Con

  17. Una plataforma para facilitar el aprendizaje en ingeniería acústica

    OpenAIRE

    Poveda Martínez, Pedro; Carbajo San Martín, Jesús; Ramis Soriano, Jaime

    2015-01-01

    En este trabajo se presenta una plataforma que facilita la realización de diversas actividades y prácticas asociadas a contenidos en el ámbito de lo que se viene denominando “ingeniería acústica”. El sistema central de esta plataforma es una tarjeta de adquisición de datos para la que se han programado diversas aplicaciones en Labview. Se pueden distinguir distintas áreas entre las que destacamos: el estudio de los transductores (con emisión audible y ultrasónicos) y la acústica de salas. Tam...

  18. Instalación para vivienda multifamiliar de ACS en Madrid

    OpenAIRE

    Fernández Fanego, María

    2009-01-01

    El objeto de este proyecto consiste en el diseño y propuesta de una instalación solar térmica para producción de agua caliente sanitaria (ACS) en una vivienda multifamiliar situada en Madrid. Para ello se van a estudiar las necesidades térmicas de ACS en función de las características constructivas del edificio y analizando los datos climatológicos y de temperatura de red de agua fría propios del emplazamiento. Con ello se llevará a cabo un estudio energético teniendo en cue...

  19. Paisajes sonoros de Barcelona: itinerarios realizados para "Arquitectura acústica" en 2016

    OpenAIRE

    Daumal Domènech, Francesc de Paula; Piguillem Poch, Núria; Díaz Blanco, Celia

    2016-01-01

    Cuando hablamos del Paisaje sonoro de una ciudad, hemos definido el itinerario acústico como una de las herramientas de análisis más expresivas del contenido histórico, cultural y perceptivo. Por ello, en esta comunicación, se muestran los trabajos realizados por 9 grupos de alumnos de la asignatura optativa e intensiva “Arquitectura Acústica”, impartida por este autor durante la última semana de enero del 2016, en concordancia con los estudios anteriormente realizados para el Area de Medi Am...

  20. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  1. sistema Web con JSP

    Directory of Open Access Journals (Sweden)

    César Viloria Núñez

    2014-01-01

    Full Text Available Este artículo presenta el desarrollo de un sistema de información que permite la adquisición y la administración de información relacionada con los signos vitales como la presión arterial, la frecuencia cardiaca y respiratoria, y la saturación de oxígeno en la sangre de un paciente. La implementación del sistema se basa en una solución Web, permitiendo así que médicos especialistas puedan monitorear a sus pacientes desde cualquier punto conectado a la red en tiempo real y, al mismo tiempo, dar indicaciones críticas al personal médico que se encuentra en el lugar con el paciente.

  2. pacientes con falla cardiaca

    Directory of Open Access Journals (Sweden)

    Diana Marcela Achury Saldaña

    2007-01-01

    Full Text Available Objetivo: determinar la adherencia al tratamiento de pacientes con falla cardiaca hospitalizados, al aplicar un plan educativo quefomenta el autocuidado.Método: estudio cuasiexperimental (entrevistas enfermera-paciente realizado entre diciembre de 2004 y mayo de 2006, con unamuestra de 50 pacientes seleccionados por conveniencia. Se diseñó un instrumento para evaluar los comportamientos de los pacientes,con base en algunos resultados de la adherencia y sus respectivos indicadores de la taxonomía NOC (Nursing out comes classification. Laadherencia al tratamiento fue medida en dos momentos: el primero durante la hospitalización, seguido de la aplicación del plan educativoantes del alta, que proporcionaba información en el manejo de su enfermedad desde una dimensión física, psicológica y social quepromueve el autocuidado; y el segundo un mes después del alta en su domicilio.Resultados: diferencias estadísticamente significativas (P=0,0001 que demuestran cómo mediante la capacitación al paciente enel manejo de su tratamiento farmacológico y no farmacológico, el establecimiento de una sana relación entre el profesional de enfermeríay el paciente, y la participación de la familia, se logra una total adherencia al tratamiento.Conclusiones: para lograr una adherencia total del paciente con falla cardiaca al tratamiento es necesario un proceso educativo y unseguimiento continuo y personalizado que motive permanentemente al paciente y se le reconozca el papel protagónico en su cuidado y manejo de la enfermedad.

  3. Transporte forestal con cables

    OpenAIRE

    Anaya L. Héctor J.

    2012-01-01

    La explotación forestal es un problema fundamentalmente de transporte. El apeo y la preparación de las trozas, aunque a veces presentan algunas dificultades, son operaciones fáciles de resolver comparadas con la operación de transporte la cual absorbe del 60% al 70% o más del costo total del aprovechamiento del bosque. El 30% o 40% restante es absorbido por las faenas previas de apeo y troceo.

  4. Lectura con adolescentes

    Directory of Open Access Journals (Sweden)

    Silvia Méndez Anchía

    2007-01-01

    Full Text Available Con base en la premisa de que la lectura de textos literarios tiene una función formadora y que esta se acentúa en la adolescencia, me propongo demostrar que el cuento “Rapunzel” puede utilizarse como estrategia para explorar algunas situaciones que los sujetos adolescentes perciben como particulares en relación con su vida, pero que se inscriben dentro de grandes problemáticas estudiadas por varias disciplinas. Para ello, he identificado, desde dos marcos de referencia (sociológico y psicoanalítico, diversas problemáticas y discursos que se desprenden de la lectura del cuento realizada por dos mujeres adolescentes, quienes respondieron una guía de lectura y participaron en una entrevista a profundidad. Concluyo que la lectura y comentario del cuento hacen posible que una serie de experiencias que los sujetos adolescentes viven como únicas (como el embarazo de una amiga, las críticas de las personas adultas y las exigencias de padres y madres, ingresen en el circuito de los conocimientos generales al relacionarlas con los discursos y problemáticas en que se inscriben (por ejemplo, el discurso de la “crisis” de la adolescencia, el enfoque de derechos humanos, el mundo fantasmático materno. Por ello, recomiendo la lectura y comentario de textos literarios como estrategia didáctica para contribuir a la elaboración de la subjetividad de personas adolescentes.

  5. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  6. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  7. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  8. ac electroosmosis in rectangular microchannels.

    Science.gov (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  9. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  10. Cementos con cenizas volantes

    Directory of Open Access Journals (Sweden)

    Ossa M., Mauricio

    1984-03-01

    additions of 20 and 30% .

    Casi la generalidad de los estudios realizados sobre cementos con adición de cenizas volantes se refieren a sus características y comportamiento en pastas, morteros y hormigones, siempre en relación con aquéllos del cemento portland. Esta vez, se desarrolló un trabajo experimental orientado a relacionar entre sí los cementos con adiciones de cenizas volantes y de puzolana natural. Para ello se fabricaron a escala de laboratorio cementos de ambos tipos, empleando como materias primas comunes clinker y yeso y, como variables, diferentes porcentajes de las dos adiciones, que cumplieron previamente los requisitos normalizados en cuanto a sus actividades puzolánicas. La calidad de los cementos fabricados resultó adecuada y concordante con la del cemento portland-puzolánico obtenido a escala industrial con los mismos clinker, yeso y puzolana natural de este estudio. Posteriormente, se determinaron las características de los cementos experimentales y se confeccionaron morteros normales para la realización de ensayos físicos y mecánicos. Los resultados de ensayos indicaron que los cementos con adición de cenizas volantes (CCV requieren menos agua para consistencia normal, presentan tiempos de fraguado mayores y expansiones en autoclave menores que los cementos con adición de puzolana (CP. Los calores de hidratación a 7 y 28 días de edad fueron aproximadamente similares para ambos tipos de cemento. En morteros normales, los cementos CCV mostraron menor retracción de secado, mayor retentividad y mayor fluidez (para igual cantidad de agua que los cementos CP. En los ensayos de exudación se observó que ésta depende más de la finura que el tipo de adición. Finalmente, los ensayos mecánicos señalaron que las resistencias a compresión y flexotracción de los morteros con cementos CCV son menores a edades inferiores que 14 días (del orden de 5 a 10% a un día de edad, pero que a partir de entonces pasan a ser mayores que las de

  11. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  12. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  13. Utilización del mineral de manganeso (pirolusita) en la producción de aceros al carbono

    OpenAIRE

    Aerles Batista-Cabrera; Efraín Navas-Medina

    2003-01-01

    Los métodos tradicionales de producción de acero utilizan el ferromanganeso para obtener el porcentaje de Mn en la marca establecida según la norma cubana, pero este compuesto es altamente costoso. Se ensayó, en la producción del Ac 35, sustituir el ferromanganeso por el mineral pirolusita (MnO2) con el fin de reducir los costos. Se evaluaron dos variantes de sustitución: la primera consiste en añadir el mineral con virutas de aluminio y coque (o residuos de electrodos) sobre la escoria del m...

  14. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  15. Reinas de acá

    OpenAIRE

    Artigas, Celina

    2013-01-01

    La más conocida de todas las mariposas de América fue clasificada (en 1874, por Nahuel Parada) con ese nombre por el vasto dominio que cubre esta especie naranja y negra. Es protagonista de una de las migraciones más emocionantes, que tiene en Michoacán, México, un santuario de regreso, declarado Patrimonio de la Humanidad en 2008.

  16. Funciones con Microsoft Excel

    OpenAIRE

    Castillo, Dalia Imelda; Estrada, Ana Luisa; Hernández, Brenda Amalia

    2009-01-01

    En este documento se presenta el desarrollo de algunas actividades que se trabajaron con estudiantes de primer semestre de la Universidad Autónoma de Nayarit; utilizando la hoja de cálculo Excel en el tema de visualización de funciones, para la materia de lenguaje y pensamiento matemático. Ya que la tecnología ha adquirido un papel muy importante en el proceso enseñanza-aprendizaje, nos ofrece un medio para que el estudiante explore, analice, verifique y desarrolle habilidades que se serán út...

  17. Creo con mis dedos

    OpenAIRE

    S??nchez Aniceto, Monta??a

    2015-01-01

    Las artes pl??sticas son muy importantes para los ni??os/as sobre todo para Educaci??n Infantil ya que promueven la creatividad mediante diferentes recursos y t??cnicas lo que favorece su motivaci??n en las competencias desde la edad temprana hasta la adolescencia. Es la primera forma que tiene el ni??o/a de expresarse en el mundo (a trav??s de los garabatos), de comunicarse, compartir sus emociones con los dem??s, creando su propio lenguaje que evolucionar?? hacia el lenguaje oral y escri...

  18. Mayonesa con quitosano

    OpenAIRE

    Gaffrey, María Celeste

    2014-01-01

    Introducción: El quitosano es un polímero natural que se obtiene a partir de la quitina, la cual forma parte de la estructura de soporte de numerosos organismos vivos, tales como artrópodos (crustáceos e insectos), moluscos y hongos. Presenta propiedades aplicables en los alimentos, como estabilizante, emulsificante, y quelante. No puede ser digerido por los seres humanos por lo cual está considerado como una fibra dietética con un contenido calórico cero. Objetivos: Evaluar...

  19. Eugenistas, pero con prudencia

    Directory of Open Access Journals (Sweden)

    Pogliano, Claudio

    1999-12-01

    Full Text Available Thinking that one could not describe eugenics like a unique movement, since numerous bound varians took place related to the geographical and cultural context, this article tries to demostrate the peculiarity of the Italian case. If already in 1889 Giuseppe Sergi wanted that the artificial selection take it to end what should make the natural, avoiding the risk of the so called «degeneration», only in the face of the First World War seems to grow the alarm for the decadent quality of the population, finding a more and more wide echo. In 1919 the Siges was born (Società italiana de genetica ed eugenica shocked under the impression of the difusse fear about the butcher the war had caused. From there from now on fastens a «nazional» direction closely related to the traditional thought and also with the new political temper. A «moderate» direction, Fascist, Catholic, that was built in consonance with the pronatalism of the regime and in rough polemic with the presumed Anglo-Saxon eugenics aberration.

    Partiendo de la base de que no se puede describir la eugénica como un movimiento unitario, ya que se produjeron numerosas variantes ligadas al contexto geográfico y cultural, este artículo intenta demostrar la peculiaridad del caso italiano. Si ya en 1889 Giuseppe Sergi deseaba que la selección artificial llevase a cabo lo que debía de hacer la natural, evitando así el riesgo de la «degeneración », sólo ante la Primera Guerra Mundial parece crecer la alarma por la decadente calidad de la población, encontrando un eco cada vez más amplio. En 1919 nació la Sige (Società italiana de genetica ed eugenica bajo la impresión del difuso temor que la carnicería bélica había provocado. De ahí en adelante prende rápidamente una dirección «nazional» que se imbrica tanto con una tradición del pensamiento como con el nuevo temple político. Una dirección «moderada» fascista, católica, que se construyó en consonancia con el

  20. Conversando con... BENEDETTA TAGLIABUE

    OpenAIRE

    Torres, Ana; Cabanes, Miguel

    2011-01-01

    Esta entrevista se realiza en el marco del XIII Congreso Internacional de Expresión Gráfica Arquitectónica realizado en la Escuela Técnica Superior de Arquitectura de Valencia los días 27 al 30 de Mayo de 2010.Benedetta Tagliabue es, en la actualidad, una de las arquitectas con mayor prestigio en el panorama internacional. El Pabellón de España para la Expo de Shanghai 2010, es una de sus últimas obras más representativas, en el que se acentúa y desarrolla un conjunto de características arqui...

  1. Placa de pila de combustible con varias áreas de reacción química

    OpenAIRE

    Lincheta Mesa, Eduardo; Lozano Fantoba, Antonio; Barreras Toledo, Félix; Valiño García, Luis; Mustata Oroviceanu, Radu

    2010-01-01

    La placa de pila de combustible, que se utiliza generalmente para distribuir de forma homogénea los fluidos reactantes sobre las áreas de reacción química correspondientes a las capas catalíticas (electrodos), presenta, en al menos una de las dos caras, dos o más áreas de reacción química una geometría de flujo determinada, de manera que se optimiza la producción de corriente por celda utilizando ensamblajes de membrana y electrodo del mismo tamaño, reduciendo el espacio nec...

  2. AcEST: BP921217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B03 574 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B03. BP921217 - Show BP92121...is mRNA. clone: YMU001_000147_B03. Accession BP921217 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121...containing protei... 100 5e-21 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-con...... 89 2e-17 sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei...

  3. con la cosecha mecanizada

    Directory of Open Access Journals (Sweden)

    Arturo Martínez Rodríguez

    2006-01-01

    Full Text Available Las investigaciones dirigidas a incrementar los indicadores de eficiencia y calidad durante la cosecha mecanizada del café, constituyen un tema de gran actualidad a nivel internacional. La determinación de las propiedades físico-mecánicas de los frutos y del sistema frutopedúnculo, es una etapa indispensable durante las investigaciones relacionadas con la cosecha mecanizada de este producto. En este trabajo se brindan los resultados sobre la determinación de un grupo de propiedades dimensionales, inerciales y elásticas del sistema fruto-pedúnculo de coffea arabica variedad Catuai en diferentes estadios de maduración, relacionadas con la cosecha mecanizada de este cultivo.Así mismo se determina el momento flector requerido para la ruptura de la unión fruto pedúnculo. Durante la investigación se emplearon técnicas de procesamiento de imágenes digitales, así como de extensometría eléctrica. Como resultado de la medición de las diferentes propiedades se apreciaron diferencias sustanciales en las características dimensionales, inerciales y elásticas de los frutos maduros y verdes, así como en el momento requerido para el desprendimiento de los frutos y en las formas en que se produce el desprendimiento.

  4. La atención odontológica del paciente geriátrico con deterioro cognitivo

    OpenAIRE

    M.C. Haya Fernández; I. Blasco Garrido; M.B. Cabo Pastor

    2015-01-01

    La investigación clínica ha demostrado que una mejor función cognitiva se relaciona con un mejor estado de salud oral. Y, de la misma manera, los pacientes mayores institucionalizados con deterioro cognitivo presentan una pobre salud oral con mayor número de dientes ausentes, caries, acúmulo de placa y enfermedad periodontal. El diagnóstico precoz del paciente con deterioro cognitivo es fundamental para mejorar el pronóstico de la enfermedad y poder plantear un tratamiento odontológico preven...

  5. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  6. Entrevista con Juan Marichal.

    Directory of Open Access Journals (Sweden)

    - Consejo de Redacción

    1997-01-01

    Full Text Available Juan Marichal nació en Santa Cruz de Tenerife, en 1922, en el seno de una familia ligada al partido republicano insular. Muy joven, en 1935, se trasladó a Madrid, ciudad en la que vive el estallido de la guerra civil. En 1937, pasa a Valencia y luego a Barcelona; tras su exilio en 1938, prosigue sus estudios secundarios en un liceo de París, concluyéndolos en Casablanca. En 1941 emigra a México, formándose en la UNAM: fue alumno de los exiliados José Gaos y Joaquín Xirau así como del mexicano Edmundo O 'Gorman. Luego, becado en Princeton desde 1946, lo fue de América Castro, donde preparó una tesis sobre Feijoo. Apoyado en las vastas perspectivas de sus maestros, fue orientándose hada nuestra historia intelectual, desde el siglo XV hasta hoy. Su carrera profesional se ha desarrollado en los Estados Unidos (coincidiendo con Amado Alonso y con Ferrater Mora: ha sido profesor de estudios hispánicos en la Universidad de Harvard, desde 1948 hasta 1988, año en que se jubiló voluntariamente como numerario (aunque había permanecido en el Bryn Mawr College, entre 1953 y 1957. A este trabajo se suman, con todo, sus conferencias en América Latina y en España. Ha colaborado en las revistas más importantes, en este campo, de México, Nueva York, Puerto Rico, La Habana, Buenos Aires o París así como de las españolas, desde los sesenta. Juan Marichal -hoy, miembro de la Junta Directiva de los Amigos de la Residencia de Estudiantes, director del Boletín de la Institución Libre de Enseñanza y asociado al Instituto Universitario Ortega y Gasset-, reside en España desde otoño de 1989: se considera a sí mismo «voluntario en Madrid», como había dicho Alfonso Reyes en su estancia madrileña (1914-1924.

  7. Entrevista con Geoffrey Lloyd.

    OpenAIRE

    Fernando Colina Pérez; Mauricio Jalón

    2008-01-01

    Helenista y también sinólogo de relieve internacional, Geoffrey E. R. Lloyd nació en Londres (1933), de padres galeses. Es un gran historiador de la ciencia y del pensamiento griegos. En 1940 fue evacuado de Londres con su madre. Sus estudios significativos comenzaron, tras algún rodeo, en el King’s College donde estudiaba su hermano. Éste sería, como su padre, médico, y él mismo dudó en estudiar esa profesión, que late en sus libros. Pero un profesor de clásicas como John Raven –que redactó,...

  8. Adaptación cognitiva en madres de niños con síndrome de Down

    OpenAIRE

    Romero, Rosalinda; Morillo, Beatriz

    2002-01-01

    La presente investigación estuvo dirigida a determinar la Adaptación Cognitiva (AC) en madres de niños con Síndrome de Down (SD). El estudio es descriptivo y estuvo fundamentado en la Teoría de AC, elaborada por S.E. Taylor (1983), que explica el mecanismo de recuperación de las personas ante un evento victimizante. La muestra fue de 83 madres de niños con SD que asisten a los centros educativos del Estado Zulia, Venezuela. Los instrumentos empleados fueron la ...

  9. Entrevista con Georges Duby.

    Directory of Open Access Journals (Sweden)

    - Consejo de Redacción

    1994-01-01

    Full Text Available Duby, heredero de dos grandes historiadores como Marc Bloch y Lucien Febvre, es uno de los más importantes medievalistas europeos. Fue, y sigue siendo, un motor de la importante reforma en la historia producida desde los sesenta. En sus primeros trabajos se acusa la recepción de las ideas económicas y geográficas de la mejor historiografía. Su riguroso estudio sobre la base material de la Edad Media, le permitirá luego irrumpir en la historia de las mentalidades, analizando, como decía Febvre, el utillaje mental (vocabulario, sintaxis, lugares comunes, cuadros lógicos, etc. del Medioevo. Así, el ejemplo de Mauss y LéviStrauss le anima a trabajar sobre el matrimonio, la sexualidad y ciertos sistemas del pensamiento: el primero, con su defensa de los hechos sociales totales, y el segundo, que buscaba las dimensiones simbólicas de lo social, le impulsan a trabajar sobre la ideología entendida no como mero reflejo de la situación material sino como «proyecto de acción sobre lo vivido». A su obra individual, atenta a los impulsos culturales más vivos, se suma su empuje decisivo en la realización de proyectos colectivos como la Historia de la vida privada o la Historia de las mujeres. Prácticamente, han sido traducidos todos sus libros al castellano, y han podido verse en España asimismo varios de sus programas televisivos (ha sido presidente de la SEPT, cadena de televisión cultural fundada en 1985. La amplitud de sus intereses intelectuales, transmitidos en su obra con un lenguaje a la vez muy claro y bellamente elaborado, se hace palpable también en este diálogo.

  10. preescolares desnutridos con madres con obesidad y sin obesidad

    Directory of Open Access Journals (Sweden)

    Viridiana Vanessa Conzuelo-González

    2009-01-01

    Full Text Available El primer objetivo fue conocer cuántos menores de cinco años con diferentes grados de desnutrición tienen una madre con sobrepeso/obesidad/ en una comunidad indígena que vive en extrema pobreza y bajo condiciones de migración masculina internacional. El segundo fue comparar tres variables socionutricionales (ingreso familiar, educación de la madre y adecuación nutrimental de la dieta diaria entre estos hogares y los hogares con desnutrición infantil y madres sin obesidad. Se realizó un estudio transversal (2006-2007, en la comunidad mazahua de San Francisco Tepeolulco, Municipio de Temascalcingo; que incluyó a 85 hogares integrados por preescolares con desnutrición inscritos al programa Oportunidades. Se determinó el estado nutrición de los preescolares con indicadores antropométricos y se obtuvo el IMC de las madres de estos infantes. Se aplicó una encuesta socionutricional, incluida el recordatorio de 24 horas, y complementado con la observación participante (cualitativa. Se encontró que 83% de las madres mazahuas presentaron sobrepeso u obesidad. El estado de nutrición de los preescolares con madres con obesidad presentó un porcentaje mayor de desnutrición (76%. En la variable género, se encontró que 54% de los niños con madres con obesidad tenía baja talla. Al relacionar el nivel educativo de la madre, esta variable resultó ser estadísticamente significativa (p=0.015, donde el analfabetismo está más relacionado con la desnutrición infantil que tienen madres de bajo y/o peso normal. La elevada prevalencia de hogares conformados con preescolares con desnutrición y madres con obesidad, es un síntoma más de la pobreza en zonas indígenas en México, con bajo índice de desarrollo humano.

  11. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  12. Estudi de l'estat actual i proposta d'intervenció acústica de l'edifici de la Societat Musical de Sant Antoni de Benageber

    OpenAIRE

    ANDRÉS ANGLÉS, MARINA

    2014-01-01

    El TFG trata sobre el acondicionamiento acústico del edificio destinado al ensayo de la Sociedad Musical de San Antonio de Benageber. A partir de los planos realizados en AutoCad se han señalado unos puntos concretos y, posteriormente, calculado con los aparatos de medición pertinentes, los parámetros acústicos de varias aulas y sala de ensayo. Del mismo modo y atendiendo a los parámetros obtenidos tras su estudio, se ha propuesto una mejora para el acondicionamiento acústico del mismo. An...

  13. Diccionarios basados en taxonomías con estructura de grafo orientado acíclico

    OpenAIRE

    Vaquero Sánchez, Antonio; Álvarez Montero, Francisco; Sáenz Pérez, Fernando

    2005-01-01

    Al irse multiplicando las bases de datos léxicas en diferentes formatos, ha crecido también la preocupación acerca del nivel de reusabilidad de los recursos léxicos. El intercambio e integración de datos, así como el desarrollo de software común, son importantes para evitar duplicaciones de esfuerzos y posibilitar el desarrollo de bases de datos de información lingüística a gran escala. Es necesario un enfoque unificado en el desarrollo de herramientas para la creación y gestió...

  14. Propiedades acústicas de los paneles de carrizo

    Directory of Open Access Journals (Sweden)

    Díaz, César

    2012-03-01

    Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems. This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.

    El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos. En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.

  15. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  16. Aleaciones de Ag/Pd para su uso como metalizaciones internos en condensadores cerámicos multicapa

    OpenAIRE

    Villegas, Marina

    1995-01-01

    Los principales objetivos que permiten el futuro desarrollo de condensadores cerámicos de elevadas prestaciones son reducir el coste de los electrodos internos y la reducción de su espesor sin sacrificar su rendimiento. Debido a que el funcionamiento del electrodo interno influye fuertemente sobre el funcionamiento final de los condensadores cerámicos multicapa (CCM), es necesario conocer y entender todas las posibles interacciones de dichos electrodos con el material dieléctrico que constitu...

  17. Entrevista con Alberto Tenenti.

    Directory of Open Access Journals (Sweden)

    - Consejo de Redacción

    1995-01-01

    Full Text Available Gran especialista en historia moderna, Alberto Tenenti nació en Viareggio, en 1924. Tras realizar estudios superiores en Italia, trabajó en el Centre National de la Recherche Scientifique varios años, asesorado por Lucien Febvre. Ha dirigido el Archivo del Estado de Brescia; y, más tarde, ha enseñado en París, desde una cátedra en la École Pratique des Hautes Études en Sciences Sociales (VI Sección, alIado de Braudel. Su Il senso della morte e l'amore della vita nel Rinascimento, de 1957, es una obra maestra sobre los orígenes de la sensibilidad moderna: sin olvidar el naciente vitalismo, estudia el desarrollo de dos motivos, el del ars moriendi, que tiene su evolución propia desde 1350 hasta su difusión impresa, y el de lo macabro, que refleja la crisis de conciencia del siglo XV y adquiere «unas dimensiones desconocidas y verdaderamente anormales». En este libro sobre un problema clave como la muerte, apela de modo notable a la iconografía: Tenenti ha recordado que la cultura tradicional, eclesiástica sobre todo, percibió un mayor peligro en la capacidad de reflexión autónoma y de crítica de los hombres de letras, que en las renovaciones radicales de los artistas. Numerosos trabajos de conjunto realizados por él han perseguido una historia global: Los fundamentos del mundo moderno; Florencia en la época de los Medicis; La formación del mundo moderno; El Renacimiento; el primero de ellos estaba firmado con un historiador de su misma generación, R. Romano, estudioso de las relaciones comerciales en la época moderna en Europa y en la América española. Tenenti ha publicado monografías (Venezia e i corsari, 1961, colecciones de artículos (Credence, ideologie, libertinismi tra medioevo ed eta moderna, 1978; Stato: un'idea, una logica. Dal comune italiano all'assolutismo francese, 1987 y editado a clásicos como Il libri della famiglia de L. B. Alberti, 1969. Es también especialista en temas económicos, como el del

  18. Puentes con vigas pretensadas

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1965-07-01

    Full Text Available This paper describes one of the three bridges which Hidrocivil, S. A., has built in Catalonia (northern Spain, over the river Ripoll. The other two bridges are very similar to this one, both in construction and design, and show only minor adjustments to the local topography. The contracting firm proposed several alterations in the prefabrication and constructional procedure, in relation to the initial project, and these changes were accepted. The main feature of these projects is the use of prestressed beams, built at the workshop in sections, and joined together by means of sixty 7 mm cables in each beam. As the shear forces are more acute at the joints, the end of each section has a kind of diaphragm, to provide a large contact area, and hence greater surface to transmit the shear forces. The methods of construction are also of interest. Briefly, they involve building the bridge piles, and use these to support a provisional structure with transversal movement. This provisional structure, in turn, served as platform for two bridge cranes, which lifted the girders to their final location. After the first span was completed, the deck was concreted and the auxiliary structure pushed forward to the next span, to repeat the same operations. This arrangement saved the use of provisional framework.En este trabajo se describe uno de los tres puentes que Hidrocivil, S. A., ha construido.—previo concurso— en la región catalana; concretamente, el que salva el río Ripoll. Los otros dos no han sido objeto de descripción general por ser muy similares, en lo que a ejecución y concepción se refiere, con la única variante que presentan las características topográficas locales. La empresa propuso ciertas variantes— que fueron aceptadas— en la prefabricación y métodos de construcción. El interés de estas obras se centra en el empleo de vigas pretensadas, prefabricadas en taller por trozos, y solidarizados en el mismo mediante las operaciones

  19. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  20. Entrevista con Bernard Vincent.

    Directory of Open Access Journals (Sweden)

    Fernando Colina Pérez

    2006-01-01

    Full Text Available Nacido en París (1941, Bernard Vincent es un historiador de renombre en Europa y América del Sur. Consiguió su agregación universitaria en 1966, y desde sus inicios se centró en la Historia Moderna, particularmente en grupos marginales de la España de los siglos XVI-XVII. Ha residido en nuestro país muchos años. Vincent fue miembro de la sección científica de la Casa de Velázquez inicialmente (1968-1971, algo más tarde director de estudios (1977-1978, y a continuación secretario general (1978-1982 de dicha institución. Asimismo ha encabezado el programa de cooperación francoespañol en ciencias sociales (1993-1996. Por otra parte, ha enseñado en la Universidad de París VII, en varias etapas de su vida; pero, sobre todo, ha pertenecido siempre a centros superiores de investigación: Centre National de la Recherche Scientifique (1976-1978, y a la École des Hautes Études en Sciences Sociales, en donde ha sido director de estudios desde 1988 –era doctor de Estado ya en 1986–, y luego responsable de la Sección de Historia, desde 1996 hasta hoy. Sus colaboraciones con las universidades y centros investigadores españoles han sido constantes hasta el presente. Por añadidura, ha sido miembro del Consejo Nacional de las Universidades en Francia, en lo relativo a la historia moderna y contemporánea (1987-1988, 1992-1995, y es desde hace años miembro de la madrileña Academia de la Historia.

  1. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  2. Calentamiento global con Scratch y escuelas eficientes con Arduino

    OpenAIRE

    Ainzua Cemborain, José Ignacio

    2014-01-01

    Este trabajo final de máster está formado por dos proyectos con metodología de aprendizaje basado en proyectos (ABP). El primero de ellos se realiza en la asignatura de Tecnología y en coordinación con la asignatura de Ciencias Naturales, y el segundo únicamente para Tecnología. En la primera parte del proyecto se analiza la metodología ABP utilizada y se compara con la tradicional. Posteriormente se estudian las tres herramientas utilizadas en este proyecto como son; Scratch, Scratch for...

  3. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    OpenAIRE

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  4. [The record of sensitive nerve action potentials. Interelectrode distance in healthy children].

    Science.gov (United States)

    Arango-Aguilar, Jaime; Fraire-Martínez, María Inés; Sepúlveda-Vildósola, Ana Ana

    2014-01-01

    INTRODUCCIÓN: estudios en adultos muestran que con 3 o 4 cm de distancia entre los electrodos activo y de referencia se obtienen los valores ma´ximos de amplitud y latencia de los potenciales de accio´n nerviosos sensitivos. El objetivo de este estudio fue identificar en niños sanos, las distancia entre los electrodos con la cual los valores de amplitud y latencia pico no difieren significativamente de los obtenidos con la distancia entre los electrodos a la cual se obtienen los valores máximos. ME´TODOS: se colocaron cuatro electrodos de referencia a 1, 2, 3 y 4 cm del electrodo activo. La señal del electrodo activo se registró simultáneamente con un puente físico entre los cuatro canales. Se analizó una muestra de 66 nervios medianos en niños de cinco a nueve años. Los valores máximos de amplitud y latencia se obtuvieron con 4 cm entre los electrodos. Se compararon los valores obtenidos con 4 cm entre los electrodos y con 1, 2 y 3 cm.

  5. con el aborto provocado

    Directory of Open Access Journals (Sweden)

    José Luis Redondo Calderón

    2008-01-01

    Full Text Available Las vacunas de células diploides humanas (WI-38, MRC-5 tienen un origen éticamente objetable, dado que dichas células proceden de abortos provocados. Entre ellas destacan vacunas empleadas contra rubéola, sarampión, parotiditis, rabia, poliomielitis, viruela, hepatitis A, varicela y herpes zóster. Actualmente se encuentran en desarrollo otras vacunas cultivadas en células (293, PER.C6 transformadas mediante virus, procedentes de abortos. Entre ellas hay vacunas contra la gripe, virus respiratorio sincitial, parainfl uenza, HIV, virus del Nilo Occidental, virus Ébola, Marburg y Lassa, hepatitis B y C, glosopeda, encefalitis japonesa, dengue, tuberculosis, carbunco, peste, tétanos y paludismo. También con igual origen se trabaja en la elaboración de anticuerpos monoclonales y otras proteínas, terapia génica y genómica. Existe la tecnología necesaria para producir todo lo descrito sin recurrir a abortos provocados. Debe indicarse en los prospectos de vacunas y otros productos el origen de las células empleadas. Debe facilitarse el acceso a las vacunas existentes no cultivadas en células procedentes de abortos provocados. Debe potenciarse la investigación de opciones en aquellos casos en los que no exista una vacuna no originada en células procedentes de abortos provocados. Debe potenciarse la elaboración de anticuerpos monoclonales y de otras proteínas, así como la terapia génica y la genómica sin recurrir a células procedentes de abortos provocados. No sería consecuente rechazar productos obtenidos a partir de células troncales embrionarias y aceptar los originados en células procedentes de abortos provocados. Se debe evitar que la biotecnología basada en el aborto provocado invada todos los terrenos de la medicina.

  6. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  7. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  8. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  9. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  10. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... COMMISSION ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission (``Commission...''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b)(2) of the..., owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  11. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  12. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  13. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  14. Protocolo de mejora de la accesibilidad a personas con discapacidad auditiva en el medio

    OpenAIRE

    Espínola Jiménez, Antonio

    2014-01-01

    Este trabajo nace con el objetivo de recopilar toda la información y medidas necesarias para alcanzar la plena accesibilidad universal y autonomía para personas con discapacidad auditiva en cualquier espacio. Para ello, se analizan las características del espacio y se verifica toda la normativa existente al respecto. Además, se hace un breve estudio de las características de los diferentes materiales de construcción para comprobar cómo interfiere la acústica del espacio en l...

  15. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  16. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  17. Sensor perfeccionado para la medida de la toxicidad del agua

    OpenAIRE

    Campo García, Francisco Javier del; Mas Gordi, Jordi

    2009-01-01

    La invención se basa en un sensor de medida para la toxidad del agua y consiste en una red de micro-electrodos recubiertos de una membrana y de un biofilm. La red de micro-electrodos puede ser estándar, y es posible su funcionamiento con un único electrodo, aunque ello acarrearía una perdida de sensibilidad. La membrana se usa para evitar la pasivación del electrodo por las bacterias presentes en el agua, y se utilizará en una de las realizaciones posibles "Nafion", aunque también es posible ...

  18. Nanoparticulas basadas en complejos de Fe(II) con transicion de espin: sintesis, caracterizacion y aplicaciones en electronica molecular

    Science.gov (United States)

    Monrabal Capilla, Maria

    sintesis de otro nuevo tipo de nanoparticulas, obtenidas a partir de otro polimero de la misma familia, el [FeO8ZnO2(Htrz)3](BF4). Estas nanoparticulas se sintetizaron con el objetivo de estudiar el efecto de la dilucion del metal en la muestra. Como resultado se obtuvieron nanoparticulas que tambien presentan una estrecha distribucion de tamanos pero en este caso la transicion de espin no es tan abrupta como en los casos anteriores. Aunque sigue presentando un ciclo de histeresis termica bastante ancho y a temperaturas proximas a la temperatura ambiente. En el capitulo 4 se describiran las estrategias que se han seguido para mejorar la estabilidad y afinidad sobre diferentes sustratos de las nanoparticulas sintetizadas en el capitulo 2. Tambien se hablara de los intentos realizados parar depositarlas en superficies y embeberlas en diferentes matrices organicas e inorganicas. En el capitulo 5 presentaremos la obtencion de un interruptor molecular realizado poniendo en contacto nanoparticulas individuales sintetizadas en el capitulo 2, con unos electrodos separados varios nanometros. Este dispositivo exhibe "switching" y efecto memoria a temperaturas proximas a la temperatura ambiente como consecuencia de la biestabilidad intrinseca de las nanoparticulas. Ademas demostraremos que el estado magnetico de estas nanoparticulas puede ser controlado electricamente, ya que la transicion de espin en este nanodispositivo molecular puede ser inducida simplemente aplicando un voltaje, lo que puede ser de gran interes para la electronica molecular.

  19. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  20. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  1. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  2. con mala calidad de vida

    Directory of Open Access Journals (Sweden)

    Agustín Martín-Rodríguez

    2007-01-01

    Full Text Available En este estudio ex post facto se ha analizado si los familiares de pacientes con mala calidad de vida presentan diferencias en las variables clínicas de personalidad y relaciones familiares en función de que el paciente haya estado o no ingresado en una Unidad de Cuidados Intensivos. Seleccionamos dos grupos: 29 familiares de pacientes traumatizados graves transcurridos cuatro años de su ingreso en una UCI de Traumatología y con mala calidad de vida (debido a secuelas físicas y/o psicológicas tras el ingreso, tales como traumatismos craneoencefálicos, politraumatismos y tetraplejias traumáticas y 32 familiares de pacientes con mala calidad de vida con cuatro años de evolución de su enfermedad física (hipertensión, diabetes, artritis reumatoide y síndrome de intestino irritable que no han estado ingresados en la UCI. Para alcanzar nuestro objetivo empleamos una Encuesta Psicosocial y los siguientes instrumentos: Cuestionario de Análisis Clínico, Escala de Clima Social en la Familia y Escala de Adaptación Psicosocial de la Enfermedad. Los resultados mostraron que los familiares de pacientes con mala calidad de vida que estuvieron ingresados en la UCI hace cuatro años, presentan diferencias significativas en las variables agitación y expresividad comparados con los familiares de pacientes con mala calidad de vida que no han estado ingresados en la UCI.

  3. Study of pressing effects and variation in Pt charge in the anode on the performance of membrane electrode assemblies; Estudio de los efectos de prensado y variacion de la carga de Pt en el anodo en el rendimiento de ensambles membrana-electrodo

    Energy Technology Data Exchange (ETDEWEB)

    Albarran S, Irma Lorena; Flores Hernandez, J. Roberto; Cano Castillo, Ulises [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico). E-mail: ilas@iie.org.mx; Loyola, Felix (UNAM, Facultad de Quimica, Mexico D.F. (Mexico)

    2009-09-15

    Fabricating membrane electrode assemblies (MEA) involves different variables that determine their performance, such as: amount of the catalyst, concentration of the different solvents used in the fabrication of the catalyst dye, use of a thermomechanical process to increase the degree of adhesion between the catalyst layers and the membrane, etc. This work studied the effect of the Pt charge in the anode on performance, as well as the effect of the thermomechanical process on the fabrication of MEAs. It is evident that the optimal Pt charge should be that which provides good performance during an acceptable useful lifetime at a competitive cost. This work presents the results obtained by varying the Pt charge in the anode between 1.0 and 0.4 mgPt/cm{sup ²} while maintaining a constant charge of 1 mgPt/cm{sup ²} in the cathode. It also shows the comparison between the polarization curves and the active areas obtained in the MEAs with and without pressing during their fabrication. [Spanish] En la fabricacion de los Ensambles Membrana-Electrodo (MEA's) intervienen diferentes variables que determinan su desempeno, como lo son: cantidad de catalizador, concentracion de los diferentes solventes que se emplean en la fabricacion de la tinta catalitica, el uso de un proceso termomecanico para incrementar el grado de adherencia entre las capas cataliticas y la membrana, etc. De las variables anteriormente mencionadas, en este trabajo se estudio el efecto de la carga anodica de Pt en el desempeno, asi como del proceso termomecanico en la fabricacion de MEA's. Es evidente que la carga optima de Pt debe ser aquella que proporcione un buen rendimiento por un periodo de vida util aceptable a un costo competitivo. En este trabajo se presentan los resultados obtenidos al variar la carga de Pt en el anodo entre 1.0 a 0.4 mgPt/cm{sup ²} manteniendo una carga constante de 1 mgPt/cm{sup ²} en el catodo. Tambien se muestra la comparacion de las curvas de polarizacion y las

  4. Encuentro con el tiempo: Adagio con variaciones de Alfredo Aracil

    Directory of Open Access Journals (Sweden)

    Rosa María Rodríguez Hernández

    2012-01-01

    Full Text Available Examinando analíticamente la obra sinfónica Adagio con variaciones de Aracil, estudiaremos los principales componentes para concluir con una evaluación de los mismos. A través de la cronología de la obra de Aracil175, observamos la importancia que adquiere en su trayectoria la memoria; su pensamiento va siempre unido a ésta. Uno de sus recursos principales es la cita; es Adagio con variaciones donde claramente observaremos la memoria lejana e inmediata al tiempo: Wagner es el punto de referencia al pasado, Wolf impulsa hacia el presente, y, Aracil advierte el devenir en cada una de sus variaciones.

  5. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  6. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  7. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  8. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  9. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  10. Utilizando las Matemáticas para resolver problemas de Acústica de Salas

    Directory of Open Access Journals (Sweden)

    Anna Vidal Meló

    2014-03-01

    Full Text Available En este artículo se muestra cómo un alumno puede abordar problemas de acústica de salas ya en primer curso de Grado, con el soporte de las asignaturas de Matemáticas. De este modo, el alumno, encuentra una aplicabilidad directa de los conociminetos adquiridos en asignaturas en asignaturas de Matemáticas en su futuro entorno laboral. Este proyecto se ubica en el Grado de Ingenieria de Sistemas de Telecomunicación, Sonido e Imagn de la Escula Politécnica Superior de Gandia de la Universidad Politécnica de Valéncia.

  11. Utilizando las Matemáticas para resolver problemas de Acústica de Salas

    OpenAIRE

    Anna Vidal Meló; Romina del Rey Tormos; Almanzor Sapena Piera; Bernardino Roig Sala; Vicente Domingo Estruch Fuster; Franciso José Boigues Planes; Jesus Alba Fernández

    2014-01-01

    En este artículo se muestra cómo un alumno puede abordar problemas de acústica de salas ya en primer curso de Grado, con el soporte de las asignaturas de Matemáticas. De este modo, el alumno, encuentra una aplicabilidad directa de los conociminetos adquiridos en asignaturas en asignaturas de Matemáticas en su futuro entorno laboral. Este proyecto se ubica en el Grado de Ingenieria de Sistemas de Telecomunicación, Sonido e Imagn de la Escula Politécnica Superior de Gandia de la Universidad Pol...

  12. Entrevista con Hans Robert Jauss.

    Directory of Open Access Journals (Sweden)

    - Consejo de Redacción

    1997-01-01

    Full Text Available El importante teórico y crítico literario alemán nació en 1921. Tras el largo paréntesis de la segunda guerra mundial, Jauss realizará sus estudios superiores, a partir de 1948, en Heidelberg, licenciándose en filología románica. Se doctora pronto con una tesis, publicada en 1955, sobre el tiempo y el recuerdo en la obra capital de Marcel Proust, En busca del tiempo perdido, y se habilita en 1957 con un trabajo sobre la epopeya animal en la Edad Media. A continuación, escribe un conjunto de estudios sobre la alegoría, y codirige con el gran especialista Erich Kohler una monumental historia de la literatura medieval, campo al que ha dedicado otros artículos, a la par que proseguía sus investigaciones iniciales.

  13. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  14. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  15. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  16. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  17. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  18. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  19. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  20. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  1. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  2. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  3. Tratamiento con implantes Leader-Nano en paciente con oligodoncia

    Directory of Open Access Journals (Sweden)

    Salvador Javier Santos Medina

    2015-03-01

    Full Text Available Los implantes dentales de titanio han revolucionado el mundo de la rehabilitación desde su surgimiento. De manera particular, el empleo de implantes de carga inmediata acorta el tiempo quirúrgico y protésico, con el consiguiente bienestar estético. Se presenta el caso de una paciente femenina de 32 años de edad, con antecedentes de oligodoncia de ambos incisivos laterales superiores y portadora de prótesis parcial acrílica. Fue atendida por el equipo multidisciplinario de implantes en la Clínica Estomatológica Docente “3 de Octubre” y se le realizó tratamiento de rehabilitación integral con implantes Leader-Nano y prótesis fija con corona acrílica sobre dichos implantes. La implantología fue satisfactoria en la paciente; la mejoría estética y funcional, así como la satisfacción de la paciente, fueron los principales logros obtenidos

  4. Carlstad Comic Con : En fallstudie

    OpenAIRE

    Fors, Marcus Gabriel

    2013-01-01

    This is a case study of Carlstad Comic Con 2011 and 2012.The purpose is to study the event in relation to a project management and a local culture policy perspective. This in order to analyze the organization of a popular culture event and see how such a local event may benefit Karlstad as a city. Besides studying the organization of Carlstad Comic Con and its outcomes I am sketching a short cultural history of popular culture media and its context within recent year’s globalization.The study...

  5. con dietas suplementadas con Cromo-L-metionina

    Directory of Open Access Journals (Sweden)

    Ram\\u00F3n Garc\\u00EDa-Castillo

    2006-01-01

    Full Text Available Un total de 48 cerdos (Sus scrofa domesticus; 24 machos castrados y 24 hembras cruzados (Yorkshire, Hampshire, Duroc y Landrace de 3,5 a 4,0 meses de edad y 60,0 ± 5,0 kg PV en finalización. Se alimentaron con dietas isoproteícas (14,5 % PC e isoenergéticas (3.400 kcal EM/kg de MS, adicionadas con Cr-L-metionina (MiCroPlex® (0, 200, 400 y 600 ppb. El experimento tuvo una duración de 45 días y se realizó de agosto a noviembre del 2002 en las instalaciones de la Universidad Autónoma Agraria Antonio Narro, localizada en Saltillo, Coahuila, México. Al tener los animales aproximadamente 95 kg PV, se tomó muestra de 15 ml de sangre por cada animal para determinar la concentración de glucosa, ácido úrico, creatinina, urea, proteinas totales y colesterol. Se aplicó un diseño completamente al azar con arreglo factorial 2 x 4; dos para el factor sexo y cuatro para nivel de cromo. Los metabolitos en suero no fueron afectados (P>0,05 por el factor sexo. La glucosa en suero disminuyó (P<0,05 y el colesterol incrementó (P<0,05 con cromo en la dieta. Se concluye que el Cr incrementa el metabolismo de glucosa y disminuye el de colesterol, con lo cual puede haber energía disponible para síntesis de proteína la cual es necesaria para el crecimiento de los animales

  6. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  7. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  8. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  9. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  10. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    OpenAIRE

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  11. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  12. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  13. A new class of hybrid AC/AC direct power converters

    OpenAIRE

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  14. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    OpenAIRE

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  15. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  16. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  17. Juegos con monedas y palillos

    OpenAIRE

    Cobarro, Trinidad

    1993-01-01

    Es frecuente entre nosotros, los que nos dedicamos a la enseñanza de las matemáticas por muy grande que sea nuestro amor por la materia y el deseo de comunicación, nos encontrarnos con un problema: ¿cómo mantener interesados a los alumnos?

  18. La atención a los padres con hijos con necesidades educativas especiales (NEE)

    OpenAIRE

    Claudia María Pernas Pico

    2011-01-01

    Los padres que tienen hijos con necesidades educativas especiales (NEE) necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, et...

  19. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  20. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an...

  1. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  2. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  3. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  4. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  5. Entropy production in ac-calorimetry

    OpenAIRE

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  6. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  7. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  8. Electrodos para supercondensadores obtenidos por electrodeposición

    OpenAIRE

    Aldama Amado, Iván

    2015-01-01

    Tesis doctoral inédita leída en la Universidad Autónoma de Madrid, Facultad de Ciencias, Departamento de Química Inorgánica. Fecha de lectura: 17-11-2015 Los supercondensadores son dispositivos de almacenamiento de energía que tienen alta densidad de potencia (hasta 10 kW/kg), tiempos cortos de carga y descarga (1-30 s) y alta ciclabilidad (1 000 000 de ciclos de carga/descarga). La principal desventaja es la baja densidad de energía (hasta 5 Wh/Kg), muy inferior a la densidad de ...

  9. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  10. Literatura con mayúsculas

    Directory of Open Access Journals (Sweden)

    Cerrillo, P.

    2006-11-01

    Full Text Available En este trabajo se presenta un acercamiento alconcepto de la Literatura Infantil y Juvenil a travésde una breve visión diacrítica desde sus orígeneshasta nuestros días, subrayando los usos particularesmás característicos de esta literatura en cadaépoca (didáctico, doctrinal, proselitista…. Ademásde señalar sus coincidencias con la Literatura engeneral, se pone también de relieve sus particularidadesy características específicas, en lo que noes sino un nuevo intento de delimitar la caracterizaciónde la LIJ (contenidos, temática, estructuraliteraria, forma, ediciones… y reivindicar estaLiteratura con mayúsculas.

  11. Alumnos con necesidades educativas especiales

    OpenAIRE

    Álvarez Pérez, Luis

    1995-01-01

    El objetivo de este trabajo es delimitar el concepto de alumno con necesidades educativas especiales y determinar como se tiene que abordar su educación en el marco del proyecto educativo de centro. Además se pretende establecer un modelo operativo para consignar las adaptaciones curriculares que sea preciso adoptar en función de las orientaciones establecidas en la evaluación previa

  12. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  13. con bajo peso al nacer

    Directory of Open Access Journals (Sweden)

    Adriana Mora Antó

    2005-01-01

    Full Text Available Esta investigación dio cuenta de la relación entre el estilo de funcionamiento familiar, los patrones de crianza y las edades de desarrollo evolutivo en niños, nacidos con bajo peso. El estudio descriptivo correlacional se realizó con 41 niños y sus madres, aplicándose cuestionarios sobre funcionamiento familiar, prácticas de crianza y desarrollo infantil. Los resultados señalaron la existencia de un funcionamiento familiar caracterizado por una cohesión amalgamada y una adaptabilidad caótica, una disciplina complaciente, falta de control y de límites claros en la díada madre-hijo. Se trataba de familias monoparentales, donde la temprana edad de concepción, el madresolterismo y el apoyo de la familia extensa eran constantes. Las edades evolutivas registradas indicaron un desarrollo inferior a la edad cronológica, en la mayor parte de los casos; sin embargo, éstas tendieron a ser superiores al compararlas con la edades reales de los infantes. No se encontró una correlación estadísticamente significativa entre la edad de desarrollo y los diferentes factores del funcionamiento familiar para algunos de los rangos de edad considerados; sin embargo, no se lo descartó por completo, especialmente en lo referente al optimismo familiar

  14. pacientes con insuficiencia renal terminal

    Directory of Open Access Journals (Sweden)

    Karen Herrera Herrera

    2011-01-01

    Full Text Available La presente investigación fundamenta en la clínica psicoanalítica el estudio de dos casos de tres personas diagnosticadas con IRT que reciben tratamiento de hemodiálisis, en razón a que dadas las características y el aumento de los reportes que se presentan, ya esto se considera un problema de salud pública. El objetivo principal es describir las características dinámicas del proceso de duelo en pacientes con IRT en un centro de terapia renal de la ciudad de Cartagena. El procedimiento metodológico empleó un diseño de tipo cualitativo; la investigación se desarrolló con un diseño clínico mediante el estudio de casos, y fundamentada en la hermenéutica psicoanalítica. Todo esto respaldado en la historia clínica, la entrevista semiestructurada individual y familiar, los test proyectivos, test del dibujo de la figura humana Machover y TAT de Murray, para la debida integración de los análisis. Se concluye que predominan funciones fallidas de los progenitores y que son individuos provenientes de familias psicosomáticas, que utilizan la enfermedad para obtener un beneficio secundario.

  15. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  16. Frecuencia de anticuerpos contra el virus C de la hepatitis en pacientes con cirrosis hepática en Yucatán, México

    Directory of Open Access Journals (Sweden)

    Góngora-Biachi Renán A

    2003-01-01

    Full Text Available OBJETIVO: En este estudio reportamos la prevalencia de anticuerpos contra el virus C de la hepatitis (Ac-VCH en un grupo de pacientes con cirrosis hepática (CH. MATERIAL Y MÉTODOS: Se hizo un estudio prospectivo, transversal y descriptivo, de marzo de 1998 a mayo de 1999. Se estudiaron a 153 pacientes (117 (76% hombres y 36 (24% mujeres con diagnóstico de CH, que eran atendidos en el Hospital General Agustín O' Horan y en el Centro de Investigaciones Regionales Doctor Hideyo Noguchi, en la ciudad de Mérida, Yucatán, México. Se aplicó un cuestionario con datos clínico-epidemiológicos y se determinó la presencia de Ac-VCH (ELISA de 2ª generación y RIBA-2 para confirmar el diagnóstico a cada paciente. Se determinó también el antígeno de superficie de la hepatitis B (AgsHB y anticuerpos contra el antígeno central de la hepatitis B (Anti-HBc mediante el método de ELISA. La presencia de Ac-VCH fue relacionada con las variables epidemiológicas de los sujetos. La prevalencia de anti-HCV y la frecuencia de características se compararon entre los pacientes positivos y negativos con las pruebas de c² y exacta de Fisher. RESULTADOS: El 32% de los pacientes con CH (35/117 (30% hombres y 14/36 (39% mujeres fueron positivos para los Ac-VCH. El alcoholismo estuvo presente en todos los hombres serorreactivos y en ninguna de las mujeres positivas (p< 0.001. Ninguna de las variables epidemiológicas analizadas estuvo asociada con la seropositividad. Los anti-HBc se encontraron en 16% de los pacientes positivos para Ac-VCH y en 12% de los seronegativos (p=0.69. CONCLUSIONES: La prevalencia encontrada fue mayor a los reportes previos realizados en población general de la Península de Yucatán (1.3%. La alta prevalencia de Ac-VCH en este grupo de pacientes sugiere que la CH está más frecuentemente asociada con el VCH en Yucatán, México, que con el virus B de la hepatitis. El alcoholismo probablemente actúa como un cofactor en el

  17. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  18. Density-functional calculations of Con+,Con, Con- (n≤5) clusters%Con+,Con,Con -(n≤5)团簇的密度泛函理论研究

    Institute of Scientific and Technical Information of China (English)

    张蓓; 陈楚; 张军

    2011-01-01

    The geometrical and electronic structures of Con+ ,Con,Con- (n≤5) clusters had been investigated using spin-polarized DFT calculations. The ground-state structures of Con+ ,Con,Con- (n≤5) clusters evoluted from one-dimension to three dimensional configurations. The total magnetic moment showed monotonic increase with size up to 5, which alternated with odd and even numbers. The interaction strengths between Con+-1(n≤5) cluster and Co atom were much more stronger. The electronic affinities (EA)and ionization potential (IP)also had been discussed in this work.%本文采用基于自旋极化的密度泛函理论系统研究了Con+,Con,Con- (n≤5)团簇的几何结构和电子结构特性.随尺寸的递增,Con,Con± (n≤5)团簇的基态几何结构由一维演变为三维的几何构型.总磁矩随尺寸的增加线性递增,并呈现奇偶交替的现象,从Con,Con±(n≤5)团簇系统中分离一个Co原子带正电的团簇体系需要的能量相对较大.本文对体系的电子亲和能(EA)以及离化势(IP)也进行了讨论.

  19. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled......-second average at its output, while simultaneously achieving inductive voltage boosting by shooting through either an appropriately selected inverter phase-leg or two phase-legs being commanded simultaneously. More interestingly, these performance features are achieved with no increase in the number...

  20. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    OpenAIRE

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  1. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  2. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  3. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  4. Transgenic tobacco plants expressing synthetic Cry1Ac and Cry1le genes are more toxic to cotton bollworm than those containing one gene

    Institute of Scientific and Technical Information of China (English)

    LIAN Yun; JIA ZhiWei; HE KangLai; LIU YunJun; SONG FuPing; WANG BaoMin; WANG GuoYing

    2008-01-01

    Transgenic tobacco plants carrying Cry1Ac, Crylle or both genes were obtained. In the leaves of transgenic plants carrying both genes, the contents of CrylAc and Cry1le proteins were 0.173% and 0.131% of the total proteins, respectively, Cry1Ac protein content was 0.182 % and Cry1le protein con-tent was 0.124% of the total proteins in the leaves of transgenic plants containing only one Bt gone. Fresh leaves of transgenic tobacco and wild-type plants were used for the insect bioassay against wild-type and Cry1Ac-resistant cotton bollworm (Helicoverpa armigera). The bioassay results showed that transgenic plants carrying both genes were significantly more toxic to wild-type and Cry1Ac-resistant cotton bollworm than those carrying Cry1Ac or Cry1le alone. This study indicates that the higher toxicity of transgenic tobacco plants carrying both genes is caused by the cooperative function of both Bt proteins, thus providing a potential way to delay the development of insect resis-tance to transgenic crops.

  5. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  6. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  7. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  8. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  9. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  10. RASGOS DE PERSONALIDAD EN PACIENTES CON OBESIDAD

    Directory of Open Access Journals (Sweden)

    Alejandra Bravo Del Toro

    2011-01-01

    Full Text Available El presente estudio analizó los rasgos de personalidad con mayor incidencia en una población mexicana con obesidad. Se distinguieron los rasgos que intervienen en el funcionamiento diario de los sujetos. La muestra estuvo conformada por 60 pacientes: 31 hombres y 29 mujeres, con edades de 30 a 40 años, casados, con nivel educativo básico y que acudían a consulta médica en un centro de diagnóstico clínico, con antecedentes de obesidad. Se utilizó el perfil-inventario de la personalidad de Gordon, según el cual se comprobó que los pacientes con obesidad tienden a mostrar rasgos de personalidad por debajo de la norma. Los análisis demostraron relaciones significativas entre la gente obesa y cada uno de los rasgos de personalidad con menor prevalencia que mide la escala.

  11. Tratamiento del paciente con artrosis

    Directory of Open Access Journals (Sweden)

    Francisco Vargas Negrín

    2014-01-01

    Full Text Available El manejo terapéutico del paciente con artrosis tiene como objetivo disminuir la sintomatología dolorosa e inflamatoria, mejorar la capacidad funcional del paciente y la aplicación de intervenciones terapéuticas eficaces y lo más seguras posibles. Un enfoque centrado en el paciente implica su participación activa en el diseño del plan terapéutico y en la toma de decisiones informadas oportunas en todas las etapas de la enfermedad. La educación terapéutica, la actividad física y el ejercicio terapéutico junto con el control de peso, en caso de sobrepeso u obesidad, constituyen el núcleo central del tratamiento. Los autocuidados individuales y por los familiares son fundamentales en el control del día a día del paciente. El uso de terapias físicas, ayudas técnicas (bastón, etc. y de fármacos tipo analgésicos simples, opioides y antiinflamatorios tiene evidencias demostradas en el control del dolor, mejora la funcionalidad y la calidad de vida del paciente y una clara recomendación de uso en el tratamiento de la artrosis. La cirugía conservadora y la de reemplazo articular se indican en los casos en los que no se logran los objetivos terapéuticos en casos concretos.

  12. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  13. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  14. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  15. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  16. Rice bran supplementation during nutritional recovery period of malnourished rats improves colon development El suplemento con salvado de arroz durante el periodo de recuperación nutricional de ratas malnutridas mejora con el desarrollo del colon

    Directory of Open Access Journals (Sweden)

    M.ª Salete F. Martins

    2007-12-01

    Full Text Available Objective: To investigate the colon's development in rats subjected to protein energy malnutrition followed bysupplementation with rice bran. Materials and methods: Weaned Wistar male rats (21 days old, weight (40-50 g were divided into two groups: diet with 17% protein (C; control group or an aproteic diet (A; aproteic group, for 12 days. After this, 50% of the rats from each group were sacrificed. The remaining rats were further distributed in the three groups for a recovery (21 days: control (C continued to receive the control diet whereas the aproteic group (A received either a control diet (AC or a control diet supplementedwith 5% of rice bran (ARB. Results: The A group showed alterations in the colon and cecum, excreted dry feces mass and fecal nitrogen, compared with C rats. In the proximal colon of A rats, the external muscularis and the width of the colon wall were higher whereas in the distal colon they were lower than C. After the recovery period, the relative cecum mass, colon mass and colon length of the recovered groups (AC and ARB were higher than in the C group. Dry feces and fecal nitrogen excreted of the rats from recovered groups were lower than C group. Colon length of the AC group was lower than in the C group. Only the crypt's depthfrom ARB group was higher than in the C group. Conclusion: Control diet supplemented with 5% rice bran, reestablished the large intestine of aproteic rats. The recovery in the ARB group was even better than in the AC rats.Objetivo: investigar el desarrollo del colon en ratas sometidas a malnutrición proteico-calórica seguida de complementación con salvado de arroz. Material y métodos: se emplearon ratas Wistar macho destetadas (de 21 días de edad, peso (40-50 g que se dividieron en dos grupos: dieta con 17% de proteínas (C, grupo control y dieta aproteica (A, grupo aproteico, durante 12 días. Tras ello, se sacrificó al 50% de las ratas de cada grupo. A las ratas restantes se las dividi

  17. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...

  18. Estudio acústico del Conservatorio de Piles

    OpenAIRE

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  19. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V.

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  20. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  1. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  2. Disfonías espasmódicas: estudios acústicos

    Directory of Open Access Journals (Sweden)

    Liliana Sigal

    2013-06-01

    Full Text Available La disfonía espasmódica es un desorden vocal severo caracterizado por una interrupción involuntaria de la fonación, denominada también distonía focal laríngea. En este estudio se presentan los resultados de una investigación sobre las características acústico-vocales de una población de pacientes con disfonías espasmódicas, y la comparación de las mismas con las de un grupo control (sujetos con el diagnóstico otorrinolaringológico de cuerdas vocales móviles, sin daños estructurales en la mucosa glótica, ni alteraciones neurológicas que involucren la dinámica cordal. Se analizó acústicamente la vocal /a/ investigándose: valor de la frecuencia fundamental, desviación estándar, rango diferencial entre frecuencia máxima y mínima, y número de quiebres fonatorios. Se utilizó para estas mediciones el Sistema de análisis acústico Praat (Boersma y Weenink, 2003. En los resultados no se encontraron diferencias significativas entre las medias de la Frecuencia Fundamental entre ambos grupos estudiados.La comparación de los promedios del desvío estándar de la Frecuencia Fundamental arrojó sin embargo diferencias significativas, así como la comparación de los promedios de los rangos entre frecuenciamáxima y mínima. Respecto a la variable Quiebres Fonatorios, se calcularon solamente en el grupo de pacientes ya que ninguno de los sujetos del grupo control presentó interrupciones fonatorias en la emisión de la vocal. Cabe concluirse que la desviación estándar, el rango entre el valor máximo y mínimo de frecuencia fundamental y el número de interrupciones durante la emisión de vocal prolongada pueden utilizarse como indicadores de disfonía espasmódica.

  3. Un tema con muchas variaciones

    Directory of Open Access Journals (Sweden)

    Bárbara Kepowics Malinowska

    2003-01-01

    Full Text Available Se aborda el tema de ética y valores como uno de los ejes principales de la formación de la identidad de los futuros profesionistas. Se presentan los resultados de una investigación realizada con metodología cualitativa, para conocer la relación entre los valores explícitos en el proyecto universitario y los valores en los estudiantes al culminar su carrera en la Universidad. Entre las principales conclusiones, cabe destacar la heterogeneidad de los valores vividos a través de las prácticas curriculares, una discrepancia significativa entre ellos y los valores declarados en los proyectos y, por consecuencia, una diferencia entre los valores deseables y los asumidos como compromiso personal. Predomina la ética de la conveniencia y hay poca conciencia de la profesión, entendida como un servicio de calidad para la sociedad.

  4. Fare astronomia con piccoli telescopi

    CERN Document Server

    Gainer, Michael K

    2007-01-01

    Non sono necessariamente richiesti strumenti mastodontici per produrre risultati scientificamente validi nel campo dell’astronomia. Anche l’astrofilo dotato di un piccolo telescopio, con un diametro di soli 8-9 cm, può contribuire alla scienza del cielo realizzando utili osservazioni del Sole, della Luna, dei pianeti, delle comete, degli asteroidi, delle stelle doppie o variabili, delle nebulose e degli ammassi stellari. Il manuale di M.K. Gainer spiega quale sia la dotazione minima (un piccolo telescopio, un computer, una semplice fotocamera digitale), come utilizzarla, e quali siano le tecniche appropriate da adottare nelle osservazioni. Offre inoltre schemi per interpretare e ridurre i dati raccolti, nonché schede da compilare e da spedire ai centri di raccolta internazionali. Questo libro è il passaporto grazie al quale l’astrofilo può entrare a pieno titolo nel mondo affascinante della scienza astronomica.

  5. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  6. Resistencia a los cloruros en el concreto adicionado con escoria de alto horno

    OpenAIRE

    Naliett Karina Santamaría Díaz; Luis Eduardo Yamín Lacouture; Carlos Alberto Arcila López

    2006-01-01

    Para evaluar la resistencia a los cloruros en diferentes mezclas de concreto se realizó el ensayo de permeabilidad rápida a cloruros, estipulado en la norma ASTM 1202. Para ello se utilizó un equipo hecho en el país que sigue los requerimientos dados por esta norma. Se ensayaron concretos con 6 diferentes relaciones agua/cementante (a/c) y tres porcentajes de adición de escoria en reemplazo de parte del cemento. Aunque la edad a la que se evaluaron las muestras de concreto fue la misma, tambi...

  7. Enfoque del paciente con intoxicación aguda por plaguicidas organosfoforados

    OpenAIRE

    Hurtado Clavijo, Carlos Mauricio; Gutierrez de Salazar, Myriam

    2014-01-01

    Un gran número de insecticidas organofosforadosse usan en todo el mundo a diario. Lasintoxicaciones ocurren generalmente de formaaccidental por exposición laboral, o intencional,con fines suicidas. Los organofosforados producensus efectos tóxicos a través de la inhibiciónde la acetilcolinesterasa, la enzima responsablede la hidrólisis del neurotransmisoracetilcolina, produciendo ácido acético y colina,productos químicamente inertes. La unión entrelos organofosforados y la acetilcolina es unau...

  8. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  9. La atención a los padres con hijos con necesidades educativas especiales (NEE

    Directory of Open Access Journals (Sweden)

    Claudia María Pernas Pico

    2011-01-01

    Full Text Available Los padres que tienen hijos con necesidades educativas especiales (NEE necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, etc... Siempre desde la empatía y la profesionalidad que debe transmitir el maestro de Audición y Lenguaje. Cambiando la preocupación de los padres por su ocupación.

  10. Obtención de ácido acético a partir de alcohol etílico en un solo paso y en fase vapor

    Directory of Open Access Journals (Sweden)

    Gerardo Rodríguez N.

    2011-01-01

    Full Text Available La obtención de ácido acético a partir de etanol en una sola etapa se estudió sobre un catalizador de paladio, 0.5% en peso de paladio, soportado en alfa-alúmina. Los ensayos se realizaron en un reactor diferencial a temperaturas entre 150 y 300°C y con una relación molar oxígeno/etanol= 1.25.

  11. An ac bridge readout for bolometric detectors

    Science.gov (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  12. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  13. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  14. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  15. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  16. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  17. Tratamiento conservador en pacientes con retinoblastoma bilateral

    OpenAIRE

    Juan C. Suárez; Mabel C. Ospina; Sandra A. Arias; González, María E

    2008-01-01

    OBJETIVO: comparar el tratamiento convencional del retinoblastoma bilateral, usado hasta hace algunos años, consistente en radioterapia o enucleación bilateral, con el tratamiento conservador actual que incluye termoterapia transpupilar (TTT) o TTT/quimioterapia al menos en un ojo, en niños con diagnóstico de retinoblastoma bilateral. DISEÑO: estudio retrospectivo descriptivo. MUESTRA: 20 pacientes con diagnóstico de retinoblastoma bilateral que consultaron al Hospital Universitario San Vicen...

  18. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  19. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . With the proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion system...

  20. Depresion en pacientes con alteraciones del tiroides

    OpenAIRE

    Ljiljana Radanovic-Grguric´; Pavo Filakovic´; Jelena Barkic´; Nikola Mandic´; Ivan Karner; Juraj Smoje

    2003-01-01

    Nuestro estudio fue realizado en un grupo de 53 mujeres con disfunción tiroidea y 28 mujeres con depresión mayor. Empleamos la Escala de la Depresión de Hamilton, la Escala de Autoevaluación de la Depresión de Zung y la Escala sobre la Impresión Clínica Global. Los resultados del estudio demuestran que la mayoría de los pacientes con disfunción tiroidea se mostraron clínicamente significativos en cuanto al trastorno depresivo. Los episodios depresivos son más frecuentes en pacientes con hipot...

  1. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  2. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  3. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  4. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  5. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%), for kidneys 20 ± 1% (19...

  6. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  7. AC loss in large-scale superconducting cables

    NARCIS (Netherlands)

    Mulder, G.B.J.

    1993-01-01

    A review is given of recent work on ac losses, carried out at our institute. The emphasis is on large-scale conductors for fusion applications, such as the `cable-in-conduit¿ prototype conductors to be used for NET. Calculation methods for the ac losses are presented together with some experimental

  8. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  9. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  10. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems

    Science.gov (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François

    2016-09-01

    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  11. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  12. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  13. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  14. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  15. Control del convertidor boost DC-AC por moldeo de energía

    OpenAIRE

    Albea-Sanchez, Carolina; Gordillo, Francisco

    2006-01-01

    National audience En este artículo se aplica a un convertidor boost dc-ac no lineal una estrategia de control para la generación de corriente alterna sin emplear señal de referencia alguna. Como la técnica propuesta no alcanza la sincronización deseada entre las dos partes del circuito, se añade un Phase-Locked Loop a la ley de control. Se muestra además que esta idea es válida para la sincronización con la red. Mediante simulación se comprueba la bondad de las leyes de control resultantes...

  16. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Science.gov (United States)

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  17. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  18. Caracterización e inmunoreactividad de la proteína acídica Ribosomal P2ß de L. (V. braziliensis

    Directory of Open Access Journals (Sweden)

    Carlos Padilla R

    2003-04-01

    Full Text Available Introducción: El diagnóstico serológico de la leishmaniasis usando proteínas totales presenta reacciones cruzadas. La caracterización de nuevos antígenos de Leishmania mejorará el uso de herramientas serológicas en el diagnóstico de esta enfermedad. Objetivo: Caracterizar un nuevo antígeno de Leishmania. Materiales y métodos: Se seleccionó el bacteriófago T166-U19 de una biblioteca de cADN de L. (V. braziliensis el cual es reactivo a mezclas de sueros de leishmaniasis cutánea y mucocutánea. El cADN del clon T166-U19 fue subclonado en el plásmido pGEX, luego secuenciado y la proteína recombinante fue expresada. La reactividad de esta proteína recombinante se evaluó por ELISA. Resultados: El cADN del clon T166- U19 presentó un marco de lectura abierto de 318 pb que traduce una proteína de 105 aminoácidos con 81,1%, 82,9% y 60,7% de identidad total con la proteína acídica ribosomal LiP de L. (L. infantum, P2 de L. (L. donovani, y P2 de T. cruzi, respectivamente. Además, la proteína recombinante presentó baja reactividad (50% con sueros de pacientes con leishmaniosis, mientras que presentó reactividad cruzada con sueros de pacientes chagásicos. Conclusiones: Se caracterizó por primera vez la proteína acídica ribosomal P2B de L. (V. braziliensis, y presentando baja reactividad con sueros de pacientes con leishmaniasis.

  19. Itinerari Musicali con la Wiild

    Directory of Open Access Journals (Sweden)

    Elisabetta Nanni

    2013-03-01

    Full Text Available La Wiild, acronimo di Wiimote Lavagna Digitale, è uno strumento didattico che utilizza il telecomando della Wii, il famoso gioco della Nintendo, insieme a un software libero, rendendolo così estremamente versatile. Non vincolato a software proprietario, il suo utilizzo è legato alla capacità dell’insegnante di ripartire dalla didattica, dalle risorse selezionate e dall’epistemologia di ogni singola disciplina, trovando così nel proprio contesto un ruolo per le tecnologie. Il contributo presenta ipotesi di lavoro per l’educazione musicale nella scuola secondaria di primo grado che si sviluppano sia attraverso lo studio del rapporto suono/segno con affinità pittoriche e successiva codificazione grafica, sia attraverso un’attività di laboratorio in cui co-costruire percorsi storico-musicali. La Wiild diventerà davvero utile ed efficace nel momento in cui, affiancando le risorse selezionate dal docente, verrà utilizzata senza essere notata, giocando un ruolo di strumento tecnologico «normale e trasparente».

  20. Adiciones y cementos con adiciones

    Directory of Open Access Journals (Sweden)

    Calleja, José

    1983-09-01

    Full Text Available The present paper deals with aspects concerning the conditions to be fulfilled by raw materials and manufacturing process of cements containing components other than clinker and setting regulator. It deals also with proper conditions for the utilization of these cements, as well as with the knowledge of the interrelation between manufacture and use of them, in order to aid the manufacturers and the users in the better profit o such energy saving blended cements in optimal technical and economical conditions.

    Se tratan en este trabajo aspectos relativos a las condiciones exigibles a las materias primas y a los procesos de fabricación de los cementos que contienen constituyentes distintos del clínker y del yeso. Se tienen también en cuenta las condiciones adecuadas para utilizar estos cementos, así como el conocimiento de las relaciones entre la fabricación y el empleo de los cementos con constituyentes secundarios que ahorran energía, a fin de ayudar a fabricantes y usuarios en su mejor aprovechamiento en condiciones técnicas y económicas óptimas.

  1. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  2. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel

    2000-01-01

    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  3. La palatalización de las velares. Análisis acústico

    Directory of Open Access Journals (Sweden)

    Mónica Tapia-Ladino

    1997-09-01

    Full Text Available Uno de los rasgos más característicos del español de Chile es el alto grado de palatalización de las consonantes velares cuando van seguidas de yod o de vocal anterior. Este fenómeno articulatorio se manifiesta acústicamente como una elevación de la frecuencia de ruido de fricción en el caso de la áfona fricativa. Mediante un análisis acústico se ha medido la duración y la frecuencia del ruido en las realizaciones de /x/ extraídas de una muestra del habla de la televisión con el propósito de examinar en qué medida este rasgo aparece en esa variedad de habla. Las mismas mediciones se han efectuado en el habla de los locutores de la televisión española con el fin de efectuar una comparación. (One of the most salient features of Chilean Spanish is the high degree of velar consonant palatalization when followed by yod or a frontal vowel. The acoustic correlate of this articulatory phenomenon is the frequency increase of friction noise in the case of the voiceless fricative. The realizations of /x/ in a sample of Chilean television speech have been measured acoustically, focusing on the duration and frequency noise. The aim was to find out to what extent palatalization appears in that speech variety. For comparative purposes, the same measures have been made in the speech of Spanish television.

  4. Cefalea cervicogénica: Tratamiento con estimulación eléctrica subcutánea periférica C1-C2-C3 Cervicogenic headache: Treatment with peripheral C1-C2-C3 subcutaneous electrostimulation

    Directory of Open Access Journals (Sweden)

    M. D. Rodrigo

    2005-09-01

    Full Text Available Introducción: Presentamos siete pacientes con dolor cervicogénico (C1-C2-C3 de larga evolución, persitente, severo, no controlado, de diferentes etiologías, en los que se habían agotado otras posibilidades terapéuticas, tratados con una técnica de estimulación eléctrica extraespinal periférica occipital (C1-C2-C3, mediante implante quirúrgico de electrodo cérvico-occipital uni- o bilateral. Material y método: Se trata de siete pacientes, mujeres, edad media de 50,5 años, con los siguientes diagnósticos: en 3 pacientes cefalea cervicogénica (migraña transformada; otros dos casos se tratan de un síndrome de dolor regional complejo, uno localizado cervical tipo 2 post-siringomielia C2-D1 + malformación de Arnold Chiari + cirugía y en otro de hemicara/cuello/occipital y EESS izqda. postcirugía de carótida; un caso de neuralgia postherpética C1-C2-C3 izquierda; y otro caso de cefalea cervicogénica secundaria a artrosis. Resultados: En todos los casos se ha obtenido un buen resultado analgésico. En la mayoría de las pacientes ha desaparecido el dolor continuo, ha disminuido el número de crisis y su severidad. Se ha normalizado su actividad física, y tres pacientes se han reincorporado al trabajo. El descanso nocturno que era malo en todas ha pasado a ser normal. En dos pacientes se ha retirado el tratamiento farmacológico y en el resto se ha reducido de forma considerable. El tiempo medio de seguimiento es de 16 meses, el máximo en el primer caso es de 33. Las complicaciones han sido en dos ocasiones migración del electrodo, una ocurrió a los 7 días del implante definitivo y en otra paciente después de un año. Discusión: La neuromodulación mediada por la estimulación eléctrica invasiva ha demostrado su utilidad terapéutica a lo largo de los últimos años, en pacientes con dolor neuropático refractario e intratable. Los avances recientes en neuroestimulación han permitido ampliar sus posibilidades terap

  5. Produtividade das culturas de alface e rabanete em função da época de estabelecimento do consórcio

    Directory of Open Access Journals (Sweden)

    Cecilio Filho Arthur Bernardes

    2002-01-01

    Full Text Available Avaliou-se a produtividade das culturas de rabanete e alface, e a qualidade de seus produtos, em função da época de estabelecimento do consórcio, na UNESP em Jaboticabal, de março a maio de 1999. Os tratamentos foram constituídos por consórcios estabelecidos aos 0; 7 e 14 dias após o transplantio (DAT da alface e monocultivos implantados nestas mesmas épocas. As cultivares de rabanete (Raphanus sativus L. e alface (Lactuca sativa L. utilizadas foram, respectivamente, Crimson Gigante e Carolina. Maior altura das plantas de rabanete foi observada quando consorciada com alface. As plantas de rabanete em monocultivo apresentaram acúmulo de massa seca da parte aérea (MSPA 29,4% menor do que em consorciação, independente da época de semeadura. Para massa seca de raízes tuberosas, maior acúmulo foi obtido na presença de alface, independentemente da época de instalação do consórcio. Quanto a MSPA de alface, maior acúmulo ocorreu em consórcio, quando a semeadura do rabanete foi realizada até 7 DAT. Além de menor acúmulo de MSPA, quando a semeadura do rabanete foi realizada aos 14 DAT, a alface apresentou perda na qualidade comercial. O maior valor da razão de área equivalente (1,6 no sistema de consórcio, foi obtido quando o rabanete foi semeado aos 7 dias após o transplantio da alface.

  6. Determination of sulphides in cements by using potentiometry with a selective electrode of sulphides

    Directory of Open Access Journals (Sweden)

    Bernal, José Luis

    1988-03-01

    Full Text Available A procedure for the determination of sulphides attackable by HCI (1 :3 in cements by means of a potentiometric determination with a selective electrodo of sulphides, is proposed.

    Se propone un método para la determinación de sulfuros, basado en el ataque con HCI (1:3, destilación y posterior medida potenciométrica con un electrodo selectivo de sulfuros.

  7. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  8. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  9. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  10. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  11. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  12. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  13. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  14. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  15. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  16. Cyclotron production of Ac-225 for targeted alpha therapy.

    Science.gov (United States)

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  17. Influencia de la cantidad de O2 adicionado al CO2 en el gas de protección sobre la microestructura del metal depositado en uniones soldadas de bordes rectos en aceros de bajo contenido de carbono con el proceso GMAW Influence of O2 content, added to CO2 in the shielding gas, on the microstructure of deposited metal in butt welded joint with straight edges, in low carbon steels using GMAW process

    Directory of Open Access Journals (Sweden)

    Eduardo Díaz-Cedré

    2010-12-01

    Full Text Available La presencia de ferrita acicular (FA en la microestructura del cordón de soldadura, dentro de determinado rango de valores, eleva considerablemente la tenacidad de las uniones soldadas. Es por ello, que el presente trabajo trata sobre un estudio que relaciona la cantidad de ferrita acicular en el cordón en función del contenido de oxígeno presente en la mezcla activa CO2+O2, durante la realización de uniones soldadas de bordes rectos en aceros de bajo carbono con el proceso con electrodo fusible y protección gaseosa (GMAW en condiciones invariables de parámetros de proceso (corriente de soldadura, voltaje de arco, velocidad de soldadura, longitud libre y flujo de gas protector. Como resultado del trabajo se estableció la relación gráfica existente entre la ferrita acicular y el contenido de oxígeno en la mezcla.The presence of acicular ferrite (AF in the microstructure of weld bead, in a specified range of values, increase considerably the toughness of welded joints. The present paper, for that reason, study the relationship between the acicular ferrite quantity in the deposited metal and the oxygen present in the active gas mixture of CO2+O2, during the execution of butt welded joints with straight edges, in low carbon steels with consumable electrode and gas protection (GMAW in invariable conditions of process parameters (welding current, arc voltage, welding speed, electrode extension, and gas flow. The graphic relation between the acicular ferrite and the oxygen content was established, as result of the research work.

  18. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    Institute of Scientific and Technical Information of China (English)

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  19. Moneda ibérica y gens mariana (107-90 a.C.

    Directory of Open Access Journals (Sweden)

    López Sánchez, Fernando

    2010-12-01

    Full Text Available The division between domi/rider reverses with a palm and armed militiae/rider in (Celtiberian currency leads us to establish a link between certain mints and military camps. An example of this can be found in the Ikale (n sken denarii, which must be related to the troops sent in the direction of Córdoba by Kese, in support of Sertorius (97-93 B.C.. The Sekobirikes denarii, on the other hand, were the coins used by the troops of Sekaisa while in the territory of the Arevaci with T. Didius and V. Flaccus (98-92 B.C., and all of the bronze Catalan series corresponds with the start of the Bellum Sociale (90 B.C.. During the second century B.C., Rome waged war in Hispania on the invitation of cities such as Osca, Turiasu or Segeda-Sekaisa, which were threatened by powerful enemies. In the period of Marius the (Celtiberian armies adopted a Roman approach to warfare. All of the (Celtiberian currency was minted between the years 107 and 90 B.C., and as such it reflects not the Roman conquest of Hispania, but the formation of a Hispanic branch of the Roman army.La división entre reversos domi/jinete con palma y militiae/jinete armado en la moneda (celtibérica permite afi rmar que algunas cecas hispanas se corresponden con campamentos militares. Así, los denarios Ikale(nsken deben ponerse en relación con las tropas enviadas por Kese hacia Córdoba en apoyo de Sertorio (97-93 a.C.. Los denarios Sekobirikes, por su parte, son las monedas de las tropas de Sekaisa en territorio arévaco con T. Didio y V. Flaco (98-92 a.C.. Las series catalanas en bronce se corresponden todas con el inicio del Bellum Sociale (90 a.C.. Roma luchó en Hispania durante el siglo II a.C. por invitación de ciudades como Segeda-Sekaisa, amenazadas por enemigos demasiado poderosos. Los ejércitos (celtibéricos combatían a la romana en tiempos de Mario. La moneda (celtibérica clásica fue toda ella acuñada entre los años 107 y 90 a.C. Refleja, no la conquista romana de

  20. Tratamiento conservador en pacientes con retinoblastoma bilateral

    Directory of Open Access Journals (Sweden)

    Juan C. Suárez

    2008-11-01

    Full Text Available OBJETIVO: comparar el tratamiento convencional del retinoblastoma bilateral, usado hasta hace algunos años, consistente en radioterapia o enucleación bilateral, con el tratamiento conservador actual que incluye termoterapia transpupilar (TTT o TTT/quimioterapia al menos en un ojo, en niños con diagnóstico de retinoblastoma bilateral. DISEÑO: estudio retrospectivo descriptivo. MUESTRA: 20 pacientes con diagnóstico de retinoblastoma bilateral que consultaron al Hospital Universitario San Vicente de Paúl, de Medellín, Colombia, entre 1997 y 2007. MÉTODO: se hizo enucleación del ojo con el tumor de mayor tamaño. En el otro ojo se hizo tratamiento con TTT, con el láser diodo (810 nm, spot amplio, solo o combinado con otras terapias. RESULTADOS: se dividió a los pacientes en dos grupos: 16 pacientes (32 ojos en el grupo 1 tratados conservadoramente y 4 pacientes (8 ojos en el grupo 2 con tratamiento convencional. El rango de edad fue de 1-72 meses en el grupo 1 y de 1-12 meses en el grupo 2. El tiempo de seguimiento fue de 7-67 meses para el grupo 1 y de 13-73 meses para el grupo 2. En el grupo 1 se hizo enucleación de 16 ojos (50%, radioterapia externa de uno (3,1%, quimioterapia más termoterapia de 5 (15,6% y quimioterapia más termoterapia más crioterapia de 10 (31,3%. En todos los pacientes se logró preservar al menos un ojo. En el grupo 2, se enuclearon 7 ojos (87,5% y se hizo radioterapia externa más enucleación en un paciente (12.5%. Además, todos los pacientes recibieron quimioterapia. CONCLUSIÓN: la terapia conservadora actual consistente en tratamiento local (termoterapia, crioterapia o braquiterapia y quimiorreducción permite preservar al menos un ojo y en algunos casos de los dos, muchas veces con buena agudeza visual, en niños con retinoblastoma bilateral; se evitan así la enucleación bilateral y la radioterapia externa usada en el tratamiento convencional con todos sus efectos secundarios. La enucleación contin

  1. Fonones en cristales con estructura de diamante

    OpenAIRE

    F. L. Pérez Sánchez; F. Pérez Rodríguez

    2004-01-01

    Se presenta un estudio de los modos vibracionales de cristales con estructura de diamante. En este estudio aplicamos el modelo de Keating para describir las interacciones de corto alcance entre los átomos e incorporar, en la forma más simple, las interacciones de tres cuerpos asociadas con la deformación del ángulo entre dos enlaces covalentes. En el marco de la aproximación armónica, se obtienen expresiones analíticas para las relaciones de dispersión de fonones con vectores de onda a lo lar...

  2. Reflexiones de un objeto con mente

    OpenAIRE

    Viader Junyent, Manel

    1993-01-01

    A estas alturas, y conociendo en parte su trayectoria, no resulta ninguna sorpresa para el lector avezado o al menos interesado en la problematica de la psicologia cognitiva que el profesor Ángel Riviere nos presente un libro como Objetos con mente. Por el contrario, se trata de un trabajo coherente con las reflexiones que viene aportando desde hace años a la tematica, y comparte con sus libros anteriores altos niveles de rigor y profundidad. Desde luego, los trabajos de Riviere rompen totalm...

  3. Posicionamiento WIFI con variaciones de fingerprint

    OpenAIRE

    Kornuta, Carlos; Acosta, Nelson; Toloza, Juan Manuel

    2013-01-01

    Los sistemas de posicionamiento Indoor estiman la posición de un dispositivo móvil en un entorno cerrado con una precisión relativa. Existen diversas técnicas de posicionamiento, donde el parámetro mayormente utilizado es el RSSI (Received Signal Strength Indicator). En este artículo se analiza la técnica Fingerprint con la finalidad de estimar el margen de error obtenido con la distancia euclidiana como métrica principal. Se presentan variantes de la construcción de la base de datos Fingerpr...

  4. El envejecimiento de las personas con discapacidad

    OpenAIRE

    Envejecimiento Activo, CERMI

    2012-01-01

    El envejecimiento activo es considerado como un concepto multidimensional que abarca y supera la buena salud, resultado de un amplio conjunto de factores biológicos, psicológicos y sociales. En el caso de las personas mayores con discapacidad, la ausencia de una política de promoción y sensibilización en la comunidad a veces les niega la igualdad de oportunidades en relación con el resto de los ciudadanos. Para desarrollar ese potencial de envejecimiento activo en personas con discapacidad ha...

  5. Portal de compraventa con red social

    OpenAIRE

    Montero Vegas, Toni

    2010-01-01

    Este proyecto ha sido diseñado con la intención de añadir una aplicación a la red en la que un usuario que disponga de una necesidad, ya sea de compra o de venta, de un articulo pueda disponer de un medio más para vender en el que además, pueda hacer amistad con otros usuarios y que pueda interaccionar con todos estos usuarios, tanto amigo como simples usuarios bajo su punto de vista. Para poder realizar el proyecto, se han utilizado frameworks existentes como por ejemplo Ibatis, para la c...

  6. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC22Q.Seq.d/ Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  7. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC23Q.Seq.d/ Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  8. PROSPECTS OF MULTIFILAMENTARY SUPERCONDUCTOR AC 50 Hz APPLICATIONS

    OpenAIRE

    Hlásnik, I.

    1984-01-01

    It is shown that parameters of modern multifilamentary superconductors and their possible improvements allow their application to AC 50 Hz windings working at Bm of about 1 T and giving energy and total cost savings.

  9. Dc to ac converter operates efficiently at low input voltages

    Science.gov (United States)

    1965-01-01

    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  10. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  11. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    Directory of Open Access Journals (Sweden)

    H. Salamati

    2004-06-01

    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  12. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  13. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  14. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  15. Development of the Field of Flexible AC Transmission Systems (FACTS)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  16. Muc5ac mucin expression during rat skin development

    OpenAIRE

    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  17. Dynamics of a nanowire superlattice in an ac electric field

    OpenAIRE

    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen

    2005-01-01

    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  18. Theory of the ac spin-valve effect

    OpenAIRE

    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav

    2011-01-01

    The spin-valve complex magnetoimpedance of symmetric ferromagnet/normal metal/ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance---the real part difference of the impedances of the parallel and antiparallel magnetization configurations---exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and ...

  19. Fractal AC circuits and propagating waves on fractals

    CERN Document Server

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander

    2015-01-01

    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  20. AC resistivity of d-wave ceramic superconductors

    OpenAIRE

    Li, Mai Suan; Dominguez, Daniel

    2000-01-01

    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  1. Update on bedside ultrasound (US) diagnosis of acute cholecystitis (AC).

    Science.gov (United States)

    Zenobii, Maria Francesca; Accogli, Esterita; Domanico, Andrea; Arienti, Vincenzo

    2016-03-01

    Acute cholecystitis (AC) represents a principal cause of morbidity worldwide and is one of the most frequent reasons for hospitalization due to gastroenteric tract diseases. AC should be suspected in presence of clinical signs and of gallstones on an imaging study. Upper abdominal US represents the first diagnostic imaging step in the case of suspected AC. Computed tomography (CT) with intravenous contrast (IV) or magnetic resonance imaging (MRI) with gadolinium contrast and technetium hepatobiliary iminodiacetic acid (Tc-HIDA) can be employed to exclude complications. US examination should be performed with right subcostal oblique, with longitudinal and intercostal scans. Normal gallbladder US findings and AC major and minor US signs are described. Polyps, sludge and gallbladder wall thickening represent the more frequent pitfalls and they must be differentiated from stones, duodenal artifacts and many other non-inflammatory conditions that cause wall thickening, respectively. By means of bedside ultrasound, the finding of gallstones in combination with acute pain, when the clinician presses the gallbladder with the US probe (the sonographic Murphy's sign), has a 92.2 % positive predictive value for AC. In our preliminary experience, bedside US-performed by echoscopy (ES) and/or point-of-care US (POCUS) demonstrated good reliability in detecting signs of AC, and was always integrated with physical examination and performed by a skilled operator.

  2. AC electrophoretic deposition of organic-inorganic composite coatings.

    Science.gov (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials.

  3. Temperature integration at the AC thermosensory neurons in Drosophila.

    Science.gov (United States)

    Tang, Xin; Platt, Michael D; Lagnese, Christopher M; Leslie, Jennifer R; Hamada, Fumika N

    2013-01-16

    Temperature sensation has a strong impact on animal behavior and is necessary for animals to avoid exposure to harmful temperatures. It is now well known that thermoTRP (transient receptor potential) channels in thermosensory neurons detect a variable range of temperature stimuli. However, little is known about how a range of temperature information is relayed and integrated in the neural circuits. Here, we show novel temperature integration between two warm inputs via Drosophila TRPA channels, TRPA1 and Pyrexia (Pyx). The internal AC (anterior cell) thermosensory neurons, which express TRPA1, detect warm temperatures and mediate temperature preference behavior. We found that the AC neurons were activated twice when subjected to increasing temperatures. The first response was at ∼25°C via TRPA1 channel, which is expressed in the AC neurons. The second response was at ∼27°C via the second antennal segments, indicating that the second antennal segments are involved in the detection of warm temperatures. Further analysis reveals that pyx-Gal4-expressing neurons have synapses on the AC neurons and that mutation of pyx eliminates the second response of the AC neurons. These data suggest that AC neurons integrate both their own TRPA1-dependent temperature responses and a Pyx-dependent temperature response from the second antennal segments. Our data reveal the first identification of temperature integration, which combines warm temperature information from peripheral to central neurons and provides the possibility that temperature integration is involved in the plasticity of behavioral outputs.

  4. A Novel High Performance Bridgeless Ac-Dc Boost Converter

    Directory of Open Access Journals (Sweden)

    S.M.AshrafulAlam Mohon

    2016-08-01

    Full Text Available A new single phase high performance bridgeless AC-DC Boost converter is proposed. The converter is made bridgeless by the use of two unidirectional switches and two diodes at the input ac side for power conversion for both positive and negative half cycle. Because of the high frequency switching, the power factor of the circuit is inherently corrected and it requires a small filter to make the input current near sinusoidal with limited THD. The significant improvement in THD makes the circuit a good choice in applications needing AC-DC conversion with power conditioning. The circuit exhibits such better performances than conventional AC-DC boost converter with variable loads at constant frequency switching with no additional control circuits. The efficiency of the circuit is also satisfactory. Analysis and simulation results of the circuit are obtained by using software simulation. The main advantage of this new AC-DC converter is its superior power quality over conventional AC-DC boost converter

  5. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  6. Presa con revestimiento asfáltico

    Directory of Open Access Journals (Sweden)

    Proudfit, D. P.

    1960-07-01

    Full Text Available La presa denominada Montgomery se halla situada sobre el río South Platte River, a unos 8 km aguas arriba de la ciudad de Alma, del Estado de Colorado (EE. UU., y en la ladera oriental de la cordillera Continental Divide. El cuerpo o dique de esta presa está constituido por piedra, revestida con una capa de hormigón asfáltico en el paramento de contacto con el agua.

  7. Infactibilidad en programas con restricciones lineales

    Directory of Open Access Journals (Sweden)

    Liern Carrión, V.

    1999-01-01

    Full Text Available En este trabajo resumimos las técnicas más habituales que permiten diagnosticar las causas de infactibilidad de programas con restricciones lineales. Además, presentamos dos métodos que, con las mínimas transformaciones posibles del modelo inicial, permiten hacer viable un programa infactible. Los métodos descritos son aplicados a un modelo de selección de carteras eficientes.

  8. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG

    OpenAIRE

    Bulhosa, João Paulo Rodrigues

    2009-01-01

    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  9. RadCon: A Radiological Consequences Model

    International Nuclear Information System (INIS)

    RadCon estimates the dose received by user selected groups in the population from an accidental release of radionuclides to the environment. The exposure pathways considered are external exposure from the cloud and ground and internal exposure from inhalation and ingestion of contaminated food. Atmospheric dispersion modelling is carried out externally to RadCon.Given a two dimensional time varying air and ground concentration of radioactive elements, RadCon allows the user to: view the air and ground concentration over the affected area, select optional parameters and calculate the dose to people,display the results to the user, and change the parameter values. RadCon offers two user interfaces: 1) the standard graphical user interface which is started using Java DoseApp at the command line, or by setting up a shortcut to this command (particularly when RadCon is installed on a PC) and 2) the text based interface used to generate information for the model inter-comparison exercise . This is initiated using Java BIOMASS at the command line, or an equivalent shortcut. The text based interface was developed for research purposes and is not generally available. Appendices A, B and C provide a summary of instructions on setting up RadCon. This will generally be carried out by the computer support personnel

  10. Study on AC/A ratio in myopia%近视患者AC/A率的临床意义

    Institute of Scientific and Technical Information of China (English)

    肖婉莉; 孙建宁

    2011-01-01

    目的:探讨AC/A率在近视发生发展中的作用及机制.方法:选择30名正视眼者(正视眼组)及90名近视眼者.对近视眼者根据屈光程度分为轻、中、高度近视眼3组;根据平时戴镜情况,分为从未戴镜、间断戴镜和持续戴镜组.采用同视机法测量AC/A率并进行分析和比较.结果:轻度近视眼组AC/A率平均值为(3.22±1.51)Δ/D,中度(3.46±1.00)Δ/D,高度(3.97±1.36)Δ/D,均高于正视眼组(P<0.05).从未戴镜组AC/A率高于间断戴镜及持续戴镜组(P<0.05).结论:近视患者高AC/A率是调节与辐辏功能不协调的一种表现,高AC/A率可导致眼球近视性改变.近视患者应进行矫正,恢复调节与辐辏的平衡.%Objective: To assess the difterence of accommodative convergence to accommodation (AC/A) ratio in myopia and emmetropia, then evaluate the relationship between AC/A ratio and myopia. Methods: Thirty emmetropia and 90 myopia cases were included in this study. The myopia cases were divided into mild myopia,moderate myopia and high myopia. The AC/A ratios were measured with a synoptophore, and the results were analyzed. Results: Average values of mild myopia group, moderate myopia group and high myopia group were (3.22 ± 1.51 ) Δ/D, (3.46 ± 1.00) Δ/D, (3.46 ± 1.00) Δ/D, a significant difference was found between each group and emmetropia group ( P < 0.05 ). The AC/A ratio of non- wearing glasses group was higher than that of discontinuous wearing and continued wearing glasses group. Conclusion: The increased AC/A ratio represents the incoordination of accommodations and convergences, which can lead to an aggravation of myopia, which should be readjusted.

  11. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  12. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Indian Academy of Sciences (India)

    Manoj Chugh; B R Gulati; S K Gakhar

    2010-03-01

    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  13. Perceptions of breath alcohol concentration (BrAC) levels among a sample of bar patrons with BrAC values of 0.08% or higher.

    Science.gov (United States)

    Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer; Vail-Smith, Karen

    2016-09-01

    Breath alcohol concentration (BrAC) is a commonly used measure of alcohol intoxication. Because of the potential negative consequences of excessive alcohol consumption, it is important to examine how accurately intoxicated individuals can estimate their BrAC values, especially individuals over the legal BrAC driving threshold (i.e., 0.08%). To better understand perceptions of BrAC values among intoxicated individuals, this field study examined actual BrAC values and BrAC range estimates (0.08% and above, 0.02-0.07%, less than 0.02%) among a sample of bar patrons (N = 454) with BrAC levels at 0.08% or higher. Bivariate and multivariate analyses were conducted to examine the relationship between actual BrAC values and perceived BrAC levels. We also examined whether the following demographic and drinking variables were associated with underestimating BrAC in this sample: gender, age, race, college student status, plans to get home, and hazardous drinking. Results indicated that the majority (60.4%) of participants underestimated their BrAC (i.e., less than 0.08%) and lower BrAC values correlated with underestimating BrAC ranges (p young (less than 21) intoxicated females are a group at high risk for sexual assault on college campuses. (PsycINFO Database Record PMID:27631614

  14. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate...

  15. RadConEd: A Graphical Data Editor for the Radiological Consequences Model, RadCon

    International Nuclear Information System (INIS)

    This document describes the application, RadConEd, which has been designed and implemented to enable users of the RadCon system to update these parameter files. The RadCon system is written in the Java programming language, and as such provides portability across computer platforms. The software described in this report was developed in line with the portability requirements of RadCon, thus providing a uniform user interface across computer platforms and bypassing the need of using system editors. In addition a number of data integrity measures were implemented

  16. Atenuación natural en suelos contaminados con hidrocarburos

    OpenAIRE

    Lilia Corona Ramírez; Rosario Iturbe Argûelles

    2005-01-01

    Se realizó un experimento con suelo contaminado proveniente de una refinería, el cual contaba con hidrocarburos derivados de petróleo, específicamente con concentraciones elevadas de hidrocarburos poliaromáticos (HAP). El estudio consistió en preparar 7 cajones con 7 kg de suelo, cada uno con las siguientes condiciones: S1 suelo contaminado con hidrocarburos y 15% de contenido de agua. S2 suelo contaminado con hidrocarburos y adición de Nitrógeno y Fósforo (N y P) con 15% de contenido de agua...

  17. La atención odontológica del paciente geriátrico con deterioro cognitivo

    Directory of Open Access Journals (Sweden)

    M.C. Haya Fernández

    2015-06-01

    Full Text Available La investigación clínica ha demostrado que una mejor función cognitiva se relaciona con un mejor estado de salud oral. Y, de la misma manera, los pacientes mayores institucionalizados con deterioro cognitivo presentan una pobre salud oral con mayor número de dientes ausentes, caries, acúmulo de placa y enfermedad periodontal. El diagnóstico precoz del paciente con deterioro cognitivo es fundamental para mejorar el pronóstico de la enfermedad y poder plantear un tratamiento odontológico preventivo que pueda mejorar su salud y su calidad de vida. Por este motivo, todo el personal sanitario, incluido el odontólogo, tiene que ser determinante en este proceso valorando los cambios conductuales y las pérdidas de memoria de sus pacientes. El objetivo de este artículo es realizar una visión geriátrica de las enfermedades que con mayor frecuencia van a provocar deterioro cognitivo. Así como revisar que cambios se producen en estos pacientes, en cuanto a su salud oral, debido a las alteraciones producidas en el desarrollo de la enfermedad. Para concluir recopilando las pautas de cómo y cuándo debería de realizarse el tratamiento odontológico dependiendo de la fase del deterioro cognitivo.

  18. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  19. Placa de pila de combustible con geometría de flujo en forma de "espina de pez"

    OpenAIRE

    Lincheta Mesa, Eduardo; Barreras Toledo, Félix; Lozano Fantoba, Antonio; Valiño García, Luis; Mustata Oroviceanu, Radu

    2010-01-01

    La placa de pila de combustible, que se utiliza generalmente para distribuir de forma homogénea los fluidos reactantes sobre las áreas de reacción química correspondientes a las capas catalíticas (electrodos), presenta en cada una de estas áreas de reacción química una geometría de flujo en forma de “espina de pez” que comprende canales 10 delimitados por unos nervios, dispuestos de tal forma que el canal de entrada se bifurca en canales que ocupan dos estructuras laberíntic...

  20. Behaviour analysis of AC-600 passive safety systems

    International Nuclear Information System (INIS)

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  1. 压电发电机AC-DC输出性能的优化与仿真研究%The Optimization and Simulation of the AC-DC Output Performances of Piezoelectric Generator

    Institute of Scientific and Technical Information of China (English)

    金文平; 王光庆; 展永政

    2014-01-01

    The AC-DC transferring circuit greatly affects the output performances of the piezoelectric vibration generator (PVG).In order to improve the output performance and the energy conversion efficiency of the PVG,this paper presents the equivalent circuit model of the PVG at first,and then the analytical expressions of the AC-DC cir-cuit,such as the output voltage and the output power,are derived by using the mechanical equilibrium principle and circuit theory when the PVG operates under the steady-state.To maximize the output power of the AC-DC transfer-ring circuit,the optimization of the output power with different resistance loads are carried out by using differential calculation method,and the optimal load resistance,displacement,output voltage and output power are obtained un-der the open-circuit resonance and short-circuits resonance condition respectively.Some simulations are carried out to analyze the output performances of the PVG.The validity are performed by compared the results with the coupling a-nalysis results of Ottman and the in-phase analysis results of Guyomar.The results have shown that the optimization of the output performance of the AC-DC circuit is attributing to enhance the total performance and the energy con-version efficiency of the PVG.%交流-直流(AC-DC)转换电路对压电振动发电机的输出性能影响较大,为提高压电发电机 AC-DC转换电路的输出性能和能量转换效率,该文首先给出了压电振动发电机系统等效电路模型,基于该模型利用力学平衡原理和电路理论推导了发电机稳态运行时 AC-DC输出电压和输出功率表达式。以输出功率最大化为优化目标,通过微分计算对发电机 AC-DC转换电路在不同负载电阻下的输出功率进行了优化分析,分别得到了发电机在开路谐振和短路谐振状态下优化的负载电阻、振动位移、输出电压和输出功率。仿真与对比分析了发电机优化后的输出

  2. Enfermedad coronaria en pacientes con psoriasis

    Directory of Open Access Journals (Sweden)

    Walter Masson

    2013-10-01

    Full Text Available Comunicaciones previas asociaron la psoriasis con la enfermedad coronaria. Desconocemos si en nuestro país o región existe dicha asociación. Se realizó un estudio transversal analizando los datos de la historia clínica electrónica de un sistema de salud de Buenos Aires. Analizamos todos los pacientes mayores de 18 años con diagnóstico de psoriasis entre el 1 de enero de 2003 y el 31 de julio de 2011 y los comparamos con un grupo control, en una relación 2:1, obtenido en forma aleatoria del mismo sistema de salud, apareados por edad y sexo. Determinamos la prevalencia de los factores de riesgo cardiovascular y de enfermedad coronaria. Analizamos la asociación entre la enfermedad coronaria y la psoriasis mediante análisis uni y multivariado. Se incluyeron 3 833 sujetos (1 286 pacientes con psoriasis y 2 547 controles. La prevalencia de hipertensión arterial (50% vs. 38%, p < 0.001, tabaquismo (25% vs. 17%, p < 0.001, diabetes (12% vs. 8%, p < 0.001 y enfermedad coronaria (4.98% vs. 3.06%, p = 0.003 fue mayor en los sujetos con psoriasis en comparación con el grupo control. Independientemente de la edad, la presencia de diabetes, hipertensión arterial o tabaquismo, hubo una asociación significativa entre la enfermedad coronaria y la psoriasis (OR 1.48, IC95% 1.04-2.11, p = 0.03. En conclusión, en esta población de Buenos Aires, los pacientes con psoriasis tuvieron una mayor prevalencia de diabetes, hipertensión arterial, tabaquismo y enfermedad coronaria. La asociación entre la psoriasis y la enfermedad coronaria fue independiente de los factores de riesgo explorados.

  3. Mincle Signaling Promotes Con A Hepatitis.

    Science.gov (United States)

    Greco, Stephanie H; Torres-Hernandez, Alejandro; Kalabin, Aleksandr; Whiteman, Clint; Rokosh, Rae; Ravirala, Sushma; Ochi, Atsuo; Gutierrez, Johana; Salyana, Muhammad Atif; Mani, Vishnu R; Nagaraj, Savitha V; Deutsch, Michael; Seifert, Lena; Daley, Donnele; Barilla, Rocky; Hundeyin, Mautin; Nikifrov, Yuriy; Tejada, Karla; Gelb, Bruce E; Katz, Steven C; Miller, George

    2016-10-01

    Con A hepatitis is regarded as a T cell-mediated model of acute liver injury. Mincle is a C-type lectin receptor that is critical in the immune response to mycobacteria and fungi but does not have a well-defined role in preclinical models of non-pathogen-mediated inflammation. Because Mincle can ligate the cell death ligand SAP130, we postulated that Mincle signaling drives intrahepatic inflammation and liver injury in Con A hepatitis. Acute liver injury was assessed in the murine Con A hepatitis model using C57BL/6, Mincle(-/-), and Dectin-1(-/-) mice. The role of C/EBPβ and hypoxia-inducible factor-1α (HIF-1α) signaling was assessed using selective inhibitors. We found that Mincle was highly expressed in hepatic innate inflammatory cells and endothelial cells in both mice and humans. Furthermore, sterile Mincle ligands and Mincle signaling intermediates were increased in the murine liver in Con A hepatitis. Most significantly, Mincle deletion or blockade protected against Con A hepatitis, whereas Mincle ligation exacerbated disease. Bone marrow chimeric and adoptive transfer experiments suggested that Mincle signaling in infiltrating myeloid cells dictates disease phenotype. Conversely, signaling via other C-type lectin receptors did not alter disease course. Mechanistically, we found that Mincle blockade decreased the NF-κβ-related signaling intermediates C/EBPβ and HIF-1α, both of which are necessary in macrophage-mediated inflammatory responses. Accordingly, Mincle deletion lowered production of nitrites in Con A hepatitis and inhibition of both C/EBPβ and HIF-1α reduced the severity of liver disease. Our work implicates a novel innate immune driver of Con A hepatitis and, more broadly, suggests a potential role for Mincle in diseases governed by sterile inflammation.

  4. Mincle Signaling Promotes Con A Hepatitis.

    Science.gov (United States)

    Greco, Stephanie H; Torres-Hernandez, Alejandro; Kalabin, Aleksandr; Whiteman, Clint; Rokosh, Rae; Ravirala, Sushma; Ochi, Atsuo; Gutierrez, Johana; Salyana, Muhammad Atif; Mani, Vishnu R; Nagaraj, Savitha V; Deutsch, Michael; Seifert, Lena; Daley, Donnele; Barilla, Rocky; Hundeyin, Mautin; Nikifrov, Yuriy; Tejada, Karla; Gelb, Bruce E; Katz, Steven C; Miller, George

    2016-10-01

    Con A hepatitis is regarded as a T cell-mediated model of acute liver injury. Mincle is a C-type lectin receptor that is critical in the immune response to mycobacteria and fungi but does not have a well-defined role in preclinical models of non-pathogen-mediated inflammation. Because Mincle can ligate the cell death ligand SAP130, we postulated that Mincle signaling drives intrahepatic inflammation and liver injury in Con A hepatitis. Acute liver injury was assessed in the murine Con A hepatitis model using C57BL/6, Mincle(-/-), and Dectin-1(-/-) mice. The role of C/EBPβ and hypoxia-inducible factor-1α (HIF-1α) signaling was assessed using selective inhibitors. We found that Mincle was highly expressed in hepatic innate inflammatory cells and endothelial cells in both mice and humans. Furthermore, sterile Mincle ligands and Mincle signaling intermediates were increased in the murine liver in Con A hepatitis. Most significantly, Mincle deletion or blockade protected against Con A hepatitis, whereas Mincle ligation exacerbated disease. Bone marrow chimeric and adoptive transfer experiments suggested that Mincle signaling in infiltrating myeloid cells dictates disease phenotype. Conversely, signaling via other C-type lectin receptors did not alter disease course. Mechanistically, we found that Mincle blockade decreased the NF-κβ-related signaling intermediates C/EBPβ and HIF-1α, both of which are necessary in macrophage-mediated inflammatory responses. Accordingly, Mincle deletion lowered production of nitrites in Con A hepatitis and inhibition of both C/EBPβ and HIF-1α reduced the severity of liver disease. Our work implicates a novel innate immune driver of Con A hepatitis and, more broadly, suggests a potential role for Mincle in diseases governed by sterile inflammation. PMID:27559045

  5. Analysis of AC loss in superconducting power devices calculated from short sample data

    OpenAIRE

    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  6. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  7. Variables socionutricionales de hogares mazahuas integrados por preescolares desnutridos con madres con obesidad y sin obesidad

    Directory of Open Access Journals (Sweden)

    Conzuelo González, Viridiana Vanessa

    2009-01-01

    Full Text Available El primer objetivo fue conocer cuántos menores de cinco años con diferentes grados de desnutrición tienen una madre con sobrepeso/obesidad/ en una comunidad indígena que vive en extrema pobreza y bajo condiciones de migración masculina internacional. El segundo fue comparar tres variables socionutricionales (ingreso familiar, educación de la madre y adecuación nutrimental de la dieta diaria entre estos hogares y los hogares con desnutrición infantil y madres sin obesidad. Se realizó un estudio transversal (2006-2007, en la comunidad mazahua de San Francisco Tepeolulco, Municipio de Temascalcingo; que incluyó a 85 hogares integrados por preescolares con desnutrición inscritos al programa Oportunidades. Se determinó el estado nutrición de los preescolares con indicadores antropométricos y se obtuvo el IMC de las madres de estos infantes. Se aplicó una encuesta socionutricional, incluida el recordatorio de 24 horas, y complementado con la observación participante (cualitativa. Se encontró que 83% de las madres mazahuas presentaron sobrepeso u obesidad. El estado de nutrición de los preescolares con madres con obesidad presentó un porcentaje mayor de desnutrición (76%. En la variable género, se encontró que 54% de los niños con madres con obesidad tenía baja talla. Al relacionar el nivel educativo de la madre, esta variable resultó ser estadísticamente significativa (p=0.015, donde el analfabetismo está más relacionado con la desnutrición infantil que tienen madres de bajo y/o peso normal. La elevada prevalencia de hogares conformados con preescolares con desnutrición y madres con obesidad, es un síntoma más de la pobreza en zonas indígenas en México, con bajo índice de desarrollo humano.

  8. Evolution of ConAl clusters and chemisorption of hydrogen on ConAl clusters

    International Nuclear Information System (INIS)

    The growth behavior of ConAl (n = 1–15) and the chemisorptions of hydrogen on the ground state geometries have been studied using the density functional theory (DFT) within the generalized gradient approximation (GGA). The growth pattern for ConAl is Al-substituted Con+1 clusters, and it keeps the similar frameworks of the most stable Con+1 clusters except for n = 2, 3, and 6. The Al atom substitutes the surface atom of the Con+1 clusters for n ≤ 13. Starting from n = 14, the Al atom completely falls into the center of the Co-frame. The dissociation energy, the second-order energy differences, and the HOMO–LUMO gaps indicate that the magic numbers of the calculated ConAl clusters are 7, 9, and 13, corresponding to the high symmetrical structures. To my knowledge, this is the first time that a systematic study of chemisorption of hydrogen on cobalt aluminum clusters. The twofold bridge site is identified to be the most favorable chemisorptions site for one hydrogen adsorption on ConAl (n = 1–6, 8, 10), and two hydrogen adsorption on ConAl (n = 1–7), while threefold hollow site is preferred for one hydrogen adsorption on ConAl (n = 7, 9, 11–15) and two hydrogen adsorption on ConAl (n = 8–10, 12–15) clusters. The ground state structure of two hydrogen adsorption on Co11Al is exceptional. In general, the binding energy of both H and 2H of ConAl (n = 1–12) is found to increase with the cluster size. And the result shows that large binding energies of the hydrogen atoms and large fragmentation energies for Co11AlH and Co12AlH make these species behaving like magic clusters.

  9. 一种简单新型拓扑Cuk AC/AC变换器及其仿真研究%A New Simple Topology of Cuk AC/AC Converter and Its Simulation

    Institute of Scientific and Technical Information of China (English)

    陈溪; 刘韬; 谭光慧; 纪延超

    2006-01-01

    由Cuk DC/DC变换器的拓扑结构导出一种只具有两个开关的PWM AC/AC变换器的简单新型拓扑--Cuk AC/AC变换器.给出单相和三相Cuk AC/AC变换器的拓扑结构,分析Cuk AC/AC变换器的外特性及小信号特性.仿真结果验证了所提的Cuk AC/AC变换器的合理性和可行性.

  10. Factors associated with oxidative stress in women with breast cancer Factores asociados con estrés oxidativo en mujeres con cáncer de mama

    Directory of Open Access Journals (Sweden)

    F. G. K. Vieira

    2011-06-01

    Full Text Available Objective: To assess the association between physiological, physical, lifestyle and nutritional variables and oxidative stress biomarkers in women with breast cancer. Methods: This cross-sectional study was conducted on 55 women newly diagnosed with breast cancer. The extent of oxidative stress was analyzed by the measurement of plasma lipid hydroperoxides (LH, thiobarbituric acid reactive substances (TBARS, protein carbonyl, whole blood reduced glutathione (GSH and serum antioxidant capacity (AC. Diet data were obtained from food frequency questionnaire. Linear regression was used to determine the association between the variables studied and oxidative stress biomarkers. The protein carbonyl data was not included in the linear regression analyses since the data did not show a normal distribution, even after logarithmic and other transformations. Results: After adjusting for energy intake, the intake of chicken and high-fat dairy products was associated with increased levels of LH, while vitamin E intake was associated with decreased LH levels (R² = 23.8%. Intake of oils was associated with increased levels of TBARS (R² = 6.82%. Positive axillary lymph node status was associated with decreased levels of GSH (R² = 9.31%. Increasing age was directly associated with levels of AC, while animal fat, dairy product, and sweet food intakes were associated with low levels of AC (R² = 41.42%. Conclusion: Intake of chicken, vitamin E, dairy products (particularly high-fat dairy products, oils, animal fat, and sweet foods, along with axillary lymph node status and age, may be important determinants of oxidative stress in women with breast cancer.Objetivo: Evaluar la asociación entre las variables fisiológicas, físicas, de estilo de vida y nutricionales y de los biomarcadores de estrés oxidativo en mujeres con cáncer de mama. Métodos: Este estudio transversal se realizó en 55 mujeres diagnosticadas de cáncer de mama. Se analizó el grado de estr

  11. Modelling ac ripple currents in HTS coated conductors

    Science.gov (United States)

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  12. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  13. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  14. AC Zeeman potentials for atom chip-based ultracold atoms

    Science.gov (United States)

    Fancher, Charles; Pyle, Andrew; Ziltz, Austin; Aubin, Seth

    2015-05-01

    We present experimental and theoretical progress on using the AC Zeeman force produced by microwave magnetic near-fields from an atom chip to manipulate and eventually trap ultracold atoms. These AC Zeeman potentials are inherently spin-dependent and can be used to apply qualitatively different potentials to different spin states simultaneously. Furthermore, AC Zeeman traps are compatible with the large DC magnetic fields necessary for accessing Feshbach resonances. Applications include spin-dependent trapped atom interferometry and experiments in 1D many-body physics. Initial experiments and results are geared towards observing the bipolar detuning-dependent nature of the AC Zeeman force at 6.8 GHz with ultracold 87Rb atoms trapped in the vicinity of an atom chip. Experimental work is also underway towards working with potassium isotopes at frequencies of 1 GHz and below. Theoretical work is focused on atom chip designs for AC Zeeman traps produced by magnetic near-fields, while also incorporating the effect of the related electric near-fields. Electromagnetic simulations of atom chip circuits are used for mapping microwave propagation in on-chip transmission line structures, accounting for the skin effect, and guiding impedance matching.

  15. Impedance, AC conductivity and dielectric behavior Adeninium Trichloromercurate (II)

    Science.gov (United States)

    Fersi, M. Amine; Chaabane, I.; Gargouri, M.

    2016-09-01

    In this work, we report the measurements impedance spectroscopy technique for the organic-inorganic hybrid compound (C5H6N5) HgCl3, 11/2H2O measured in the 209 Hz-5 MHz frequency range from 378 to 428 K. Besides, the Cole-Cole (Z″ versus Z‧) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experiment results indicated that AC conductivity (σac) was proportional to σdc + A ωS . The obtained results are discussed in terms of the correlated barrier hopping (CBH) model. An agreement between the experimental and theoretical results suggests that the AC conductivity behavior of Adeninium Trichloromercurate (II) can be successfully explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.

  16. COMPARISON OF BACTERIAL ADSORPTION AND ANTIBACTERIAL PROPERTIES BETWEEN AC AND AC(Ag)%AC及AC(Ag)对细菌的吸附及灭菌功能的对比研究

    Institute of Scientific and Technical Information of China (English)

    万怡灶; 王玉林; 董向红; 周福刚; 成国祥; 温廷益; 韩森

    2000-01-01

    测定了活性碳(AC)及载银活性碳(AC(Ag))的比表面积和孔径分布曲线,对比研究了AC及AC(Ag))对大肠杆菌的吸附能力和灭菌性能.结果表明,载银后,虽然AC(Ag)的比表面积下降,但由于银的存在,使其吸附的大肠杆菌数量高于AC,而吸附速率低于AC.灭菌试验表明,AC对大肠杆菌没有杀灭能力,而AC(Ag)对大肠杆菌有较好的灭菌功能.

  17. El Surco Palato Radicular: Su relación con patología pulpar y/o periodontal

    OpenAIRE

    R.M. Pulgar Encinas; B. Noguerol Rodriguez

    2000-01-01

    La presencia de anomalías morfológicas radiculares pueden actuar como factor predisponente para el acúmulo de placa y el desarrollo de patología periodontal y/o pulpar. Presentamos un caso clínico de surco palatoradicular en el 21, donde la presencia del surco ha sido el factor causal de una bolsa periodontal con defecto óseo aislado que finalmente condujo a la pérdida del diente. Se analiza la prevalencia, localizaciones, patogenia y la actitud terapéutica correcta ante la presencia de este ...

  18. ENFOQUE DEL PACIENTE CON INTOXICACIÓN AGUDA POR PLAGUICIDAS ORGANOS FOSFORADOS Organophosphorates: acute intoxication practical issues

    OpenAIRE

    Carlos Mauricio Hurtado Clavijo; Myriam Gutiérrez de Salazar

    2005-01-01

    Un gran número de insecticidas organofosforados se usan en todo el mundo a diario. Las intoxicaciones ocurren generalmente de forma accidental por exposición laboral, o intencional, con fines suicidas. Los organofosforados producen sus efectos tóxicos a través de la inhibición de la acetilcolinesterasa, la enzima responsable de la hidrólisis del neurotransmisor acetilcolina, produciendo ácido acético y colina, productos químicamente inertes. La unión entre los organofosforados y la acetilcoli...

  19. Modelo de optimización con restricciones de equilibrio para el control de semáforos

    OpenAIRE

    Pedreira Andrade, Luís P.; Lema Fernández, Carmen S.; Blanco Louro, Amalia; Allende, Sira

    2006-01-01

    En este trabajo analizamos un problema de control óptimo de semáforos para un cruce de dos carreteras con los dos sentidos de circulación. Exponemos primero, un modelo exacto y acíclico que describe la evolución de las longitudes de las colas como una función del tiempo y de los instantes de cambio (“switching”). Para obtener un modelo simplificado (más manejable para el análisis matemático) hacemos algunas hipótesis simplificadoras. Pretendemos calcular una sucesión temporal switching p...

  20. Pénfigo seborreico con eritema polimorfo

    Directory of Open Access Journals (Sweden)

    Marisabel R. Coronel Q.

    2009-12-01

    Full Text Available Paciente femenino de 50 años, internadapor presentar dolor intenso generalizadoen la piel. Presenta lesiones dérmicasde mas o menos 2 meses de evolución, conáreas eritematosas y vesículas que confluyena ampollas con fondo eritematoso, que conel tiempo se extendió a una gran superficiedel cuerpo. Al examen físico se evidencian:lesiones dérmicas sobreinfectadas con secreciónpurulenta en algunas regiones delcuerpo (cuello y brazos además de lesioneshiperqueratósicas y decamativas que comprometentodo el cuerpo. El diagnóstico deingreso fue pénfigo vulgar impetiginizadocon hepatitis autoinmune.

  1. Tomate industrial con riego por cinta

    OpenAIRE

    Adán Fimbres-Fontes

    2004-01-01

    La región agrícola de Caborca cuenta con una superficie de 40 000 ha, las cuales se riegan con agua proveniente de aproximadamente 700 pozos. El abatimiento del manto acuífero es, en promedio, de 0.82 m año-1 y, en 25 años, ha sido de 20.50 m, medidos al nivel estático. El agua es uno de los factores más importantes en la producción de cualquier cultivo en la región. El objetivo del presente trabajo fue optimizar la cantidad de agua por aplicar al tomate industrial cultivado con riego por cin...

  2. Unidad didáctica sobre el sistema de medida NetdB aplicado a prácticas de acústica arquitectónica

    OpenAIRE

    Sotorríos Rubio, Ana

    2013-01-01

    El objetivo principal perseguido en este proyecto es el estudio del sistema NetdB mediante la medida de diferentes parámetros de acústica arquitectónica. El proyecto se estructura en cinco partes bien diferenciadas que se comentarán a continuación. La primera parte, fundamentos teóricos, se centrará en explicar los distintos parámetros medidos y su relación con la acústica, tanto de forma teórica como práctica. Todo ello se hará mediante la definición de los conceptos teóricos básico...

  3. Evaluación de la contaminación acústica en las inmediaciones del nuevo hospital de Gandia

    OpenAIRE

    ALÍA OLAGÜE, JAIME

    2014-01-01

    Estudio del impacto acústico al que estará sometido el nuevo Hospital de Gandía, situado en el polígono Sancho Llop, cuyas principales fuentes de ruido son : el tráfico, el centro comercial La Vital y determinadas naves destinadas al sector terciario. Se realizarán medidas en un número suficiente de puntos de interés y se compararán los resultados con la normativa de la Generalitat Valenciana relativa al ruido. Alía Olagüe, J. (2013). Evaluación de la contaminación acústica en las inmediac...

  4. Single-phase dynamic voltage restorer based on a new chopper AC/DC/AC conversion%一种新型斩波 AC/DC/AC 变换的单相 DVR

    Institute of Scientific and Technical Information of China (English)

    巫付专; 侯婷婷; 韩梁; 冯占伟

    2015-01-01

    针对输入侧采用不可控整流AC/DC/AC结构的单相动态电压恢复器( DVR )输入侧功率因数低,谐波含量高等问题,提出了一种基于PWM斩波变换器的动态电压恢复器来补偿负载两端电压的跌落。该新型拓扑结构采用PWM斩波控制节省了直流侧电容,简化了滤波器设计,使输入侧线路中谐波含量降低,同时达到单位功率因数;电压检测采用单相信号构造成两相信号,利用瞬时无功理论对信号进行检测与处理,实时性高;搭建MATLAB/Simulink仿真和系统实验平台,验证其合理性和可行性。%In view of such problems as the low input side power factor of the single-phase dynamic voltage restorer ( DVR) with the structure of uncontrolled rectifier AC/DC/AC and high harmonic content , this paper proposed a DVR based on the PWM chopper to compensate for the voltage drop at the two load ends .The new topology , which a-dopted the PWM chopper control , saved the DC capacitor and simplified the filter design so that the harmonic content in the input-side circuit was reduced and the input side achieved the unit power factor .Single-phase signals were con-structed into two-phase signals to detect voltage and the instantaneous reactive power theory was used to detect and process the signals , which attained high real time .Finally, a MATLAB/Simulink simulation and experimental plat-form was constructed to verify the rationality and feasibility of the new structure .

  5. Variable transposition of eight maize activator (ac) elements located on the short arm of chromosome 1.

    Science.gov (United States)

    Sheridan, William F

    2011-09-01

    Eight Activator (Ac) transposable elements mapped to the maize chromosome arm 1S were assessed for Ac transposition rates. For each of the Ac stocks, plants homozygous for the single Ac element and the Ds reporter r1-sc:m3 on chromosome 10 were crossed as females by a homozygous r1-sc:m3 tester color-converted W22 line. The resulting ears produced mostly coarsely spotted kernels and a low frequency of either near-colorless fine-spotted kernels or nonspotted kernels. The relative frequency of these two types of near-colorless kernels differed among the eight Ac stocks. The extent to which increased Ac dosage results in nonspotted kernels may be Ac-specific. Although all of the Ac elements are in near-isogenic inbred W22 lines, they varied to a large extent in their transposition frequency. These differences might possibly result from structural differences among the Ac elements. Because one pair of Ac elements derived from Ac33 on chromosome arm 5S differed about 13-fold in transposition frequency and a second pair of Ac elements derived from Ac12 on chromosome arm 1S differed about 3-fold in transposition frequency, this is not a likely explanation for all eight Ac elements. The data presented here support the notion that the differences in transposition frequency of the eight Ac elements may be a reflection of variability in Ac transcription or accessibility of the transposase to the Ac element, resulting from differences in the chromatin environments wherein the Ac elements are located. This is the first report of variability in transposition rates among different Ac donor lines.

  6. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  7. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    We study the response of a model microelectrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes...... in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  8. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using....... Such a change will lead to a reduction of both low-frequency and high-frequency ac phase noise by more than an order of magnitude and can be carried out for all interferometers with the exception of multiple pass optical systems and high-resolution FFT spectrometers. It is pointed out that most homemade air...

  9. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  10. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi;

    2009-01-01

    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared to the c......This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...

  11. Experiments on Corona Discharge Under AC and DC Composite Voltage

    Institute of Scientific and Technical Information of China (English)

    ZHU Zhengyi; LI Ruihai; WANG Guoli; CHEN Can; JIA Zhidong; GUAN Zhicheng

    2012-01-01

    Converter transformers are one of the most important electrical apparatuses in the ultra high voltage(UHV) DC transmission systems.The valve side and the low voltage(LV) bushing are stressed by long-term AC and DC composite voltage leading to significant partial discharge(PD) and posing great danger to the insulation system.In this paper AC and DC composite voltage is applied on a metal needle-plate model to produce PD signal sequences,and then the pulse waveshape and frequency spectrum are analyzed and compared with PD signals under conventional AC or DC voltage.In the end,the phase-resolved distribution is analyzed to depict the new characteristics of PD under this composite voltage.

  12. Harmonic-free line-commutated ac/dc rectifiers

    Energy Technology Data Exchange (ETDEWEB)

    Villablanca, Miguel E. [Electrical Engineering Department, University of Santiago, P.O. Box 10233, Santiago (Chile)

    2009-11-15

    In this paper both a method and apparatus are applied to different configurations of line-commutated ac/dc rectifiers to reduce the distortion of currents flowing from the ac supply. The load may be either inductive or capacitive. The technology involves an accurate shaping of the dc current by using two self-commutated switches. This dc-current shaping is reflected back into the shaping of the ac input currents, which become pure sine waves. Thyristor-based rectifying operation is possible with a simple control circuit, which is able to deal with both rapid load variations and failures in the self-commutated switches. Furthermore, the overlap conduction of bridge thyristors is eliminated completely. Experimental verification is provided from a 400-V 30-kVA 50-Hz laboratory prototype. (author)

  13. Theory of the ac spin-valve effect.

    Science.gov (United States)

    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav

    2011-10-21

    The spin-valve complex magnetoimpedance of symmetric ferromagnet-normal-metal-ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance-the real part difference of the impedances of the parallel and antiparallel magnetization configurations-exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and negative values, reflecting resonant amplification and depletion of the spin accumulation, while the line shape for thin tunnel junctions is predicted to be purely Lorentzian. The ac spin-valve effect could be a technique to extract spin transport and spin relaxation parameters in the absence of a magnetic field and for a fixed sample size. PMID:22107552

  14. Evaluación de ácido acético como fumigante de mosquita blanca Bemisia tabaci (Gennadious) en laboratorio y campo Assessment of acetic acid like fumigant of silverleaf whitefly Bemisia tabaci (Gennadious) in laboratory and field

    OpenAIRE

    José Alfredo Samaniego Gaxiola; José Emmanuel Amaya Carrillo; José Luis Puente Manríquez

    2012-01-01

    El objetivo de este trabajo fue evaluar la capacidad del ácido acético (AA) como fumigante en contra de Bemisia tabaci (moquita blanca) que es un plaga de importancia nacional. En el laboratorio, se fumigó el insecto con tres regímenes de dosis - tiempo: (ambos medios), baja - largos y altas - cortos. En el campo, las hojas de calabaza de cuatro variedades fueron fumigadas con 8, 16 y 32 µg ml-1 de AA en tiempos de 20, 40 y 60 min; adicionalmente, se evaluó el daño en las hojas (fitotoxicidad...

  15. IoT con IBM y NI

    OpenAIRE

    Larrañaga Fuerte, Jon

    2016-01-01

    Trabajo realizado en la empresa ULMA Embedded Solutions El Internet of Things, abreviado IoT, es el concepto de dar conectividad a la red a cualquier objeto y poder capturar, almacenar y gestionar toda la información emitida por dichos objetos con la finalidad de automatizar procesos, permitiendo además la comunicación entre todos los objetos conectados. Este proyecto se centra en crear una solución IoT, logrando además la integración de dispositivos de National Instruments con software...

  16. Ortopedia maxilar en clases III con miniplacas

    OpenAIRE

    Murillo Prieto, Noemí

    2013-01-01

    Las maloclusiones esqueléticas de clase III, pese a ser de las menos prevalentes, suponen un reto en ortodoncia por su tendencia a empeorar con el tiempo. Cuando su causa principal es debida a un maxilar deficiente, a menudo se lleva a cabo la protracción del mismo con una máscara facial (MF) acompañada de una disyunción rápida del maxilar. La mayoría de los estudios avala la eficacia de la máscara facial y de la disyunción para inducir un movimiento hacia abajo y hacia delante del maxilar me...

  17. Hiperalgesia asociada al tratamiento con opioides

    Directory of Open Access Journals (Sweden)

    A. Gil Martín

    2014-10-01

    Full Text Available La hiperalgesia inducida por opioides es una reacción paradójica caracterizada por una percepción intensificada de dolor relacionada con el uso de estos medicamentos en ausencia de progresión de la enfermedad o de síndrome de retirada. A diferencia de los casos de tolerancia, definida como pérdida de potencia analgésica durante el uso prolongado de opioides, no se produce mejoría con el escalado de dosis. La hiperalgesia inducida por opioides se ha manifestado en pacientes con dosis de mantenimiento y retirada, pacientes con dosis elevadas o escalado de dosis y pacientes con dosis ultra bajas. Para establecer un diagnóstico diferencial es importante tener en cuenta que un incremento de dosis puede producir una mejoría temporal en pacientes con tolerancia pero no en los que han desarrollado hiperalgesia. La prevalencia de dicho fenómeno es desconocida, pero puede ser más frecuente de lo esperado y muchas veces no reconocido. El mecanismo subyacente no está bien definido, pero existen diversos estudios experimentales tanto en modelos animales como en humanos en los que se observa que la hiperalgesia no está desencadenada por un único factor, sino que son muchos los implicados. Entre los mecanismos propuestos destacan: la mediación del receptor NMDA (N-metil-D-aspartato activado por la liberación presináptica de glutamato, la modulación por la proteína-kinasa de calcio/calmodulina, el aumento en el número de nociceptores o la liberación de neurotransmisores excitadores. Se han realizado diversos estudios para describir la expresión y la relevancia de la hiperalgesia inducida por opioides en distintos grupos de pacientes: ex-adictos a opioides en tratamiento de mantenimiento con metadona, en exposición perioperatoria, en voluntarios sanos o en dolor crónico. Existen diferentes estrategias de tratamiento disponibles; entre las más aceptadas se encuentra la reducción en la dosis del opioide utilizado, la rotación del

  18. Intervista con Igor’ Pil’šikov

    Directory of Open Access Journals (Sweden)

    Ornella Discacciati

    2013-12-01

    Full Text Available   Igor’ Pil’šikov, Doktor nauk in Linguistica Generale e Teoria Letteraria, è Leading Researcher all’Istituto di cultura mondiale dell’Università statale Lomonosov di Mosca e Senior Researcher presso la Facoltà di Scienze Umanisitiche dell’Università statale di Tallin. Autore di numerosi saggi sulla teoria letteraria e la letteratura russa, ha pubblicato Batjuškov e la letteratura italiana (2003 e Leksika i frazeologija “Evgenija Onegina” (2008, con I.G. Dobromodov. Ha curato con M. Šapir e M. Akimova il volume di Boris Jarcho Metodologija točnogo literaturovedenija (2006. 

  19. Compuestos bioactivos en bebidas con capacidad antioxidante

    OpenAIRE

    López Froilán, Rebeca

    2015-01-01

    El consumo de bebidas no alcohólicas en España está constituido principalmente, además del agua mineral, y las bebidas refrescantes, por los zumos y las bebidas estimulantes con predominio del café. Estas bebidas, especialmente los zumos de frutas y el café, son una importante fuente de compuestos bioactivos. Concretamente el café es la mayor fuente de polifenoles en la dieta española, mientras que los zumos de frutas, junto con las frutas cítricas, constituyeron el 43 % de ingesta de vitamin...

  20. Pensamiento divergente y creatividad con personas mayores

    OpenAIRE

    Modino Catalán, Natalia

    2015-01-01

    Este trabajo revisa la información existente sobre el pensamiento divergente y la creatividad considerando estos aspectos muy importantes dando importancia a la neuroeducación como la mejor manera de transmitir los conocimientos para un aprendizaje a largo plazo. Se propondrá un proyecto de intervención para realizar con personas mayores que mejore estos valores y así su vida, ralentizando así el deterioro cognitivo asociado a la edad y se fomentan valores relacionados con la sociali...

  1. Diarrea en el paciente con diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Jainer Méndez-Flórez

    2015-10-01

    Full Text Available La diabetes mellitus es una enfermedad de gran prevalencia a nivel mundial que conlleva a muchas complicaciones, de las cuales las gastrointestinales son las mayormente olvidadas por el personal médico. Hasta el 22% de los pacientes con diabetes mellitus pueden tener diarrea y la causa de ello es multifactorial, pues incluye la neuropatía, efectos adversos de la terapia antidiabética, el aumento de la miocrobiota intestinal, entre otras. El tratamiento más efectivo es el control estricto de la glucemia; sin embargo, algunos medicamentos han sido utilizados con algún tipo de beneficio en estos pacientes.

  2. Competencias socioemocionales en alumnado con altas capacidades

    OpenAIRE

    Camús Ferri, María del Mar

    2016-01-01

    Competencias socio-emocionales en el alumnado con necesidades específicas de apoyo educativo. Descripción de la línea: Se pretende revisar y/o emplear, de manera científica y sistemática, los recursos didácticos y metodológicos principales para una intervención eficaz que permita la mejora de las competencias socio-emocionales en el alumnado con necesidades específicas de apoyo educativo.

  3. El apoyo social con pacientes de Leucemia

    OpenAIRE

    López Avilés, Maria del Carmen

    2012-01-01

    El apoyo social a personas con enfermedades graves y en tratamiento hospitalario ha sido desarrollado en buena parte por organizaciones sociales, siendo un ejemplo de ello ASLEUVAL. En este sentido se ha desarrollado un trabajo social con características propias, impulsando la acción social en las entidades para permitir generar una red de protección social a los pacientes y sus familias complementarias e imprescindibles de la actuación desde los hospitales. Es fundamental d...

  4. Introducing high performance distributed logging service for ACS

    Science.gov (United States)

    Avarias, Jorge A.; López, Joao S.; Maureira, Cristián; Sommer, Heiko; Chiozzi, Gianluca

    2010-07-01

    The ALMA Common Software (ACS) is a software framework that provides the infrastructure for the Atacama Large Millimeter Array and other projects. ACS, based on CORBA, offers basic services and common design patterns for distributed software. Every properly built system needs to be able to log status and error information. Logging in a single computer scenario can be as easy as using fprintf statements. However, in a distributed system, it must provide a way to centralize all logging data in a single place without overloading the network nor complicating the applications. ACS provides a complete logging service infrastructure in which every log has an associated priority and timestamp, allowing filtering at different levels of the system (application, service and clients). Currently the ACS logging service uses an implementation of the CORBA Telecom Log Service in a customized way, using only a minimal subset of the features provided by the standard. The most relevant feature used by ACS is the ability to treat the logs as event data that gets distributed over the network in a publisher-subscriber paradigm. For this purpose the CORBA Notification Service, which is resource intensive, is used. On the other hand, the Data Distribution Service (DDS) provides an alternative standard for publisher-subscriber communication for real-time systems, offering better performance and featuring decentralized message processing. The current document describes how the new high performance logging service of ACS has been modeled and developed using DDS, replacing the Telecom Log Service. Benefits and drawbacks are analyzed. A benchmark is presented comparing the differences between the implementations.

  5. Aligned Immobilization of Proteins Using AC Electric Fields.

    Science.gov (United States)

    Laux, Eva-Maria; Knigge, Xenia; Bier, Frank F; Wenger, Christian; Hölzel, Ralph

    2016-03-01

    Protein molecules are aligned and immobilized from solution by AC electric fields. In a single-step experiment, the enhanced green fluorescent proteins are immobilized on the surface as well as at the edges of planar nanoelectrodes. Alignment is found to follow the molecules' geometrical shape with their longitudinal axes parallel to the electric field. Simultaneous dielectrophoretic attraction and AC electroosmotic flow are identified as the dominant forces causing protein movement and alignment. Molecular orientation is determined by fluorescence microscopy based on polarized excitation of the proteins' chromophores. The chromophores' orientation with respect to the whole molecule supports X-ray crystal data. PMID:26779699

  6. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.;

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

  7. AC and Phase Sensing of Nanowires for Biosensing.

    Science.gov (United States)

    Crescentini, Marco; Rossi, Michele; Ashburn, Peter; Lombardini, Marta; Sangiorgi, Enrico; Morgan, Hywel; Tartagni, Marco

    2016-04-19

    Silicon nanowires are label-free sensors that allow real-time measurements. They are economical and pave the road for point-of-care applications but require complex readout and skilled personnel. We propose a new model and technique for sensing nanowire sensors using alternating currents (AC) to capture both magnitude and phase information from the sensor. This approach combines the advantages of complex impedance spectroscopy with the noise reduction performances of lock-in techniques. Experimental results show how modifications of the sensors with different surface chemistries lead to the same direct-current (DC) response but can be discerned using the AC approach.

  8. Active Power Regulation based on Droop for AC Microgrid

    DEFF Research Database (Denmark)

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi;

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes......In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed...

  9. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling. The vol......This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...

  10. Development of an AC Module System: Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  11. Advanced Sensors for Accurate, Broadband AC Voltage Metrology

    Science.gov (United States)

    Lipe, Thomas E.; Kinard, Joseph R.; Novotny, Donald B.; Sims, June E.

    2013-06-01

    We report on advances in ac voltage metrology made possible by a new generation of Multijunction Thermal Converters (MJTCs). Although intended for use primarily in high-frequency (1 MHz to 100 MHz) metrology, their exceptional low-frequency qualities, combined with a large dynamic range, makes these MJTCs excellent devices for the frequency range 10 Hz to 100 MHz at voltages from 1 V to 20 V, depending on the design. We anticipate that these devices will form the future basis for ac voltage metrology at the National Institute of Standards and Technology (NIST).

  12. AC transport in graphene-based Fabry-Perot devices

    OpenAIRE

    Rocha, Claudia G; Torres, Luis E. F. Foa; Cuniberti, Gianaurelio

    2009-01-01

    We report on a theoretical study of the effects of time-dependent fields on electronic transport through graphene nanoribbon devices. The Fabry-P\\'{e}rot interference pattern is modified by an ac gating in a way that depends strongly on the shape of the graphene edges. While for armchair edges the patterns are found to be regular and can be controlled very efficiently by tuning the ac field, samples with zigzag edges exhibit a much more complex interference pattern due to their peculiar elect...

  13. Interlayer thermal conductivity of rubrene measured by ac-calorimetry

    Science.gov (United States)

    Zhang, H.; Brill, J. W.

    2013-07-01

    We have measured the interlayer thermal conductivity of crystals of the organic semiconductor rubrene, using ac-calorimetry. Since ac-calorimetry is most commonly used for measurements of the heat capacity, we include a discussion of its extension for measurements of the transverse thermal conductivity of thin crystals of poor thermal conductors, including the limitations of the technique. For rubrene, we find that the interlayer thermal conductivity, ≈0.7 mW/cm . K, is several times smaller than the (previously measured) in-layer value, but its temperature dependence indicates that the interlayer mean free path is at least a few layers.

  14. A.C. losses in current-carrying superconductors

    International Nuclear Information System (INIS)

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  15. Interplay between electron overheating and ac Josephson effect

    Science.gov (United States)

    De Cecco, A.; Le Calvez, K.; Sacépé, B.; Winkelmann, C. B.; Courtois, H.

    2016-05-01

    We study the response of high-critical-current proximity Josephson junctions to a microwave excitation. Electron overheating in such devices is known to create hysteretic dc voltage-current characteristics. Here we demonstrate that it also strongly influences the ac response. The interplay of electron overheating and ac Josephson dynamics is revealed by the evolution of the Shapiro steps with the microwave drive amplitude. Extending the resistively shunted Josephson junction model by including a thermal balance for the electronic bath coupled to phonons, a strong electron overheating is obtained.

  16. Study of AC/RF properties of SRF ingot niobium

    Energy Technology Data Exchange (ETDEWEB)

    Dhakal, Pashupati; Tsindlekht, Menachem I; Genkin, Valery M; Ciovati, Gianluigi; Myneni, Ganapati Rao

    2013-09-01

    In an attempt to correlate the performance of superconducting radiofrequency cavities made of niobium with the superconducting properties, we present the results of the magnetization and ac susceptibility of the niobium used in the superconducting radiofrequency cavity fabrication. The samples were subjected to buffer chemical polishing (BCP) surface and high temperature heat treatments, typically applied to the cavities fabrications. The analysis of the results show the different surface and bulk ac conductivity for the samples subjected to BCP and heat treatment. Furthermore, the RF surface impedance is measured on the sample using a TE011 microwave cavity for a comparison to the low frequency measurements.

  17. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung

    2005-01-01

    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  18. System and method for determining stator winding resistance in an AC motor using motor drives

    Science.gov (United States)

    Lu, Bin; Habetler, Thomas G; Zhang, Pinjia

    2013-02-26

    A system and method for determining the stator winding resistance of AC motors is provided. The system includes an AC motor drive having an input connectable to an AC source and an output connectable to an input terminal of an AC motor, a pulse width modulation (PWM) converter having switches therein to control current flow and terminal voltages in the AC motor, and a control system connected to the PWM converter. The control system generates a command signal to cause the PWM converter to control an output of the AC motor drive corresponding to an input to the AC motor, selectively generates a modified command signal to cause the PWM converter to inject a DC signal into the output of the AC motor drive, and determines a stator winding resistance of the AC motor based on the DC signal of at least one of the voltage and current.

  19. en personas con el VIH/SIDA

    Directory of Open Access Journals (Sweden)

    Ximena Palacios Espinosa

    2006-01-01

    Full Text Available El objetivo de este estudio fue hallar la relación de la intención e ideación suicida con algunas variables sociodemográficas, las características de la enfermedad, el tratamiento antirretroviral y los aspectos piscoafectivos en personas con el VIH/SIDA que residen en Bogotá (Colombia y pertenecientes a una fundación. Para ello, se tomó una muestra de 75 pacientes con VIH positivo a quienes se evaluó a través de una entrevista semiestructurada y dos instrumentos: el inventario de depresión de Beck (IBD y la escala de Ideación Suicida (SSI. Los resultados mostraron que solo 29 personas tenían ideación suicida y 10 intención suicida: De los 10 solo 2 sujetos tenían intención después del diagnóstico. Se encontró una relación estadística significativa para ideación suicida e intención suicida con edad, estrato socioeconómico, estado civil, orientación sexual, las características de la enfermedad, el tratamiento antirretroviral y los aspectos piscoafectivos.

  20. Biosensor con nanoparticulas metálicas

    OpenAIRE

    Pino González de la Higuera, Pablo del; Pelaz, Beatriz; Polo, Ester; Grazú Bonavia, Valeria; MARTÍNEZ DE LA FUENTE, Jesús; Parro-García, Víctor

    2012-01-01

    La presente invención se refiere a un biosensor donde la detección del analito se realiza de forma visual por el cambio de color en las zonas del soporte en que el analito esté presente producido por las nanopartículas al ser irradiadas con una fuente de luz externa

  1. InterCon Travel Health: Case B

    Science.gov (United States)

    Truman, Gregory E.; Pachamanova, Dessislava A.; Goldstein, Michael A.

    2010-01-01

    InterCon provides services to health insurers of foreign tourists who travel to the United States and Canada. Management wants to implement a new information system that will deal with several operational problems, but it is having difficulty securing the capital resources to fund the system's development. After an initial failure, the chief…

  2. Conversazioni autobiografiche con Albino Sacco-Casamassima

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2004-03-01

    Full Text Available Nel 1948 venne Olivetti a Matera. Olivetti venne a Matera con un certo ambasciatore americano che praticamente aveva preparato o stava dando una mano per il piano Marschall, venne a Matera e mi vollero incontrare. Io sono stato chiamato dalla piazza, stavo nella piazza, era il mese di luglio, una cosa di questo genere, e andai in un bar, un bar ad angolo mi ricordo in Via Don Minzioni, dove questo Olivetti mi disse 'ma lei che cosa fa coi sassi?' 'Che cos'è questa storia?' Gli raccontai un po' che cosa facevo io con questi amici, avevamo fatto questo, insomma tutto quello che avevamo fatto nei sassi e che volevamo preparare ancora per presentare a qualcuno un piano di revisionamento dei sassi. Mi ricordo, era la prima volta che avevo visto Adriano Olivetti, ne avevo sentito parlare però non avevo mai visto quest'uomo con gli occhi celesti, minuto, coi capelli bianchi, riccioluto, con una cravatta bianca, cosa che mi fece impressione, una specie di angelo.

  3. Procesamiento de argumentos en personas con afasia

    Directory of Open Access Journals (Sweden)

    Luis Martínez

    2012-06-01

    Full Text Available En las personas con afasia se alteran diversos procesos lingüísticos. Entre las alteraciones más comunes tenemos aquellas que se producen en el procesamiento sintáctico, lo cual es evidente en el procesamiento de los argumentos. Investigaciones previas realizadas a sujetos con afasia reflejan un procesamientodeficiente de argumentos, lo cual se hace más evidente a medida que el número de argumentos aumenta. Se ha encontrado que mientras mayor es la complejidad en la estructura de la oración, los sujetos afásicos manifiestan mayores dificultades en el procesamiento de la misma. El presente estudio indaga en las dificultades que presentan los sujetos adultos con trastornos afásicos hablantes de español en el procesamiento de argumentos durante tareas de descripción. Este trabajo corrobora la evidencia de que los sujetos con afasia manifiestan un manejo deficiente en el procesamiento de argumentos en las tareas señaladas.

  4. Sarcoma de Kaposi en paciente con SIDA

    Directory of Open Access Journals (Sweden)

    Jesús Ramón León Polanco

    2015-01-01

    Full Text Available Se presenta el caso de un paciente masculino de 33 años de edad, con antecedentes de VIH-SIDA desde hace 10 años, que se mantiene en tratamiento con antirretrovirales. Durante todo este tiempo ha presentado varios episodios de infecciones respiratorias, incluyendo tuberculosis pulmonar 5 años atrás. Acude a consulta refiriendo edemas en miembros inferiores acompañado de lesiones en piel de color violáceo de un año de evolución, previamente interpretado como linfangitis rebelde al tratamiento y que se extendió a la cara interna de los muslos y a los miembros inferiores. Con pérdida de peso, no prurito en las lesiones, fiebre, lesiones en la mucosa oral. Se determinó hemoglobina 89 g/L, leucocitos 4,5 x 109 /L, se estudiaron las funciones hepática y renales resultando normales. Radiografías de tórax y ultrasonido abdominal normales. Se realizó estudio anatomopatológico de piel que informó Sarcoma de Kaposi. Se impuso tratamiento con quimioterapia

  5. IoT con Raspberry Pi

    OpenAIRE

    García Muelas, Carlos

    2015-01-01

    Estudio de diferentes plataformas software y hardware del internet de las cosas. Aplicación real con Raspberry Pi. Estudi de diferents plataformes programari i maquinari de l'internet de les coses. Aplicació real amb Raspberry Pi. Bachelor thesis for the Telecommunication Technologies program on Telematics.

  6. Ocio Inclusivo para personas con discapacidad

    OpenAIRE

    Ruiloba Arce, Marta María

    2014-01-01

    Mi proyecto de Fin de Grado trata del ocio inclusivo para personas con discapacidad intelectual. Como educadora social apuesto por la inclusión social para la mejora de calidad de vida de las personas, siendo uno de los medios más efectivos para lograr una sociedad sin diferencias ni prejuicios. [...

  7. Modulation schemes with enhanced switch thermal distribution for single-phase AC-DC-AC reduced-switch converters

    DEFF Research Database (Denmark)

    Qin, Zian; Loh, Poh Chiang; Blaabjerg, Frede

    2015-01-01

    ulation schemes can significantly change the performance of a power converter in steady state, and they have been extensively studied, but mostly directed to three-phase topologies, where triplen offsets are added. Single-phase systems, including ac-dc-ac systems, are less widely pursued, even...... among their switches, while keeping their dc-link voltages low. Single points of failure are thus minimized, allowing the converters to have longer lifetimes. Simulation and experimental results have demonstrated the intended performances and hence verifying the idea....

  8. Impacts on Power Factor of AC Voltage Controllers Under Non-Sinusoidal Conditions

    Directory of Open Access Journals (Sweden)

    Mukhtiar Ahmed Mahar

    2012-04-01

    Full Text Available AC-AC conversion is obtained with the help of Cyclo-converters, DC Link converters and AC Voltage Controllers. AC voltage controllers are also referred to as voltage regulators. Main issue concerned to these converters is that they generate harmonics due to periodic variable structure system. The generated harmonics create disturbances and degrade the performance of converter. The power factor of supply side is affected due to these harmonics. This paper focuses on source side power factor of ac voltage controllers under nonsinusoidal conditions. In order to observe the power factor, measurement tool of power factor and simulation model of ac voltage controller is also developed in MATLAB software.

  9. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  10. Factores de Accesibilidad Relacionados con Muerte Perinatal

    Directory of Open Access Journals (Sweden)

    Vilma del Socorro Catalán Álvarez

    2010-12-01

    Full Text Available Introducción: Objetivo Describir diferencias de factores relacionados con accesibilidad a servicios de salud, entre un grupo de mujeres que tuvieron parto en instituciones prestadoras de servicios de salud de Bucaramanga, cuyos productos sufrieron muerte perinatal y otro grupo con productos vivos, procedentes de Lebrija Santander año 2004. Materiales y métodos: estudio de caso descriptivo, retrospectivo. De 15 muerte perinatal reportadas, sólo 7 cumplían criterios de inclusión. Por cada muerte perinatal, se seleccionaron por conveniencia, 3 madres con niños vivos. Las variables estudiadas, mediante frecuencia absoluta y relativa, fueron: Características de la madre, del niño, Oportunidad, Percepción de atención, Funcionalidad, Costos. Resultados: 6 muerte perinatal previsibles, 1 no previsible. 3 pertenecían al régimen subsidiado, 1 al contributivo, 3 no aseguradas. Se observó, falta de oportunidad para remisión de madres e intervención del parto. Mujeres con 3 ó más controles, presentaron mayor frecuencia relativa de muerte perinatal. También se observó insatisfacción en la percepción de atención, en 3 aspectos estudiados, en 3 niveles de atención. Discusión y Conclusiones: Implementar políticas encaminadas a mejorar la oportunidad de atención materna-perinatal, facilitando acceso oportuno para prestación de servicios de salud. Controles prenatales enfocados en búsqueda de factores relacionados con muerte perinatal. Fortalecer Sistemas de Vigilancia Epidemiológica y Centro Regulador de Urgencias. (Rev Cuid 2010;1(1:26-34.Palabras clave: Mortalidad perinatal, Accesibilidad, Servicios de Salud. (Fuente DeCs, BIREME.

  11. Ependimoma myxopapilar sacro gigante con osteolisis

    Science.gov (United States)

    Ajler, Pablo; Landriel, Federico; Goldschmidt, Ezequiel; Campero, Álvaro; Yampolsky, Claudio

    2014-01-01

    Objetivo: la presentación de un caso de una paciente con un ependimoma sacro con extensa infiltración y destrucción ósea local. Descripción del caso: una mujer de 53 años acudió a la consulta por dolor lumbosacro y alteraciones sensitivas perineales y esfinterianas. La imágenes por Resonancia Magnética (IRM) y la Tomografía Axial Computada (TAC) mostraron una lesión expansiva gigante a nivel S2-S4 con extensa osteólisis e invasión de tejidos adyacentes. Se realizó una exéresis tumoral completa con mejoría del estatus funcional. La anatomía patológica informó ependimoma mixopapilar. Discusión: la extensión de la resección quirúrgica es el mejor predictor de buen pronóstico. El tratamiento radiante se reserva como opción adyuvante para las resecciones incompletas y recidiva tumoral. La quimioterapia sólo debería utilizarse en casos en que la cirugía y la radioterapia estén contraindicadas. Conclusión: Los ependimomas mixopapilares sacros con destrucción ósea y presentación intra y extradural son muy infrecuentes y deben ser tenidos en cuenta entre los diagnósticos diferenciales preoperatorios. Su resección total, siempre que sea posible, es la mejor alternativa terapéutica. PMID:25165615

  12. Manejo de conductos radiculares con curvatura marcada

    Directory of Open Access Journals (Sweden)

    Jorge Mario Nuñez Duran

    2013-10-01

    Full Text Available Las variaciones anatómicas en dientes con conductos que poseen dilaceraciones hacen del tratamiento de endodonciaun reto o una complicación relativa, en donde el clínico debe desarrollar toda su habilidad y el uso de instrumentosespeciales que faciliten u optimicen la terapia de conductos radiculares. La toma de radiografías previas con diferentesangulaciones y el estudio minucioso de ellas, darán una ayuda fundamental para conocer más detalladamente estacomplicación anatómica, que en algunos casos es muy frecuente. El uso de instrumental más flexible y resistentepermite llegar con mayor precisión y seguridad a la parte apical sin que se corra el riesgo de fracturar los instrumentos,limpiándolos y modelándolos en toda su extensión para poder obturarlos de una manera correcta.El uso de limas de menor calibre, precurvadas, permite acceder a la porción dilacerada de la raíz. Este es un métodoeficaz para prevenir la perdida de longitud de trabajo y evitar así las perforaciones de las raíces durante la preparación.Dentro de los errores más comunes durante la instrumentación de los conductos está la perdida de longitud detrabajo, junto con la transportación del foramen apical, ya sea de manera externa o interna. En el presente artículose menciona el uso de nuevas y mejores técnicas usadas para poder evitar este tipo de errores y se muestra un casoclínico del manejo de un molar superior con una curvatura de 40 grados que fue preparado y obturado exitosamentecon el sistema Protaper (Dentsply- maillefer.

  13. La verificación de las fuentes sonoras en la acreditación de laboratorios de ensayos acústicos

    OpenAIRE

    Pedrero González, Antonio; Sánchez Bote, José Luis; Diaz Sanchidrian, Cesar; Navacerrada Saturio, Maria Angeles

    2015-01-01

    La norma UNE-EN ISO/IEC 17025 establece los requisitos generales para la competencia en la realización de ensayos y sirve de referencia para la acreditación de los laboratorios. Entre los requisitos que establece está el de asegurar que los equipos utilizados en las mediciones cumplen con las especificaciones que determinan las normas de ensayo correspondientes. En este trabajo se analizan los requisitos que se imponen a las fuentes sonoras en los ensayos acústicos más usuales. Se describen l...

  14. Caracterización anual del metabolismo de las acículas de Pinus pinaster (Aiton) mediante procedimientos transcriptómicos y metabolómicos

    OpenAIRE

    Cañas, Rafael A.; Canales, Javier; Muñoz, C; Ávila, Concepción; García-Martin ML; Cánovas, Francisco M.

    2013-01-01

    El presente trabajo pretende iniciar una serie de estudios sobre el metabolismo nitrogenado en árboles adultos de la conífera Pinus pinaster (Aiton) en condiciones naturales. Durante un año completo se ha caracterizado el metabolismo de las acículas de árboles de P. pinaster que crecen en el paraje natural de Los Reales de Sierra Bermeja, Estepona (Málaga). Para ello se han seguido dos aproximaciones diferentes. En primer lugar se ha analizado la expresión génica mediante el em...

  15. Diseño y acondicionamiento acústico de la sala de grabación musical de Basic Productions en Valencia

    OpenAIRE

    CORBI ALBELLA, DIDAC

    2013-01-01

    El objetivo de este proyecto es el estudio del comportamiento del sonido en recintos cerrados para después realizar con éxito el diseño y acondicionamiento de la sala de grabación de los estudios Basic Productions. Esta sala será utilizada para grabaciones musicales por lo que se tendrá en cuenta esto a la hora de valorar las condiciones acústicas más adecuadas para este. Se considerará como objetivo principal el control del tiempo de reverberación para obtener uno adecuado al ...

  16. Aportes a la conversión DC-AC en sistemas fotovoltaicos: módulos inversores conectados en cascada

    OpenAIRE

    Álvarez López, Ramón Antonio

    2015-01-01

    En este trabajo se propone la evaluación de desempeño de un nuevo enfoque de inversor multinivel fotovoltaico. El inversor multinivel se basa en la conexión en cascada de micro-inversores con etapa intermedia de elevación y reducción de voltaje. La etapa intermedia es un convertidor DC-DC SEPIC que garantiza los niveles de voltaje requeridos en los respectivos buses de DC, para la conversión DC-AC. Adicionalmente, el convertidor DC-DC SEPIC realiza el seguimiento del punto de máxima potencia ...

  17. Terapias alternativas con animales para niños con necesidades especiales

    OpenAIRE

    Cea-Chueca, Aihnoa

    2014-01-01

    El presente trabajo de fin de grado consiste en la realización de un análisis y descripción de la literatura acerca de las distintas terapias animales, destinadas a niños con necesidades especiales: cómo y por qué surgieron, en qué consisten las terapias, cómo podemos utilizarlas, etc. Las terapias alternativas con animales se conocen como una alternativa terapéutica, donde se utiliza a un animal como co-terapeuta para poder desarrollar diferentes capacidades de los niños con necesidades espe...

  18. Cambios psicológicos en pacientes con espondiloartritis axial tratados con infliximab

    OpenAIRE

    Morlà Novell, Rosa M.

    2015-01-01

    Es conocido que los pacientes con enfermedades reumáticas presentan alteraciones psicológicas relacionadas con su enfermedad articular crónica. Algunos estudios reportan el beneficio de las terapias biológicas en las espondiloartritis (EsP), pero son pocos los datos acerca del impacto de los fármacos biológicos en los síntomas psicológicos. El objetivo del estudio fue el de analizar la influencia del tratamiento con un fármaco biológico anti-TNFα, infliximab (IFX), en los síntomas de ansi...

  19. Variables socionutricionales de hogares mazahuas integrados por preescolares desnutridos con madres con obesidad y sin obesidad

    OpenAIRE

    Conzuelo González, Viridiana Vanessa; Vizcarra Bordi, Ivonne

    2009-01-01

    El primer objetivo fue conocer cuántos menores de cinco años con diferentes grados de desnutrición tienen una madre con sobrepeso/obesidad/ en una comunidad indígena que vive en extrema pobreza y bajo condiciones de migración masculina internacional. El segundo fue comparar tres variables socionutricionales (ingreso familiar, educación de la madre y adecuación nutrimental de la dieta diaria) entre estos hogares y los hogares con desnutrición infantil y madres sin obesidad. Se realizó un est...

  20. El empleo con apoyo como indicador de calidad de vida en personas con discapacidad intelectual

    OpenAIRE

    Santamaría Domínguez, Mónica

    2014-01-01

    [ES]Esta tesis doctoral se desarrolló en el Instituto Universitario de Integración en la Comunidad (INICO) de la Universidad de Salamanca, como parte de una de sus principales líneas de investigación dedicada a la Inclusión Laboral, Empleo con Apoyo y Políticas Sociales. Cuya finalidad fue profundizar en el conocimiento de la calidad de vida de las personas con discapacidad intelectual que se encontraban trabajando a través de la metodología del empleo con apoyo. Para la evaluación de la cali...

  1. Pacientes con Enfermedad de Alzheimer Presenil : Hallazgos con RM de alto campo (3T).

    OpenAIRE

    Núñez Marín, Fidel

    2013-01-01

    La enfermedad de Alzheimer (EA) Presenil se inicia antes de los 65 años, y ha sido relacionada con una diferente presentación clínica a la EA senil. En neuroimagen, se ha descrito un patrón de atrofia cerebral concordante con las diferencias clínicas. Se realizaron estudios de RM cerebral de alto campo (3T) a pacientes con EA presenil, EA senil y controles, que se procesaron para valorar diferencias en el grosor cortical. Se obtuvieron diferencias estadísticamente significativas de grosor cor...

  2. Distributed energy resources in grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep; Chen, Zhe;

    2010-01-01

    of future electrical power system. This paper gives an overview of DER units in the grid interactive ac microgrid. The options in structures and control methods of power electronics interfaced DER units are described. Instantaneous load sharing strategies among DER units in the islanded microgrid operations...

  3. Team-oriented Adaptive Droop Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Nasirian, Vahidreza; Guerrero, Josep M.;

    2014-01-01

    This paper proposes a distributed control strategy for voltage and reactive power regulation in ac Microgrids. First, the control module introduces a voltage regulator that maintains the average voltage of the system on the rated value, keeping all bus voltages within an acceptable range. Dynamic...

  4. Soliton ratchetlike dynamics by ac forces with harmonic mixing

    DEFF Research Database (Denmark)

    Salerno, Mario; Zolotaryuk, Yaroslav

    2002-01-01

    The possibility of unidirectional motion of a kink (topological soliton) of a dissipative sine-Gordon equation in the presence of ac forces with harmonic mixing (at least biharmonic) and of zero mean, is presented. The dependence of the kink mean velocity on system parameters is investigated...

  5. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...... are stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function....... Mathematically, our study refers to the expanding area of fractional calculus and we propose a systematic derivation of the fractional relaxation and fractional diffusion equations from the property of ac universality....

  6. Current Control of Grid Converters Connected with Series AC Capacitor

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang;

    2015-01-01

    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...

  7. Calculation of AC losses in large HTS stacks and coils

    DEFF Research Database (Denmark)

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad;

    2012-01-01

    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting...

  8. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;

    1998-01-01

    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...

  9. Equivalent Circuits For AC-Impedance Analysis Of Corrosion

    Science.gov (United States)

    Danford, M. D.

    1992-01-01

    Report presents investigation of equivalent circuits for ac-impedance analysis of corrosion. Impedance between specimen and electrolyte measured as function of frequency. Data used to characterize corrosion electrochemical system in terms of equivalent circuit. Eleven resistor/capacitor equivalent-circuit models were analyzed.

  10. Security analysis of interconnected AC/DC systems

    DEFF Research Database (Denmark)

    Eriksson, Robert

    2015-01-01

    This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid. The red...

  11. Direct Experimental Observation of a Practical AC Zeeman Force

    Science.gov (United States)

    Fancher, Charles; Pyle, Andrew; Rotunno, Andrew; Du, Shuangli; Aubin, Seth

    2016-05-01

    We present measurements of the spin-dependent AC Zeeman force produced by microwave magnetic near-field gradients on an atom chip. We measure the AC Zeeman force on ultracold 87 Rb atoms by observing its effect on the motion of atoms in free-fall and on those confined in a trap. We have studied the force as a function of microwave frequency detuning from a hyperfine transition at 6.8 GHz at several magnetic field strengths and have observed its characteristic bipolar and resonant features predicted by two-level dressed atom theory. We find that the force is several times the strength of gravity in our setup, and that it can be targeted to a specific hyperfine transition while leaving other hyperfine states and transitions relatively unaffected. We find that our measurements are reasonably consistent with theory and are working towards a parameter-free comparison. AC Zeeman potentials offer the possibility of targeting qualitatively different trapping potentials to different spin states, a capability currently absent from the toolbox of atomic quantum control techniques. In particular, an AC Zeeman potential could be used as the beamsplitter for a spin-dependent atom interferometer or for engineering a quantum gate. Work supported by AFOSR and W&M, and in part by AFRL.

  12. Introducing AC Inductive Reactance with a Power Tool

    Science.gov (United States)

    Bryant, Wesley; Baker, Blane

    2016-01-01

    The concept of reactance in AC electrical circuits is often non-intuitive and difficult for students to grasp. In order to address this lack of conceptual understanding, classroom exercises compare the predicted resistance of a power tool, based on electrical specifications, to measured resistance. Once students discover that measured resistance…

  13. Rethinking Rectification: AC-DC Power Supply in Package

    DEFF Research Database (Denmark)

    Pejtersen, Jens; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Rectification of AC mains voltage is almost exclusively implemented with passive diode bridge rectifiers for power applications below 100 W. The diode bridge rectifier is reliable, cost effective and easy to use. But it is also lossy, nonlinear and passive. Thus reducing the power conversion...

  14. Dielectric relaxation and ac conductivity of sodium tungsten phosphate glasses

    Indian Academy of Sciences (India)

    B Singh; P S Tarsikka; L Singh

    2002-10-01

    Studies of dielectric relaxation and ac conductivity have been made on three samples of sodium tungsten phosphate glasses over a temperature range of 77–420 K. Complex relative permittivity data have been analyzed using dielectric modulus approach. Conductivity relaxation frequency increases with the increase of temperature. Activation energy for conductivity relaxation has also been evaluated. Measured ac conductivity (m()) has been found to be higher than dc at low temperatures whereas at high temperature m() becomes equal to dc at all frequencies. The ac conductivity obeys the relation ac() = A over a considerable range of low temperatures. Values of exponent are nearly equal to unity at about 78 K and the values decrease non-linearly with the increase of temperature. Values of the number density of states at Fermi level ((F)) have been evaluated at 80 K assuming values of electron wave function decay constant to be 0.5 (Å)-1. Values of (F) have the order 1020 which are well within the range suggested for localized states. Present values of (F) are smaller than those for tungsten phosphate glasses.

  15. AcTA: Accessdatabase Telen met toekomst - Alterra

    OpenAIRE

    Smit, A.; Zwart, K.B.

    2003-01-01

    Binnen het project Telen met toekomst wordt een groot aantal metingen verricht, die op een overzichtelijke manier moeten worden opgeslagen. Er is gekozen voor en relationele database in MS-Access. De database zal AcTA worden genoemd (Access-database voor Telen met toekomst Alterra). Dit rapport bevat de beschrijving van de structuur van de database.

  16. Evolution of ac conductivity in nonequilibrium warm dense gold

    International Nuclear Information System (INIS)

    Using a chirped pulse probe technique, we have obtained single-shot measurements of temporal evolution of ac conductivity at 1.55 eV (800 nm) during electron energy relaxation in nonequilibrium warm dense gold with energy densities up to 4.1 MJ/kg (8*1010 J/m3). The results uncover important changes that have been masked in an earlier experiment. Equally significant, they provide valuable tests of an ab initio model for the calculation of electron heat capacity, electron-ion coupling, and ac conductivity in a single, first principles framework. While measurements of the real part of ac conductivity corroborate our theoretical temperature-dependent electron heat capacity, they point to an electron-ion coupling factor of 2.2*1016 W/m3K, significantly below that predicted by theory. In addition, measurements of the imaginary part of ac conductivity reveal the need to improve theoretical treatment of intraband contributions at very low photon energy. (authors)

  17. Combined AC electroosmosis and dielectrophoresis for controlled rotation of microparticles.

    Science.gov (United States)

    Walid Rezanoor, Md; Dutta, Prashanta

    2016-03-01

    Electrorotation is widely used for characterization of biological cells and materials using a rotating electric field. Generally, multiphase AC electric fields and quadrupolar electrode configuration are needed to create a rotating electric field for electrorotation. In this study, we demonstrate a simple method to rotate dielectrophoretically trapped microparticles using a stationary AC electric field. Coplanar interdigitated electrodes are used to create a linearly polarized nonuniform AC electric field. This nonuniform electric field is employed for dielectrophoretic trapping of microparticles as well as for generating electroosmotic flow in the vicinity of the electrodes resulting in rotation of microparticles in a microfluidic device. The rotation of barium titanate microparticles is observed in 2-propanol and methanol solvent at a frequency below 1 kHz. A particle rotation rate as high as 240 revolutions per minute is observed. It is demonstrated that precise manipulation (both rotation rate and equilibrium position) of the particles is possible by controlling the frequency of the applied electric field. At low frequency range, the equilibrium positions of the microparticles are observed between the electrode edge and electrode center. This method of particle manipulation is different from electrorotation as it uses induced AC electroosmosis instead of electric torque as in the case of electrorotation. Moreover, it has been shown that a microparticle can be rotated along its own axis without any translational motion. PMID:27014394

  18. Heat Transfer Analysis for Industrial AC Electric Arc Furnace

    Institute of Scientific and Technical Information of China (English)

    (U)nal (C)amdali; Murat Tun(c)

    2005-01-01

    The heat transfer analysis was performed for an AC electric arc furnace (EAF). Heat losses by conduction, convection and radiation from outer surface, roof, bottom and electrodes of EAF were determined in detail. Some suggestions about decreasing heat losses were presented.

  19. Acústica, fluidos y termodinámica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica. Estática de fluidos. Dinámica de fluidos y fluidos reales. Temperatura y propagación del calor. Primer principio de la Termodinámica. Gases ideales. Segundo principio de la Termodinámica.

  20. Exchange anisotropy determined by magnetic field dependence of ac susceptibility

    Science.gov (United States)

    Rodríguez-Suárez, R. L.; Vilela Leão, L. H.; de Aguiar, F. M.; Rezende, S. M.; Azevedo, A.

    2003-10-01

    ac susceptibility measurements of ferromagnetic/antiferromagnetic (FM/AF) bilayers are usually performed as a function of the temperature. In this work we describe measurements of transverse biased ac susceptibility (χt) of FM/AF bilayers as a function of the applied magnetic field H0. The measurements were carried out at room temperature by means of an ac magneto-optical Kerr effect susceptometer. The χt-1(H0) dependence, at the saturation magnetization regime, exhibits a linear behavior with the applied field parallel and perpendicular to the exchange bias direction. The linear extrapolation of χt-1 versus H0 cuts the abscissa at asymmetrical values of field due to the exchange bias coupling. The inverse susceptibility is calculated in the saturation regime by a model, which takes into account the free energy of both layers plus a term corresponding to the interfacial coupling. The exchange coupling field (HE) and uniaxial anisotropy (HU) are extracted from the best fit to the experimental results. The results obtained are crosschecked by those obtained from ferromagnetic resonance (FMR) and dc magnetometry. The measurements of the exchange bias and the uniaxial field in all of the three analyzed bilayers gave values that are consistently lower when measured by FMR than those obtained by ac and dc magnetometry. It is argued that the apparently discrepant values of HE and HU, obtained by different techniques, might be explained by existence of unstable AF grains at the AF/FM interface.

  1. A simple technique for a.c. conductivity measurements

    Indian Academy of Sciences (India)

    R Padma Suvarna; K Raghavendra Rao; K Subbarangaiah

    2002-12-01

    An inexpensive, indigenous and a simple electronic instrument based on voltage follower, current–to–voltage converter, zero crossing detector and a phase detector has been developed for measurement of a.c. conductivity. Real and imaginary parts of complex impedance are determined for a given sample as a function of frequency and the given sample is represented by a pure electronic model.

  2. An overview of the ALMA Common Software (ACS) .

    Science.gov (United States)

    Di Marcantonio, P.; Cirami, R.; Caproni, A.; Chiozzi, G.; Jeram, B.; Sommer, H.; Harrington, S.; Zagar, K.; Plesko, M.; Sekoranja, M.

    The ALMA Common Software (ACS) is an application framework designed to provide a common and homogeneous software architecture and infrastructure, spanning the end to end needs of an Astronomical observatory, from the Telescope Control system to high-level data flow management. ACS offers, at the lower level, several basic services needed for object-oriented distributed computing like transparent remote object invocation, object deployment and location, distributed error, alarm handling, logging and events. On top of this it provides an application architecture based on the Component/Container paradigm that fosters sharing and reusing of software components. Although developed for the ALMA project, ACS is now used by several other projects worldwide, among which the Italian Sardinia Radio Telescope (SRT). Besides, there is an active community that shares ideas, concepts and actual software components. Major drivers for this diffusion were the choice of adopting the LGPL public license and the adoption of CORBA, a free but reliable and widely used middleware software. In this paper we present an overview of the main features of ACS, emphasizing in particular the role of INAF-OAT in this project.

  3. Container-component model and XML in ALMA ACS

    Science.gov (United States)

    Sommer, Heiko; Chiozzi, Gianluca; Zagar, Klemen; Voelter, Markus

    2004-09-01

    ALMA software, from high-level data flow applications down to instrument control, is built using the ACS framework. To meet the challenges of developing distributed software in distributed teams, ACS offers a container/component model that integrates the use of XML transfer objects. ACS containers are built on top of CORBA and are available for C++, Java, and Python, so that ALMA software can be written as components in any of these languages. The containers perform technical aspects of the software system, while components can focus on the implementation of functional requirements. Like Web services, components can use XML to exchange structured data by value. For Java components, the container seamlessly integrates the use of XML binding classes, which are Java classes that encapsulate access to XML data through type-safe methods. Binding classes are generated from XML schemas, allowing the Java compiler to enforce compliance of application code with the XML schemas. This presentation will explain the capabilities of the ACS container/component model, and how it relates to other middleware technologies that are popular in industry.

  4. On Conformal Field Theories With Extremal a/c Values

    CERN Document Server

    Zhiboedov, Alexander

    2013-01-01

    Unitary conformal field theories (CFTs) are believed to have positive (non-negative) energy correlators. Energy correlators are universal observables in higher-dimensional CFTs built out of integrated Wightman functions of the stress-energy tensor. We analyze energy correlators in parity invariant four-dimensional CFTs. The goal is to use the positivity of energy correlators to further constrain unitary CFTs. It is known that the positivity of the simplest one-point energy correlator implies that 1/3 <= a/c <= 31/18 where a and c are the Weyl anomaly coefficients. We use the positivity of higher point energy correlators to show that CFTs with extremal values of a/c have trivial scattering observables. More precisely, for a/c=1/3 and a/c=31/18 all energy correlators are fixed to be the ones of the free boson and the free vector theory correspondingly. Similarly, we show that the positivity and finiteness of energy correlators together imply that the three-point function of the stress tensor in a CFT cann...

  5. Conductivity measurements with trapezoidal a.c. magnetic fields

    NARCIS (Netherlands)

    Gijsbertse, E.A.; Klundert, van de L.J.M.

    1981-01-01

    The inductive response of normal metals to trapezoidal a.c. fields is studied theoretically as well as experimentally. A method is presented to determine the conductivity and its magnetic induction dependence from the decay of the induced voltage during periods of constant field. The correctness of

  6. 78 FR 42567 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-16

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION ACS Wireless, Inc.; Notice of Application June 25, 2013. Correction In notice document 2013-15658 beginning on page 39345 in the issue of Monday, July 1, 2013, make the following correction: On page...

  7. RELACIONES GENOMICAS ENTRE CUATRO ESPECIES DIPLOIDES DE TURNERA CON FLORES AMARILLAS (SERIE CANALIGERAE

    Directory of Open Access Journals (Sweden)

    Aveliano Mercedes Fernández

    2010-11-01

    Full Text Available

    Los rasgos morfológicos y citogenéticos de los híbridos artificiales entre cuatro especies diploides (2n = 10: T.concinna, T.Krapovickasii, T.scabra y T.subulata han sido estudiados. Los híbridos fueron intermedios en varios caracteres, como el color de las flores, la longitud, la anchura y forma de las semillas, en algunos rasgos se parecían a uno o al otro padre.
    Todos los híbridos interespecíficos mostraron un alto porcentaje de PMC con cinco bivalentes. La meiosis de T.subulata x T.scabra fue regular (5 II. En los otros híbridos fue grabada una baja frecuencia de trivalentes o cuadrivalentes; estos trivalentes y cuadrivalentes son evidencia de translocaciones recíprocas. Puentes y fragmentos en anafase I y II muestran la presencia de inversiones paracéntricas.
    Los análisis morfológicos y citogenéticos de los híbridos indican una estrecha relación entre T.scabra y T.subulata y entre T.concinna y T.Krapovickasii respectivamente. Esta última especie tiene un par de cromosomas con satélites grandes. T.scabra y T.concinna están más alejadas.
    El estudio citogenético de todos los híbridos entre estas especies confirmaría que son taxones independientes. Ellos tienen el mismo genoma básico, que designamos Asu Asu de T. subulata, Asc Asc para T.scabra, Ak Ak para T. Krapovickasii y Ac Ac para T.concinna.

  8. Evaluation of the behavior of PtPd/MWCNT electrocatalysts as ethylene glycol-tolerant electrodes for oxygen oxidation reaction (ORR); Evaluacion del comportamiento de electrocatalizadores tipo PtPd/MWCNT como electrodos para la reaccion de oxidacion del oxigeno (ORR) tolerantes al etilenglicol

    Energy Technology Data Exchange (ETDEWEB)

    Morales-Acosta, D.; Arriaga, L.G. [Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Pedro Escobedo, Queretaro (Mexico)]. E-mail: dmorales@cideteq.mx; Alvarez-Contreras, L. [Centro de Investigacion en Materiales Avanzados S. C., Chihuahua, Chihuahua (Mexico); Fraire Luna, S.; Rodriguez Varela, F.J. [Cinvestav, Unidad Saltillo, Ramos Arizpe, Coahuila, (Mexico)

    2009-09-15

    Pt-Pd/MWCNTs (atomic ratio Pt:Pd 43:57) and Pt/MWCNTs electrocatalysts were synthesized and evaluated as cathodes for oxygen reduction reaction (ORR) with the application of direct ethylene glycol fuel cells (DEGFC). A commercial PtC material was also evaluated as a reference. It was found that Pt-Pd/MWCNT has a capability for high tolerance to ethylene glycol (EG) and higher selectivity for ORR compared to a single Pt- cathode. As a result, the change in onset potential of the ORR, Eonset, in Pt-Pd/MWCNTs was considerably less than the change in Pt/MWCNTs or Pt/C. The average particle size (XRD) was 3.5nm and 4nm for Pt/MWCNTs and Pt-Pd/MWCNTs, respectively. A moderate degree of alloying was determined for the material. The application of Pt-Pd electrocatalysts in DEGFCs should be advantageous. [Spanish] Electrocatalizadores Pt-Pd/MWCNTs (relacion atomic Pt:Pd 43:57) y Pt/MWCNTs fueron sintetizados y evaluados como catodos para la reaccion de reduccion del oxigeno (ORR) con aplicacion del celdas de consumo directo de etilenglicol (Direct Ethylene Glycol Fuel Cells, o DEGFC). Como referencia, un material comercial tipo Pt/C fue tambien evaluado. Se encontro que Pt-Pd/MWCNTs tiene una alta capacidad de tolerancia al etilenglicol (EG) y una selectividad mayor hacia la ORR comparado con el catodo basado en Pt-solo. Como resultado, el cambio en potencial de inicio de la ORR, Eonset, en Pt-Pd/MWCNTs fue considerablemente menor que el cambio en Pt/MWCNTs o Pt/C. La talla de particula promedio (de XRD) fue 3.5 nm y 4 nm para Pt/MWCNTs y Pt-Pd/MWCNTs, respectivamente. Un moderado grado de aleacion fue determinado para el material. Una aplicacion ventajosa para electrocatalizadores tipo Pt-Pd debe ser en DEGFCs.

  9. Context based computational analysis and characterization of ARS consensus sequences (ACS) of Saccharomyces cerevisiae genome.

    Science.gov (United States)

    Singh, Vinod Kumar; Krishnamachari, Annangarachari

    2016-09-01

    Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS) requires an essential consensus sequence (ACS) for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC) denoted as ORC-ACS and non-replicating ACS sequences (nrACS), that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme. PMID:27508123

  10. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh

    2016-09-01

    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  11. Biocontrol activity of Paenibacillus polymyxa AC-1 against Pseudomonas syringae and its interaction with Arabidopsis thaliana.

    Science.gov (United States)

    Hong, Chi Eun; Kwon, Suk Yoon; Park, Jeong Mee

    2016-04-01

    Paenibacillus polymyxa AC-1 (AC-1) is a plant growth-promoting rhizobacterium (PGPR) that has been used as a soil inoculant for biocontrol of plant pathogenic fungi and to promote plant growth. In this study, we examine the effects of AC-1 on the bacterial phytopathogen Pseudomonas syringae and internal colonization of AC-1 by counting bacterial populations that colonize plants. AC-1 inhibited the growth of both P. syringae pv. tomato DC3000 (Pst) and P. syringae pv. tabaci (Pta) in a concentration-dependent manner in in vitro assays. Upon treatment of AC-1 dropping at root tip of axenically grown Arabidopsis, we found that most of the AC-1 was detected in interior of leaves of Arabidiopsis plants rather than roots after 5 days post infection, indicating systemic spreading of AC-1 occur. We examined further AC-1 colonization patterns in Arabidopsis mutants deficient in phytohormone signaling pathways. These results indicated that abscisic acid (ABA) and jasmonic acid (JA) signaling pathways positively and negatively contributed, respectively, to AC-1 colonization of leaves, whereas epiphytic accumulation of AC-1 around root tissues was not affected. This study shows that AC-1 is an effective biocontrol agent to suppress P. syringae growth, possibly owing to its colonization patterns as a leaf-inhabiting endophyte. The results showed in this work will help to expand our understanding of the mode of action of AC-1 as a biological control agent and consequently, its application in agriculture.

  12. Expression and immunocytochemical analysis of Autographa californica nucleopolyhedrovirus (AcMNPV) orf74 gene

    Institute of Scientific and Technical Information of China (English)

    SHI-HENG AN; ZHONG-JIANG GUO; XIN-MING YIN

    2006-01-01

    Autographa californica nucleopolyhedrovirus orf74 (Ac74) is located between 62 311 and 63 108bp in the AcMNPV genome, which encodes 265 amino acid residues with a predicted 31 kDa molecular weight. The homologues of Ac74 were searched using BLASTP in protein databases, GenBank/EMBL and SWISS-PROT. The result revealed that deduced Ac74 protein was homologous to the predicted products from 10 lepidoptera NPV ORFs. The multiple sequence alignments of Ac74 and its 10 homologues manifested only one amino acid residue was completely conserved. The transcript analysis revealed that the transcript of Ac74 was detected from 24-72 hours post-infection (hpi). The product of Ac74was detected at 24 hpi and lasted until 72 bpi by Western blot using anti-Ac74 antiserum,consistent with reverse transcriptase polymerase chain reaction results. These results suggested Ac74 was expressed during the later stages of infection. The product of Ac74 was 31 kDa in size, consistent with predicted molecular weight. The subcellular localization of Ac74 proteins manifested Ac74 protein in the cytoplasm, and was hardly present in the nucleus at 24 bpi. The fluorescence was also observed in polyhedra, except cytoplasm at 72hpi. Together, Ac74 is a functional protein with 31kDa molecular weight and is located in the cytoplasm and the polyhedra.

  13. Biocontrol activity of Paenibacillus polymyxa AC-1 against Pseudomonas syringae and its interaction with Arabidopsis thaliana.

    Science.gov (United States)

    Hong, Chi Eun; Kwon, Suk Yoon; Park, Jeong Mee

    2016-04-01

    Paenibacillus polymyxa AC-1 (AC-1) is a plant growth-promoting rhizobacterium (PGPR) that has been used as a soil inoculant for biocontrol of plant pathogenic fungi and to promote plant growth. In this study, we examine the effects of AC-1 on the bacterial phytopathogen Pseudomonas syringae and internal colonization of AC-1 by counting bacterial populations that colonize plants. AC-1 inhibited the growth of both P. syringae pv. tomato DC3000 (Pst) and P. syringae pv. tabaci (Pta) in a concentration-dependent manner in in vitro assays. Upon treatment of AC-1 dropping at root tip of axenically grown Arabidopsis, we found that most of the AC-1 was detected in interior of leaves of Arabidiopsis plants rather than roots after 5 days post infection, indicating systemic spreading of AC-1 occur. We examined further AC-1 colonization patterns in Arabidopsis mutants deficient in phytohormone signaling pathways. These results indicated that abscisic acid (ABA) and jasmonic acid (JA) signaling pathways positively and negatively contributed, respectively, to AC-1 colonization of leaves, whereas epiphytic accumulation of AC-1 around root tissues was not affected. This study shows that AC-1 is an effective biocontrol agent to suppress P. syringae growth, possibly owing to its colonization patterns as a leaf-inhabiting endophyte. The results showed in this work will help to expand our understanding of the mode of action of AC-1 as a biological control agent and consequently, its application in agriculture. PMID:26946374

  14. Modulación adaptativa y diversidad en canales de comunicaciones acústicas subacuáticas

    OpenAIRE

    Clemente Medina, María del Carmen

    2013-01-01

    El objetivo general de la tesis es evaluar las técnicas de transmisión de datos a alta velocidad más adecuadas para canales de comunicaciones acústicas subacuáticas. Se centra en la técnica madura de modulación adaptativa, donde el canal se estima en recepción. Esta técnica adaptativa se puede combinar con la codificación de canal que desarrolla y analiza códigos orientados a facilitar la detección y corrección de los errores originados a causa del paso de las señales por el medio de transmis...

  15. Proyecto de instalación solar para ACS, calefacción y piscina en un edificio de viviendas

    OpenAIRE

    Relaño Peña, Antonio Luis

    2010-01-01

    Con arreglo al nuevo Código Técnico de la Edificación, en el que se establece unos niveles mínimos de contribución solar para ACS en los edificios de nueva construcción y rehabilitación, por el interés por las energías renovables y la eficiencia energética el alumno ha realizado el siguiente proyecto. En este proyecto se ha pretendido realizar un diseño de la instalación que sea por una parte lo más eficiente posible desde el punto de vista energético y por otra parte que su utilización sea l...

  16. Aragonite coating solutions (ACS) based on artificial seawater

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

  17. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

    2015-03-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  18. Esporotricosis cutánea diseminada con compromiso articular en una mujer con diabetes tipo 2

    Directory of Open Access Journals (Sweden)

    Sendy Solorzano

    2015-01-01

    Full Text Available La esporotricosis diseminada es una presentación infrecuente de esta micosis. Aunque ha sido descrita en sujetos inmunocompetentes, con frecuencia existe compromiso de la inmunidad mediada por células T. Reportamos el caso de una mujer con diabetes tipo 2 no controlada que desarrolló esporotricosis cutánea diseminada. El curso de la enfermedad presentó varias complicaciones que incluyeron hepatitis secundaria a itraconazol y artritis de la rodilla con cultivo positivo para Sporothrix schenckii durante el tratamiento con solución saturada de ioduro de potasio. La discusión del caso incluye aspectos de la patogénesis de la esporotricosis diseminada y el manejo de la infección y sus complicaciones.

  19. Esporotricosis cutánea diseminada con compromiso articular en una mujer con diabetes tipo 2

    Directory of Open Access Journals (Sweden)

    Sendy Solorzano

    2015-03-01

    Full Text Available La esporotricosis diseminada es una presentación infrecuente de esta micosis. Aunque ha sido descrita en sujetos inmunocompetentes, con frecuencia existe compromiso de la inmunidad mediada por células T. Reportamos el caso de una mujer con diabetes tipo 2 no controlada que desarrolló esporotricosis cutánea diseminada. El curso de la enfermedad presentó varias complicaciones que incluyeron hepatitis secundaria a itraconazol y artritis de la rodilla con cultivo positivo para Sporothrix schenckii durante el tratamiento con solución saturada de ioduro de potasio. La discusión del caso incluye aspectos de la patogénesis de la esporotricosis diseminada y el manejo de la infección y sus complicaciones.

  20. Prueba de inmunodifusión radial con hapteno nativo para diferenciar bovinos con revacunaciones repetidas con la cepa S19 de Brucella abortus

    OpenAIRE

    Esperanza González Miranda; Laura Hernández Andrade; Efrén Díaz Aparicio

    2006-01-01

    El objetivo del estudio fue establecer la capacidad de la inmunodifusión radial (IDR) con hapteno nativo, para diferenciar anticuerpos post-vacunales de anticuerpos por infección, en bovinos con revacunaciones repetidas de cepa S19. Se trabajó en un establo del estado de México, con presencia de abortos, retención de placenta, expulsiones y fetos momificados. Las becerras se vacunaban con dosis clásica de cepa S19 de B. abortus, y ya adultas revacunaciones anuales repetidas con dosis reducida...

  1. 多元组合ACS-TSP系统%A Multi-Metaheuristic Combined ACS-TSP System

    Institute of Scientific and Technical Information of China (English)

    陈芳

    2015-01-01

    文章提出了用多算法结合蚁族系统(ACS)求解旅行商问题(TSP)的方法,介绍了在ACS-TSP问题上的遗传算法,目的是为了寻找处理旅行商早期停滞现象的解空间.此外,还提出了一种新的最小生成树(MST)算法,结合最近邻(NN)来创建一个初始架构,以便又快又好地解决旅行商问题.%This paper presents a Multi-Metaheuristic combined Ant Colony System (ACS)-Travelling Salesman Problem (TSP) al-gorithm for solving the TSP. We introduce genetic algorithm in ACS-TSP to search solutions space for dealing with the early stagnation problem of the traveling salesman problem. Moreover, we present a new strategy of Minimum Spanning Tree(MST) coupled with Nearest Neighbor(NN) to construct a initial tour for improving TSP thus obtaining good solutions quickly. According to our simulation results, the new algorithm can provide a significant improvement for obtaining a global optimum solution or a near global optimum solution in large TSPs.

  2. Expression characteristics of CS-ACS1, CS-ACS2 and CS-ACS3, three members of the 1-aminocyclopropane-1-carboxylate synthase gene family in cucumber (Cucumis sativus L.) fruit under carbon dioxide stress.

    Science.gov (United States)

    Mathooko, F M; Mwaniki, M W; Nakatsuka, A; Shiomi, S; Kubo, Y; Inaba, A; Nakamura, R

    1999-02-01

    We investigated the expression pattern of three 1-aminocyclopropane-1-carboxylate (ACC) synthase genes, CS-ACS1, CS-ACS2 and CS-ACS3 in cucumber (Cucumis sativus L.) fruit under CO2 stress. CO2 stress-induced ethylene production paralleled the accumulation of only CS-ACS1 transcripts which disappeared upon withdrawal of CO2. Cycloheximide inhibited the CO2 stress-induced ethylene production but superinduced the accumulation of CS-ACS1 transcript. At higher concentrations, cycloheximide also induced the accumulation of CS-ACS2 and CS-ACS3 transcripts. In the presence of CO2 and cycloheximide, the accumulation of CS-ACS2 transcript occurred within 1 h, disappeared after 3 h and increased greatly upon withdrawal of CO2. Inhibitors of protein kinase and types 1 and 2A protein phosphatases which inhibited and stimulated, respectively, CO2 stress-induced ethylene production had little effect on the expression of these genes. The results presented here identify CS-ACS1 as the main ACC synthase gene responsible for the increased ethylene biosynthesis in cucumber fruit under CO2 stress and suggest that this gene is a primary response gene and its expression is under negative control since it is expressed by treatment with cycloheximide. The results further suggest that the regulation of CO2 stress-induced ethylene biosynthesis by reversible protein phosphorylation does not result from enhanced ACC synthase transcription. PMID:10202812

  3. Guía de recursos para alumnos con discapacidad

    OpenAIRE

    Intersocial

    2006-01-01

    Ha sido política del Ministerio de Educación y Ciencia, mantener una estrecha colaboración con las entidades que desarrollan su labor en el ámbito de las personas con discapacidad, con objeto de prestar al alumnado con necesidades educativas especiales una atención educativa de calidad y propiciar los recursos materiales y personales necesarios. En esta línea de actuación, el Ministerio, de acuerdo con el Comité Español de Representantes de Personas con Discapacidad (CERMI), constituyó el ...

  4. Recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices.

    Science.gov (United States)

    Sasaki, Naoki

    2012-01-01

    AC electrokinetics is a generic term that refers to an induced motion of particles and fluids under nonuniform AC electric fields. The AC electric fields are formed by application of AC voltages to microelectrodes, which can be easily integrated into microfluidic devices by standard microfabrication techniques. Moreover, the magnitude of the motion is large enough to control the mass transfer on the devices. These advantages are attractive for biomolecular analysis on the microfluidic devices, in which the characteristics of small space and microfluidics have been mainly employed. In this review, I describe recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices. The applications include fluid pumping and mixing by AC electrokinetic flow, and manipulation of biomolecules such as DNA and proteins by various AC electrokinetic techniques. Future prospects for highly functional biomolecular analysis on microfluidic devices with the aid of AC electrokinetics are also discussed.

  5. A Study on Power Quality Improvement in PWM Controlled AC Voltage Controller

    Directory of Open Access Journals (Sweden)

    Ahmet ALTINTAŞ

    2009-04-01

    Full Text Available A lot of topologies of pulse-width modulated (PWM-AC controllers for single-phase and three-phase systems are proposed up to date. PWM-AC controllers have important advantages compared with the phase-controlled AC controllers using thyristors and triacs. The PWM-AC controller has sinusoidal current waveforms, smaller THD values, better power factor, faster dynamics, and smaller input/output filter. This article presents a novel control technique for application to PWM-AC controllers with ability of generating fewer harmonics. In the proposed control method, both the traditional AC voltage controllers and the PWM-AC controllers are combined; and smaller THD values are obtained. Thus, the harmonic pollution in the power system will be reduced; and consequently, the power quality will be increased. For this purpose, computer simulations are performed in order to investigate the proposed controller performance. The obtained results are compared with the conventional PWM-AC controller.

  6. VANET Routing Protocols: Pros and Cons

    CERN Document Server

    Paul, Bijan; Bikas, Md Abu Naser

    2012-01-01

    VANET (Vehicular Ad-hoc Network) is a new technology which has taken enormous attention in the recent years. Due to rapid topology changing and frequent disconnection makes it difficult to design an efficient routing protocol for routing data among vehicles, called V2V or vehicle to vehicle communication and vehicle to road side infrastructure, called V2I. The existing routing protocols for VANET are not efficient to meet every traffic scenarios. Thus design of an efficient routing protocol has taken significant attention. So, it is very necessary to identify the pros and cons of routing protocols which can be used for further improvement or development of any new routing protocol. This paper presents the pros and cons of VANET routing protocols for inter vehicle communication.

  7. Riesgos asociados con las radiaciones ionizantes

    Directory of Open Access Journals (Sweden)

    Adriana Cascón

    2009-01-01

    Full Text Available El uso médico de las radiaciones ionizantes implica ciertos riesgos, aunque están ampliamente compensados por sus beneficios diagnósticos y terapéuticos. No obstante, el conocimiento de esos riesgos, así como su diagnóstico y prevención, minimiza sus inconvenientes y optimiza la calidad y la seguridad de su empleo. En este artículo se discuten aspectos vinculados con la relación dosis-respuesta en la piel (efectos determinísticos, la importancia del límite de la dosis, la fisiopatología del daño biológico y, por último, con las medidas de prevención.REV ARGENT CARDIOL 2009;77:123-128.

  8. Monitoreo de PostgreSQL con Munin

    Directory of Open Access Journals (Sweden)

    Gunnar Eyal Wolf Iszaevich

    2011-11-01

    Full Text Available Una de los principales tareas del trabajo diario de un administrador de sistemas, redes o bases de datos es el monitoreo de recursos. Con herramientas adecuadas de monitoreo, el administrador puede no sólo detectar un problema antes de que cause interrupciones en la operación de los sistemas, sino que puede prevenir que ocurran, conociendo la evolución histórica de los valores relevantes. En el presente trabajo presento el marco de recopilación y graficación de datos Munin, enfocándome a su uso para monitorear el gestor de base de datos relacional PostgreSQL, así como en la flexiblilidad y facilidad con que administradores y programadores pueden adecuarlo para desarrollar plugins específicos para el monitoreo de sus necesidades puntuales.

  9. REHIDRATACIÓN POST-EJERCICIO CON AGUA DE COCO: ¿IGUAL O MÁS EFECTIVA QUE UNA BEBIDA DEPORTIVA?

    Directory of Open Access Journals (Sweden)

    Alexandra Pérez Idárraga

    2011-07-01

    Full Text Available Objetivo: comparar la efectividad rehidratante del agua de coco fresca, con el agua embotellada y una bebida deportiva. Metodología: once participantes de 22,0 ± 1,9 años y 65,6 ± 13,0 kg de masa corporal (promedio ± D.E, asistieron al laboratorio en tres ocasiones, separadas entre sí por una semana. En cada sesión se deshidrataron por ejercicio en el calor hasta perder 1,84 ± 0,2% de la masa corporal. Luego fueron rehidratados en una hora, con agua comercial embotellada (AE, una bebida deportiva (BD o agua de coco (AC, utilizando un volumen equivalente al 120% del peso perdido. Se evaluaron las sensaciones percibidas relacionadas con la tolerancia y la aceptación de las bebidas. Se recolectó la orina eliminada durante tres horas post-rehidratación. Resultados: Hubo interacción entre las bebidas y el tiempo sobre la orina excretada (p=0,003, siendo el AE estadísticamente diferente al AC y la BD a los 30 y 60 min post-rehidratación (p0,05. Esto produjo porcentajes de conservación de líquido diferentes para AE (56%, con respecto a BD (71% y AC (71% (p0,05. La percepción de la dulzura fue menor para AE (p= 0,024. BD obtuvo mejores puntajes de sabor y aceptación general (p<0,05. Conclusiones: el agua de coco fresca resulta tan efectiva como una bebida deportiva para conservar el líquido consumido, teniendo una buena tolerancia y aceptación. Podría ser usada como una bebida rehidratante, cuando la persona la tenga disponible y le agrade su sabor.

  10. Advanced reliability improvement of AC-modules (ARIA)

    International Nuclear Information System (INIS)

    The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

  11. Bibliotecari con Moodle, su Moodle, per Moodle

    OpenAIRE

    Boscaro, Elena; Cognola, Ruben; De Robbio, Antonella

    2008-01-01

    This is the presentation of the poster "Bibliotecari con Moodle, su Moodle, per Moodle" shown at Moodlemoot Italia 2008, forth edition of the users of Moodle's annual meeting held at the University of Padua in May 9-10, 2008. Nowadays, one of the fundamental missions of a university digital library is to cooperate and integrate with e-learning: academic digital libraries are asked to support the new ways and models of contemporary didactics through the use of training and educational mater...

  12. Bacteriemia en pacientes internados con celulitis

    Directory of Open Access Journals (Sweden)

    Juan S. Lasa

    2012-08-01

    Full Text Available La celulitis es una inflamación aguda de la dermis y tejido celular subcutáneo de causa bacteriana, que generalmente complica a heridas, úlceras y dermatosis, aunque de manera frecuente no existe sitio de entrada. Se recomienda la realización de cultivo de punción de piel y partes blandas (PPB. Los hemocultivos raramente dan resultados positivos. El objetivo de este trabajo fue determinar la prevalencia de bacteriemia en pacientes internados en nuestra institución con diagnóstico de celulitis. Se analizaron retrospectivamente los registros clínicos de los pacientes con este diagnóstico al ingreso entre junio de 2007 y marzo de 2010. Se evaluaron los datos poblacionales, presencia de comorbilidades, y resultados de los cultivos. En ese período, se internaron 140 pacientes con diagnóstico de celulitis y a todos ellos se les realizó hemocultivo y cultivos de PPB. Setenta y cuatro eran varones (52.8%. La edad promedio: 47.5 ± 19.7 años (rango 16-94. El 40% tuvo cultivos positivos de PPB, en los que el Staphylococcus aureus meticilino resistente (SAMR fue el germen más frecuentemente aislado (35.7%; la prevalencia de bacteriemia fue del 8.6%, en donde el germen más frecuente fue Streptoccocus Beta hemolítico, grupo G (33% del total de hemocultivos positivos. La bacteriemia se asoció significativamente a mayor estadía hospitalaria (10.5 ± 8.9 vs. 4.9 ± 6, p = 0.004. Se asoció con mayor riesgo de hemocultivo positivo a ser diabético, tener cultivo de PPB positivo, consumo de alcohol y/o enfermedad pulmonar obstructiva crónica.

  13. Tratamiento de la osteoporosis grave con teriparatide

    Directory of Open Access Journals (Sweden)

    Marcelo A. Sarli

    2013-10-01

    Full Text Available El objetivo de este trabajo retrospectivo fue evaluar el tratamiento de la osteoporosis grave con teriparatide (PTH y comparar nuestros resultados con los publicados en la literatura médica. Se incluyeron cuarenta y seis pacientes, cuarenta y dos mujeres y cuatro varones, edad: 69.15 ± 9.43 años. Seis eran vírgenes de tratamiento y cuarenta tratados previamente con bisfosfonatos. Treinta y dos pacientes habían tenido 93 fracturas de las cuales 86 vertebrales. Cuarenta y seis recibieron PTH 6 meses, 29 pacientes durante 12 meses y 20 completaron los 18 meses sugeridos. La densidad mineral ósea (DMO de columna lumbar aumentó significativamente desde el primer control a los 6 meses (p < 0.0001. La DMO de cuello de fémur alcanzó un incremento significativo al final del tratamiento (p = 0.002. La osteocalcina aumentó significativamente al mes, seguido por el ß crosslaps (beta-CTx, prueba en suero al tercer mes y la fosfatasa alcalina ósea, regresando los marcadores de recambio óseo a niveles basales a los 18 meses. Las calcemias y las calciurias no se modificaron significativamente, pero 8 pacientes tuvieron hipercalcemias leves y tres hipercalciurias asintomáticas. El tratamiento fue bien tolerado y no se registraron efectos adversos graves que requirieran suspender el tratamiento. En conclusión, la PTH es una alternativa útil y segura para el tratamiento de la osteoporosis grave. Nuestros resultados concuerdan con los previamente publicados en la literatura médica.

  14. Comunicándonos con las cosas

    Directory of Open Access Journals (Sweden)

    Miguel Delgado

    2009-09-01

    Full Text Available Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  15. Somatic cell nuclear transfer: pros and cons.

    Science.gov (United States)

    Sumer, Huseyin; Liu, Jun; Tat, Pollyanna; Heffernan, Corey; Jones, Karen L; Verma, Paul J

    2009-01-01

    Even though the technique of mammalian SCNT is just over a decade old it has already resulted in numerous significant advances. Despite the recent advances in the reprogramming field, SCNT remains the bench-mark for the generation of both genetically unmodified autologous pluripotent stem cells for transplantation and for the production of cloned animals. In this review we will discuss the pros and cons of SCNT, drawing comparisons with other reprogramming methods. PMID:20232594

  16. Comunicándonos con las cosas

    OpenAIRE

    Miguel Delgado; Sergio Ciruela; Nicolás Marín

    2009-01-01

    Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  17. Intervista con Fabiola Gianotti, Portavoce esperimento ATLAS

    CERN Multimedia

    CERN Video Productions

    2009-01-01

    Domande : 1. Come ci si sente come Portavoce di un grande esperimento internazionale come ATLAS nel momento in cui LHC sta per produrre i primi dati? 2. Il rivelatore è pronto per i dati? 3. Quindi l'anno di arresto non è stato inutile? 4. Cosca cisi può aspettare da LHC con l'energia di 3,5 TeV per fascio? 5. Cosa succederà il giorno delle prime collisioni in sala di controllo di ATLAS?

  18. Transposition of Ac from the P Locus of Maize into Unreplicated Chromosomal Sites

    OpenAIRE

    Chen, Jychian; Greenblatt, Irwin M.; Dellaporta, Stephen L.

    1987-01-01

    We have analyzed donor and target sites of the mobile element Activator (Ac) that are altered as a result of somatic transposition from the P locus in maize. Previous genetic analysis has indicated that the two mitotic daughter lineages which result from Ac transposition from P differ in their Ac constitution at the P locus. Both lineages, however, usually contain transposed Ac elements which map to the same genetic position. Using methylation-sensitive restriction enzymes and genomic blot a...

  19. A transgenic system for generation of transposon Ac/Ds-induced chromosome rearrangements in rice

    OpenAIRE

    Yu, Chuanhe; Han, FangPu; Zhang, Jianbo; Birchler, James; Peterson, Thomas

    2012-01-01

    The maize Activator (Ac)/Dissociation (Ds) transposable element system has been used in a variety of plants for insertional mutagenesis. Ac/Ds elements can also generate genome rearrangements via alternative transposition reactions which involve the termini of closely linked transposons. Here, we introduced a transgene containing reverse-oriented Ac/Ds termini together with an Ac transposase gene into rice (Oryza sativa ssp. japonica cv. Nipponbare). Among the transgenic progeny, we identifie...

  20. Miasis en paciente con Carcinoma Basocelular

    Directory of Open Access Journals (Sweden)

    Dr. Hugo Pérez Vedia

    2012-12-01

    Full Text Available Paciente de sexo masculino, de 71 años de edad, proveniente de la provincia Chapare, Cochabamba, es remitido por sus familiares al servicio de Infectologíadel Hospital Obrero Nº2 Caja Nacional de Salud, tras presentar cuadro clínico de varios días de evolución, caracterizado por lesión ulcerada de bordes irregulares, con secreciónserosanguinolenta localizada en hemicara derecha, con extensión a tejidos profundos y destrucción ósea con pérdida del pabellón auricular derecho,destrucción de la fosa nasal derecha, exposición de globo ocular por destrucción de tejido,destrucción del paladar duro y blando del lado derecho, lengua saburral, faringe hiperémica,acompañado de dolor intenso y signos de un procesoinfeccioso-inflamatorio en la zona, además de presentar larvas en dicha lesión, y antecedentes de carcinoma basocelular de 20 añosde evolución.

  1. Igualación de muestras compuestas con comparaciones sencillas: la intercambiabilidad de los términos estimulares

    Directory of Open Access Journals (Sweden)

    Franck Carpentier

    2005-01-01

    Full Text Available Estudios previos han mostrado que el entrenamiento en tareas de igualación a la muestra con estímulos compuestos AB usados como muestra y estímulos sencillos C usados como comparación (AB-C permite tareas novedosas intercambiando los elementos estimulares; CAB, AC-B y BC-A (ej., Markham & Dougher, 1993. Estas ejecuciones permanecen intactas cuando, después de un entrenamiento subsecuente C-D, el estímulo D remplaza al estímulo C (D-AB, AD-B, BD-A. El presente estudio fue planteado para investigar si las ejecuciones también se evidencian cuando un estímulo de la triada ABC se remplaza por otro elemento de la triada (B más que por un cuarto estímulo (D. En el Experimento 1, los participantes fueron entrenados en tareas múltiples AB-C y se probó la correspondencia de las ejecuciones C-AB y AC-B. En este punto, algunos participantes recibieron entrenamiento A-B seguido por pruebas C-BB y BC-B. Estas pruebas fueron las mismas a aquellas usadas en las relaciones CAB y BC-A excepto que el elemento equivalente B remplazó al A. Otros participantes recibieron entrenamiento A-D seguido por pruebas C-DB y BC-D. Estas pruebas fueron C-AB y BC-A excepto por que el estímulo D reemplazó a A. Las pruebas C-BB y BC-B (participantes con entrenamiento tipo A-B tuvieron una ineficacia masiva en contraste con las pruebas CDB y BC-D (participantes con entrenamiento tipo A-D. Las ejecuciones C-BB y BC-B se lograron en el Experimento 2, estas pruebas estuvieron precedidas por pruebas AB-BB. El Experimento 3 demostró que el entrenamiento A-B generaba respuestas consistentes con la clase durante las pruebas AB-BB, C-BB, BC-B y pruebas subsecuentes con estímulos novedosos X (AB-XX, C-XX, XC-X , pero solamente cuando se presentaban primero pruebas AB-BB, C-BB, y BC-B. Estos hallazgos indican que los elementos establecidos previamente en las configuraciones muestra-comparación no solamente pueden ser reemplazados por estímulos novedosos sino también por

  2. Scaling of ac susceptibility and the nonlinear response function of high-temperature superconductors

    Institute of Scientific and Technical Information of China (English)

    CHEN; Kaixuan; NING; Zhenhua; XU; Hengyi; QI; Zhi; LU; Guo

    2005-01-01

    The amplitude-dependent ac susceptibility of high-temperature superconductors is shown to obey some empirical scaling relations. We try to analyze this behavior by extending a dc nonlinear response function of mixed state to the ac cases. The derived equations for critical current and ac susceptibility x(T) agree with the scaling relations of experimental data.

  3. 21 CFR 880.5510 - Non-AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Non-AC-powered patient lift. 880.5510 Section 880.5510 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is...

  4. AC losses and transient field stability of PF-FSJS sample

    International Nuclear Information System (INIS)

    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability

  5. AC losses and transient field stability of PF-FSJS sample

    Energy Technology Data Exchange (ETDEWEB)

    Zani, L

    2003-07-01

    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability.

  6. 21 CFR 880.5100 - AC-powered adjustable hospital bed.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered adjustable hospital bed is a device intended for medical purposes that consists of a bed with a...

  7. Software Development for ALMA in Chile: The ACS-UTFSM Group.

    Science.gov (United States)

    von Brand, H. H.

    ALMA Common Software (ACS) provides a common software framework for ALMA, the Atacama Large Millimeter Array in Chile. ACS is a collection of well-documented patterns for controlling systems and a set of components written to those patterns. In its core, ACS is a distributed, object-oriented system, written on top of CORBA. The ACS-UTFSM Group started as some students of informatics did summer jobs at the La Silla Observatory of ESO, where they became acquainted with ACS. Their interest led them to continue working on ACS on their own, and they eventually became official developers of the package. Now the group is being funded by project ALMA-CONICYT 31060008 ``Software Development for ALMA: Building Up Expertise to Meet ALMA Software Requirements within a Chilean University''. Several members of the original group are now working for ALMA, which fullfills one of the goals of the project. Some parts of ACS developed by the ACS-UTFSM Group include H3E (Hardware End-to-End Example), a Lego model of a telescope and its controlling software for training and demonstration purposes; and CDBChecker, a tool to verify the consistency of the configuration database for a ACS deployment. Currently we are working towards a general framework for telescope control using ACS, in order to simplify the deployment of new instruments; and repackaging ACS so it is easier to install and use. A master's thesis is exploring the real-time requirements of ACS.

  8. Examining the Effects of Introducing Online Access to ACS Journals at Primarily Undergraduate Institutions

    Science.gov (United States)

    Landolt, R. G.

    2007-01-01

    In collaboration with the Publications Division of the American Chemical Society (ACS), students and faculty at 24 primarily undergraduate institutions were provided online access to ACS primary research journals for a period of 18 months, and a group of eight schools were granted access to use the archives of ACS journals for a year. Resources…

  9. File list: His.PSC.50.H3ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.H3ac.AllCell mm9 Histone H3ac Pluripotent stem cell SRX882861,SRX882864,...SRX882865,SRX882862,SRX882860,SRX882863 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.H3ac.AllCell.bed ...

  10. AC-13混合料矿料级配及特性试验研究%Research on AC-13 mixture mineral materials gradation and feature experiments

    Institute of Scientific and Technical Information of China (English)

    何亦伟

    2016-01-01

    The paper adopts the Marshall method and Superpave method,undertakes the mixture design for AC-13Ⅰand AC-13,compares and analyzes the optimal asphalt volume and compaction features of the two,and points out the designed asphalt volumes has the same optimal asphalt and aggregate ratio,and the latter is superior to the former one in the aspect of compaction.%应用马歇尔法和Superpave法对AC-13Ⅰ和AC-13进行了混合料设计,对比分析了两者的最佳沥青用量及压实特性,指出两者的设计沥青用量在最佳油石比时基本相同,AC-13的压实特性优于AC-13Ⅰ.

  11. Characterization of an Ac transposon system based on apt1-m1 (Ac) on the long arm of maize chromosome 9.

    Science.gov (United States)

    Wang, Fei; Li, Pengfei; Tang, Yuanping; Fan, Jun; Xu, Dabin; Guo, Shengming; Xu, Zhengkai; Song, Rentao

    2012-09-01

    Activator/Dissociation (Ac/Ds) transposable elements have been used in maize insertional mutagenesis as a complement to Mutator (Mu). In this study, to further improve the efficiency of the Ac/Ds mutagenesis system, we adopted apt1-m1 (Ac) on the long arm of chromosome 9 (9L) as a donor Ac to create an Ac insertion library. This system is based on the negative selection pressure against the donor Ac, and it was highly efficient for isolating new transposition events. We obtained 9,625 transposition events from 1083 F1 ears with an average transposition rate of 8.66 % (rates ranged from 1.11 to 29.73 %). We also adopted a modified PCR-based genome walking strategy to improve the efficiency of the new method for isolating transposon-flanking sequences. This method is more efficient than the Southern-based method that was used in previous studies. A validation step was developed to distinguish transposon tags derived from newly transposed Ac or Ds elements. Using this PCR-based method, we isolated 67 inheritable flanking sequences from the apt1-m1 (Ac) transposition library; of these, 51 were confirmed as tr-Ac-flanking sequences and 11 were tr-Ds-flanking sequences. Similar to other Ac donors from different loci, the apt1-m1 (Ac) system also exhibited a preference for short distance transposition. In this study, we have further improved the Ac mutagenesis system in maize for gene isolation and functional genomics studies.

  12. 单相AC/AC Buck变换器中双向开关四步换流策略的研究%Four-step switching strategy of the bidirectional switches in single-phase AC/AC Buck converter

    Institute of Scientific and Technical Information of China (English)

    曾松; 张波; 丘东元; 马化盛

    2007-01-01

    为解决双向开关在电力电子器件中的换流问题,可采用"四象限换流"的换流策略,即"四步换流".该方法根据电压的相对大小或电流的方向将两个双向开关之间的换流过程分为四步进行,有效地避免了换流过程中的故障,实现了真正意义上的安全换流.本文以单相AC/AC Buck变换器为例,研究其中双向开关的四步换流控制策略,设计出具体的实现电路,并用实验加以验证.

  13. On-Chip AC self-test controller

    Science.gov (United States)

    Flanagan, John D.; Herring, Jay R.; Lo, Tin-Chee

    2009-09-29

    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  14. Towards an AC-MOT of CaF

    Science.gov (United States)

    Anderegg, Loic; Chae, Eunmi; Ravi, Aakash; Augenbraun, Benjamin; Hemmerling, Boerge; Drayna, Garrett; Hutzler, Nicholas; Collopy, Alejandra; Wu, Yewei; Ding, Shiqian; Ye, Jun; Ketterle, Wolfgang; Doyle, John

    2016-05-01

    Ultra-cold diatomic molecules have rich prospects as candidates to study controlled ultra-cold chemistry, strongly correlated systems and precision measurements. They are also considered as possible qubits in quantum computing and simulation schemes. We report on progress towards loading CaF into a molecular magneto-optical trap (MOT). An AC-MOT will be used to actively remix magnetic dark states via both polarization and magnetic field switching. In order to load a molecular MOT, we have successfully laser slowed a CaF beam to near the expected capture velocity. We describe our AC-MOT apparatus, which is designed to co-trap CaF and Li. We outline our planned study of CaF-Li collisions to explore the feasibility of sympathetically cooling molecules to ultra-cold temperatures.

  15. Development of ac corona discharge modes at atmospheric pressure

    International Nuclear Information System (INIS)

    Corona discharges in gases exist under several distinctive forms. In this paper, a survey study has been made of ac corona discharge modes generated in some different gases fed in a wire-duct reactor with a constant rate of flowing at atmospheric pressure. The properties of different corona modes are analyzed under some condition transitions from Trichel pulses to a steady glow. In the course of the presented experimental work, numerous apparent contradictions with earlier observations necessitated further study and are given to provide more information on the physical mechanisms of the ac corona discharges. Furthermore, we have gained insight into some new technologies and applications of the environmentally friendly corona and plasma discharges.

  16. Effective nonlinear AC response to composite with spherical particles

    Institute of Scientific and Technical Information of China (English)

    Chen Xiao-Gang; Liang Fang-Chu; Wei En-Bo

    2005-01-01

    An effective nonlinear alternative-current (AC) response to granular nonlinear-composite with spherical inclusions embedded in a host medium under the action of an external AC field is investigated by using a perturbation approach.The local potentials of composite at higher harmonics are derived both in a region of local inclusion particles and in a local host region under the action of a sinusoidal field E1 sinωt + E3sin3ωt. An effective nonlinear-response to composite and the relationship between the effective nonlinear-responses at the fundamental frequency and the third harmonics are also studied for the spherical inclusions in a dilute limit.

  17. ac power control in the Core Flow Test Loop

    International Nuclear Information System (INIS)

    This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report

  18. Fiber Materials AC Impedance Characteristics and Principium Analysis

    Science.gov (United States)

    Wang, Jianjun; Li, Xiaofeng

    With an invariable amplitude and variable frequency inspiriting, impedance of fiber materials rapidly decrease at first and then increase speedy followed with increasing of signal frequency. For the impedance curve of frequency is section of bathtub, this phenomenon is defined as alternating current electric conductive bathtub effect of fiber material. With analysis tools,of circuit theory and medium polarization theory, the phenomenon can be deeply detected that in AC electric field there are four different kind of currents in fiber material: absorbing current, conductance current, charging current and superficial current. With more analyzing it's discovered this phenomenon can be explained by medium polarize theory. Make using of fiber AC electric conductivity bathtub effect, fast testing equipment on fiber moisture regain can be invent, and disadvantages of conventional impedance technique, such as greatness test error and electrode polarization easily. This paper affords directions to design novel speediness fiber moisture test equipments in theory.

  19. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, L; Veintemillas-Verdaguer, S; Serna, C J; Morales, M P [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Sor Juana Ines de la Cruz 3, Cantoblanco 28049, Madrid (Spain); MejIas, R; Barber, D F [Centro Nacional de BiotecnologIa, CNB-CSIC, Darwin 3, Cantoblanco 28049, Madrid (Spain); Lazaro, F J, E-mail: lucia@icmm.csic.es [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, Maria de Luna 3, 50018, Zaragoza (Spain)

    2011-06-29

    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  20. [Effect of prostatilen AC suppositories on course of experimental prostatitis].

    Science.gov (United States)

    Savateeva-Liubimova, T N; Sivak, K V; Malinin, V V

    2012-01-01

    The article presents the results of evaluation of efficacy of new drug prostatilen AC (rectal suppositories), containing regulatory peptides of the bovine prostate and zinc arginate-glycinate complex, in the treatment of prostatitis. The experiment was conducted on 40 Sprague-Dawley rats weighing 180-200 g. Chronic prostatitis was modeled by injection of 10% Dimexidum in combination with water, mixed with turpentine, a volumetric ratio of 4:1. It is shown that prostatilen AC has pronounced organotropic antiinflammatory effect, which manifests in reducing the weight of the prostate, reducing the protein level in the urine, activity of acid phosphatase, and levels of ceruloplasmin and C-reactive protein. In addition, this drug normalizes the act of urination and increases the diurnal diuresis, has antioxidant properties and increases the blood level of the male sex hormone testosterone.