
Sample records for ac briefing material

  1. Ferromagnetic resonance driven by an ac current: a brief review

    International Nuclear Information System (INIS)

    Excitation of ferromagnetic resonance (FMR) by an ac current has been observed in macroscopic ferromagnetic films for decades and typically relies on the ac Oersted field of the current to drive magnetic moments into precession and classical rectification of ac signals to detect the resonance. Recently, current-driven ferromagnetic resonances have attracted renewed attention with the discovery of the spin-transfer torque (STT) effect due to its potential applications in magnetic memory and microwave technologies. Here STT associated with the ac current is used to drive magnetodynamics on the nanoscale that enables FMR studies in sample volumes smaller by a factor of 1000 compared to conventional resonance techniques. In this paper, we briefly review the basics of STT-FMR technique and the results of various STT-FMR experiments.

  2. The nuclear materials control technology briefing book

    Energy Technology Data Exchange (ETDEWEB)

    Hartwell, J.K.; Fernandez, S.J.


    As national and international interests in nuclear arms control and non-proliferation of nuclear weapons, intensify, it becomes ever more important that contributors be aware of the technologies available for the measurement and control of the nuclear materials important to nuclear weapons development. This briefing book presents concise, nontechnical summaries of various special nuclear material (SNM) and tritium production monitoring technologies applicable to the control of nuclear materials and their production. Since the International Atomic Energy Agency (IAEA) operates a multinational, on-site-inspector-based safeguards program in support of the Treaty on the Non-Proliferation of Nuclear Weapons (NPT), many (but not all) of the technologies reported in this document are in routine use or under development for IAEA safeguards.

  3. Fiber Materials AC Impedance Characteristics and Principium Analysis (United States)

    Wang, Jianjun; Li, Xiaofeng

    With an invariable amplitude and variable frequency inspiriting, impedance of fiber materials rapidly decrease at first and then increase speedy followed with increasing of signal frequency. For the impedance curve of frequency is section of bathtub, this phenomenon is defined as alternating current electric conductive bathtub effect of fiber material. With analysis tools,of circuit theory and medium polarization theory, the phenomenon can be deeply detected that in AC electric field there are four different kind of currents in fiber material: absorbing current, conductance current, charging current and superficial current. With more analyzing it's discovered this phenomenon can be explained by medium polarize theory. Make using of fiber AC electric conductivity bathtub effect, fast testing equipment on fiber moisture regain can be invent, and disadvantages of conventional impedance technique, such as greatness test error and electrode polarization easily. This paper affords directions to design novel speediness fiber moisture test equipments in theory.

  4. Materials, matter and particles a brief history

    CERN Document Server

    Woolfson, Michael M


    This book traces the history of ideas about the nature of matter and also the way that mankind has used material resources that the world offers. Starting with the ideas of ancient civilizations that air, earth, fire and water were the basic ingredients of all matter, it traces the development of the science of chemistry beginning within the ranks of the alchemists. First, the idea of elements grew and then the atomic nature of matter was verified. Physicists had entered the scene, showing the nature of atoms in terms of fundamental particles and then introducing the concept of wave-particle d

  5. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;


    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...... candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...

  6. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;


    candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible......A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...

  7. Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect

    International Nuclear Information System (INIS)

    Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)

  8. Dc and ac Josephson effects in a granular material

    International Nuclear Information System (INIS)

    This paper reports on three-dimensional systems of point contacts that were prepared by pressing together Niobium grains of about 100 μm diameter inside a sapphire cylinder. Current-voltage characteristics were studied in dependence of temperature and, in addition, of the power of incident microwaves (X-bank). The results are similar to those established for a single weak link junction. Only for small currents the sample showed different behavior. The inverse a.c. Josephson effect was observed. The measured d.c. voltage shows and alternating temperature dependence which might be expected following the calculations of J.J. Chang for a weak link of small capacity and small resistance

  9. Modelado acústico de silenciadores con material absorbente




    Esta Tesis se centra en el desarrollo e implementación de métodos para el diseño y modelado acústico de silenciadores de motores de combustión interna, a través de herramientas basadas en soluciones analíticas y numéricas de la ecuación de ondas. La necesidad de técnicas de diseño que proporcionen rápida y eficazmente resultados precisos incluso a altas frecuencias ha aumentando con el tiempo, debido a que el ruido de los vehículos se ha convertido en una fuente importante de contaminación am...

  10. 2005 Research Briefs : Materials and Process Sciences Center.

    Energy Technology Data Exchange (ETDEWEB)

    Cieslak, Michael J.


    This report is the latest in a continuing series that highlights the recent technical accomplishments associated with the work being performed within the Materials and Process Sciences Center. Our research and development activities primarily address the materials-engineering needs of Sandia's Nuclear-Weapons (NW) program. In addition, we have significant efforts that support programs managed by the other laboratory business units. Our wide range of activities occurs within six thematic areas: Materials Aging and Reliability, Scientifically Engineered Materials, Materials Processing, Materials Characterization, Materials for Microsystems, and Materials Modeling and Simulation. We believe these highlights collectively demonstrate the importance that a strong materials-science base has on the ultimate success of the NW program and the overall DOE technology portfolio.

  11. 2003 research briefs : Materials and Process Sciences Center.

    Energy Technology Data Exchange (ETDEWEB)

    Cieslak, Michael J.


    This report is the latest in a continuing series that highlights the recent technical accomplishments associated with the work being performed within the Materials and Process Sciences Center. Our research and development activities primarily address the materials-engineering needs of Sandia's Nuclear-Weapons (NW) program. In addition, we have significant efforts that support programs managed by the other laboratory business units. Our wide range of activities occurs within six thematic areas: Materials Aging and Reliability, Scientifically Engineered Materials, Materials Processing, Materials Characterization, Materials for Microsystems and Materials Modeling and Computational Simulation. We believe these highlights collectively demonstrate the importance that a strong materials-science base has on the ultimate success of the NW program and the overall DOE technology portfolio.

  12. 2004 research briefs :Materials and Process Sciences Center.

    Energy Technology Data Exchange (ETDEWEB)

    Cieslak, Michael J.


    This report is the latest in a continuing series that highlights the recent technical accomplishments associated with the work being performed within the Materials and Process Sciences Center. Our research and development activities primarily address the materials-engineering needs of Sandia's Nuclear-Weapons (NW) program. In addition, we have significant efforts that support programs managed by the other laboratory business units. Our wide range of activities occurs within six thematic areas: Materials Aging and Reliability, Scientifically Engineered Materials, Materials Processing, Materials Characterization, Materials for Microsystems, and Materials Modeling and Simulation. We believe these highlights collectively demonstrate the importance that a strong materials-science base has on the ultimate success of the NW program and the overall DOE technology portfolio.

  13. Briefing material for congressional hearing : Laguna Atascosa Wilderness study area (United States)

    US Fish and Wildlife Service, Department of the Interior — This document is a memorandum alerting the director of the Bureau of Sport Fisheries and Wildlife that materials to assist in preparation for a congressional...

  14. Brief Introduction to China Petroleum Materials & Equipment Corporation

    Institute of Scientific and Technical Information of China (English)


    @@ CPMEC (China Petroleum Materials & Equipment Corportation) is a spectialized service company fully owned by China National Petroleum Corppration (CNPC) approved by the Ministry of Foreign Trade and Economic Cooperation.

  15. CAD/CAM (Computer Aided Design/Computer Aided Manufacture). A Brief Guide to Materials in the Library of Congress. (United States)

    Havas, George D.

    This brief guide to materials in the Library of Congress (LC) on computer aided design and/or computer aided manufacturing lists reference materials and other information sources under 13 headings: (1) brief introductions; (2) LC subject headings used for such materials; (3) textbooks; (4) additional titles; (5) glossaries and handbooks; (6)…

  16. A scanning AC calorimetry technique for the analysis of nano-scale quantities of materials


    Vlassak, Joost J.; Xiao, Kechao; John M. Gregoire; McCluskey, Patrick J.


    We present a scanning AC nanocalorimetry method that enables calorimetry measurements at heating and cooling rates that vary from isothermal to \\(2×10^3 K/s\\), thus bridging the gap between traditional scanning calorimetry of bulk materials and nanocalorimetry. The method relies on a micromachined nanocalorimetry sensor with a serpentine heating element that is sensitive enough to make measurements on thin-film samples and composition libraries. The ability to perform calorimetry over such a ...

  17. AC Conductivity and Dielectric Relaxation Behavior of Sb2S3 Bulk Material (United States)

    Abd El-Rahman, K. F.; Darwish, A. A. A.; Qashou, Saleem I.; Hanafy, T. A.


    The Sb2S3 bulk material was used for next-generation anode for lithium-ion batteries. Alternative current (AC) conductivity, dielectric properties and electric modulus of Sb2S3 have been investigated. The measurements were carried out in the frequency range from 40 Hz to 5 MHz and temperature range from 293 K to 453 K. The direct current (DC) conductivity, σ DC, shows an activated behavior and the calculated activation energy is 0.50 eV. The AC conductivity, σ AC, was found to increase with the increase of temperature and frequency. The conduction mechanism of σ AC was controlled by the correlated barrier hopping model. The behavior of the dielectric constant, ɛ', and dielectric loss index, ɛ'', reveal that the polarization process of Sb2S3 is dipolar in nature. The behavior of both ɛ' and ɛ'' reveals that bulk Sb2S3 has no ferroelectric or piezoelectric phase transition. The dielectric modulus, M, gives a simple method for evaluating the activation energy of the dielectric relaxation. The calculated activation energy from M is 0.045 eV.

  18. Evaluation of Core Loss in Magnetic Materials Employed in Utility Grid AC Filters

    DEFF Research Database (Denmark)

    Beres, Remus Narcis; Wang, Xiongfei; Blaabjerg, Frede;


    the core, depending on the magnetic material of choice and current ripple specifications. Additionally, shunt or series reactors that exists in LCL or trap filters and which are subjected to sinusoidal excitations have different specifications and requirements. Therefore, the core losses of different...... magnetic materials adopted in utility grid ac filters have been investigated and measured for both sinusoidal and rectangular excitation, with and without dc bias condition. The core loss information can ensure cost effective passive filter designs and may avoid trial-error design procedures of the passive...

  19. The effect of α-alumina particles on the properties of EN AC-44200 Al alloy based composite materials


    J.W. Kaczmar; A. Kurzawa


    Purpose: The unreinforced EN AC-44200 aluminium alloy is characterized by the medium mechanical properties and the purpose of performed investigations was improvement of mechanical properties of this alloy by introducing stable ceramic α-alumina particles.Design/methodology/approach: The composite materials were manufactured by squeeze casting of porous ceramic preforms characterized by the open porosities of 90%, 80%, 70% and 60% with the liquid EN AC- 44200 aluminum alloy. The composite mat...

  20. Failure characteristics of Ag-SnO2 contact material in AC level

    Institute of Scientific and Technical Information of China (English)

    MENG Fanbin; LU Jianguo; ZHU Yongqing; LU Ningyi; CHEN Zhichao; HUANG Qiutao


    The failure characteristics of the contact material Ag-SnO2 were investigated by X-ray diffraction (XRD),scanning electron microscopy (SEM),and X-ray energy dispersive spectroscopy (EDS).Phase analysis showed that there were Ag,SnO2,and Sn on the contact surfaces at the time of failure under the load condition of 30 A and 220 V (AC),which means that SnO2 decomposed in service.When the contacts were tested under airproof ambient condition,half-spherical bulges came into heing on the contact surfaces,which resulted in early failure and dispersive characteristics.But half-spherical bulges were not found when the contacts were tested under open ambient condition.The temperature change of the contacts during the life testing under airproof ambient condition was different from that under open ambient condition.

  1. Aluminium EN AC-AlSi12 alloy matrix composite materials reinforced by Al2O3 porous preforms


    Nagel, A.; M. Kremzer; L.A. Dobrzański,


    Purpose: The purpose of this work is to elaborate the method of manufacturing of composite materials based on porous ceramic preforms infiltrated by eutectic aluminium alloy.Design/methodology/approach: The material for investigations was fabricated by pressure infiltration method of ceramic porous preforms. The eutectic aluminium alloy EN AC – AlSi12 was use as a matrix while as reinforcement were used ceramic preforms fabricated by sintering of Al2O3 Alcoa CL 2500 powder with addition of po...

  2. Educational Brief: Using Space for a Better Foundation on Earth Mechanics of Granular Materials (United States)

    Dooling, Dave (Editor)


    Soils are three-phase composite materials that consist of soil, solid particles, and voids filled with water and/or air. Based on the particle-size distribution, they are generally classified as fine-grained (clays and plastic silts) and coarse-grained soils (nonplastic silts, sand, and gravel). Soil's resistance to external loadings is mainly derived from friction between particles and cohesion. Friction resistance is due to particles' surface-to-surface friction, interlocking, crushing, rearrangement, and dilation (or expansion) during shearing. Cohesion can be due to chemical cementation between particles, electrostatic and electromagnetic forces, and soil-water reaction and equilibrium. The basic factor responsible for the strength of coarse-grained soils is friction. Cohesion can be ignored. This educational brief focuses on measuring shear strength of sands (typical example of coarse-grained soils) where, for the same material, packing density is a main factor to be considered when one asks about the shear strength value. As the external load is applied, the soil's resistance is attained through shearing resistance, which causes the soil volume to increase (expand) or decrease (compress) depending on the initial packing density.

  3. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  4. AC/RF Superconductivity


    Ciovati, G.


    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  5. A brief summary of the progress on the EFDA tungsten materials program

    Czech Academy of Sciences Publication Activity Database

    Rieth, M.; Dudarev, S.L.; Gonzalez de Vicente, S.M.; Aktaa, J.; Ahlgren, T.; Antusch, S.; Armstrong, D.E.J.; Balden, M.; Baluc, N.; Barthe, M.-F.; Basuki, W.W.; Battabyal, M.; Becquart, C.S.; Blagoeva, D.; Boldyryeva, Hanna; Brinkmann, J.; Celino, M.; Ciupinski, L.; Correia, J.B.; De Backer, A.; Domain, C.; Gaganidze, E.; García-Rosales, C.; Gibson, J.; Gilbert, M.R.; Giusepponi, S.; Gludovatz, B.; Greuner, H.; Heinola, K.; Höschen, T.; Hoffmann, A.; Holstein, N.; Koch, F.; Krauss, W.; Li, H.; Lindig, S.; Linke, J.; Linsmeier, Ch.; López-Ruiz, P.; Maier, H.; Matějíček, Jiří; Mishra, T.P.; Muhammed, M.; Munoz, A.; Muzyk, M.; Nordlund, K.; Nguyen-Manh, D.; Opschoor, J.; Ordás, N.; Palacios, T.; Pintsuk, G.; Pippan, R.; Reiser, J.; Riesch, J.; Roberts, S. G.; Romaner, L.; Rosiński, M.; Sanchez, M.; Schulmeyer, W.; Traxler, H.; Urena, A.; van der Laan, J.G.; Veleva, L.; Wahlberg, S.; Walter, M.; Weber, T.; Weitkamp, T.; Wurster, S.; Yar, M.A.; You, J.H.; Zivelonghi, A.


    Roč. 442, 1-3 (2013), S173-S180. ISSN 0022-3115. [Fifteenth International Conference on Fusion Reactor Materials. Charleston, South Carolina, 16.10.2011-22.10.2011] Institutional support: RVO:61389021 Keywords : tungsten * joining * composites * graded materials * fusion materials Subject RIV: JI - Composite Materials Impact factor: 2.016, year: 2013

  6. A brief review of the low temperature thermal properties of crystalline and glassy materials

    International Nuclear Information System (INIS)

    The thermal properties of crystalline and amorphous materials have been reviewed. It is found that the specific heats of many crystalline materials at low temperatures deviate from the Debye T law and can be explained using flat TA mode. The thermal conductivity of many crystalline material such as ice-Ih and clathrate hydrate at low temperatures is not well understood. (author)

  7. AC Humidity Sensing Properties of Mesoporous K2CO3-SiO2 Composite Materials

    Directory of Open Access Journals (Sweden)

    Liang Guo


    Full Text Available The mesoporous silica SBA-15 and mesoporous K2CO3-SiO2 composite material were synthesized. Characterization of microstructure and morphology of materials indicated that the composite material had saved the porous framework of mesoporous silica SBA-15. Humidity sensing properties of different inverse proportion K2CO3-SiO2 composite material were studied and we found that the sample with 0.16 g/g K2CO3 exhibited excellent linearity in the wide humidity range. The complex impedance changed five orders of magnitude from 11% RH to 95% RH. The rapid response and recovery time were 10 s and 38 s, respectively. Finally a feasible ion transfer mechanism was brought forward to explain the sensing mechanism.

  8. A brief summary of the progress on the EFDA tungsten materials program

    International Nuclear Information System (INIS)

    The long-term objective of the European Fusion Development Agreement (EFDA) fusion materials programme is to develop structural and armor materials in combination with the necessary production and fabrication technologies for reactor concepts beyond the International Thermonuclear Experimental Reactor. The programmatic roadmap is structured into four engineering research lines which comprise fabrication process development, structural material development, armor material optimization, and irradiation performance testing, which are complemented by a fundamental research programme on “Materials Science and Modeling.” This paper presents the current research status of the EFDA experimental and testing investigations, and gives a detailed overview of the latest results on materials research, fabrication, joining, high heat flux testing, plasticity studies, modeling, and validation experiments

  9. Nutrition Education Materials and Audiovisuals for Grades Preschool through 6. Special Reference Briefs Series. (United States)

    Evans, Shirley King, Comp.

    This bibliography was prepared for educators interested in nutrition education materials, audiovisuals, and resources for classroom use. Items listed cover a range of topics including general nutrition, food preparation, food science, and dietary management. Teaching materials listed include food models, games, kits, videocassettes, and lesson…

  10. Food packaging materials and radiation processing of food: a brief review

    International Nuclear Information System (INIS)

    Food is usually packaged to prevent microbial contamination and spoilage. Ionizing radiation can be applied to food-packaging materials in two ways: (i) sterilization of packaging materials for aseptic packaging, and (ii) radiation processing of prepackaged food. In aseptic packaging, a sterile package is filled with a sterile product in a microbiologically controlled environment. In irradiation of prepackaged food, the food and the packaging material are irradiated simultaneously. For both applications, the radiation stability of the packaging material is a key consideration if the technology is to be used successfully. To demonstrate the radiation stability of the packaging material, it must be shown that irradiation does not significantly alter the physical and chemical properties of the material. The irradiated material must protect the food from environmental contamination while maintaining its organoleptic and toxicological properties. Single-layer plastics cannot meet the requirements of either application. Multilayered structures produced by coextrusion would likely satisfy the demands of radiation processing prepackaged food. In aseptic packaging, the package is irradiated prior to filling, making demands on toxicological safety less stringent. Therefore, multilayered structures produced by coextrusion, lamination or co-injection moulding could satisfy the requirements. (author)

  11. Space station needs, attributes and architectural options study. Briefing material: Final review and executive summary (United States)


    Advantages and disadvantages were assessed for configuration options for a modular 14' diameter space station, a modular aft cargo carrier and a shuttle derived vehicle. Early, intermediate, and mature configurations were defined as well as power requirements, heat rejection, hydrazine usage, and the external scavenging concept. Subsystems were analyzed for propulsion, attitude control, data processing, and communications. Areas of uncertainties, associated costs and benefits, and the cost by phase of the modular and shuttle derived vehicle configurations were identified. Technologies assessed included solar vs nuclear; gravity gradient vs active control; heat pipe radiators vs fluid loops; distributed processors vs centralized, and modular vs shuttle derived configuration. It was determined that the early space station architecture should include: (1) reusable OTV with aerobraking; (2) TMS with telepresence services; (3) OTV/TMS refueling and servicing capability; and (4) attached research laboratories for life sciences and materials processing.

  12. Investigation of In-Flight Melting Behaviour of Granulated Glass Raw Material by Multi-Phase AC Arc Plasma and Hybrid Plasma

    International Nuclear Information System (INIS)

    An innovative in-flight glass melting technology was developed for a purpose of energy saving and environmental protection. Granulated glass raw materials with small diameter were treated by twelve-phase AC arc and that combined with an oxygen burner. The particle measurement was carried out to investigate the in-flight melting behavior of glass raw materials during the in-flight melting by twelve-phase AC arc. Obtained results show the mean particle velocity was about 9 m s-1 and mean temperature was about 2600 K. The high vitrification degree achieved within several milliseconds reveals that the new in-flight melting technology of hybrid plasma treating can reduce energy consumption and shorten the glass production cycle.

  13. Galvanic coupling between D6AC steel, 6061-T6 aluminum, Inconel 718 and graphite-epoxy composite material: Corrosion occurrence and prevention (United States)

    Danford, M. D.; Higgins, R. H.


    The effects of galvanic coupling between D6AC steel, 6061-T6 aluminum, Inconel 718, and graphite-epoxy composite material (G/E) in 3.5% NaCl were studied. Measurements of corrosion potentials, galvanic currents and corrosion rates of the bare metals using weight-loss methods served to establish the need for corrosion protection in cases where D6AC steel and 6061-T6 aluminum are galvanically coupled to G/E in salt water while Inconel 718 was shown to be compatible with G/E. Six tests were made to study corrosion protective methods for eliminating galvanic corrosion in the cases of D6AC steel and 6061-T6 aluminum coupled to G/E. These results indicate that, when the G/E is completely coated with paint or a paint/polyurethane resin combination, satisfactory protection of the D6AC steel is achieved with either a coat of zinc-rich primer or a primer/topcoat combination. Likewise, satisfactory corrosion protection of the aluminum is achieved by coating it with an epoxy coating system.

  14. Processing of Bulk YBa2Cu3O(7-x) High Temperature Superconductor Materials for Gravity Modification Experiments and Performance Under AC Levitation (United States)

    Koczor, Ronald; Noever, David; Hiser, Robert


    We have previously reported results using a high precision gravimeter to probe local gravity changes in the neighborhood of bulk-processed high temperature superconductor disks. Others have indicated that large annular disks (on the order of 25cm diameter) and AC levitation fields play an essential role in their observed experiments. We report experiments in processing such large bulk superconductors. Successful results depend on material mechanical characteristics, and pressure and heat treat protocols. Annular disks having rough dimensions of 30cm O.D., 7cm I.D. and 1 cm thickness have been routinely fabricated and tested under AC levitation fields ranging from 45 to 300OHz. Implications for space transportation initiatives and power storage flywheel technology will be discussed.

  15. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)


    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  16. Non-Destructive Evaluation of Microstructure of SiC/AC8A Composite Material by Ultrasonic Measurement

    International Nuclear Information System (INIS)

    This study is performed to establish a non-destructive evaluation method for metal matrix composite using ultrasonic technique. The specimen is made of SiC/AC8A metal matrix composite by squeeze-casting method. Three kinds or reinforced particles are prepared as 4.86, 8.09 and 11.44μm to investigate the effect of size on the mechanical and ultrasonic properties of metal matrix composite. In addition, four different volume fractions (14, 22.5, 27.5, 35%) of reinforced particles are prepared per each size to examine the effect of volume fraction on the ultrasonic properties. From this specimen, the availability and precision of measurement of Young's modulus are examined and the evaluation method for microstructure of metar matrix composite using the speed of sound and attenuation factor is also reviewed. The results show that the Young's modulus measured by ultrasonic method is as effective as that measured by mechanical method. It is also known that the size and volume fraction of reinforced fiber are precisely evaluated using the speed of sound and attenuation factor

  17. Hydrogen storage studies on palladium-doped carbon materials (AC, CB, CNMs) @ metal-organic framework-5. (United States)

    Viditha, V; Srilatha, K; Himabindu, V


    Metal organic frameworks (MOFs) are a rapidly growing class of porous materials and are considered as best adsorbents for their high surface area and extraordinary porosity. The MOFs are synthesized by using various chemicals like triethylamine, terepthalic acid, zinc acetate dihydrate, chloroform, and dimethylformamide (DMF). Synthesized MOFs are intercalated with palladium/activated carbon, carbon black, and carbon nanomaterials by chemical reduction method for the purpose of enhancing the hydrogen adsorption capacities. We have observed that the palladium doped activated carbon on MOF-5 showed high hydrogen storage capacity. This may be due to the affinity of the palladium toward hydrogen molecule. The samples are characterized by X-ray diffraction, scanning electron microscopy (SEM), and Brunauer-Emmett-Teller (BET) surface area analysis. We have observed a clear decrease in the BET surface area and pore volume. The obtained results show a better performance for the synthesized sample. To our best knowledge, no one has reported the work on palladium-doped carbon materials (activated carbon, carbon black, carbon nanomaterials) impregnated to the metal-organic framework-5. We have attempted to synthesize carbon nanomaterials using indigenously fabricated chemical vapor deposition (CVD) unit as a support. We have observed an increase in the hydrogen storage capacities. PMID:26298339

  18. High frequency AC response, DC resistivity and magnetic studies of holmium substituted Ni-ferrite: A novel electromagnetic material

    International Nuclear Information System (INIS)

    Nanoparticles of holmium substituted nickel ferrites (NiHoxFe2−xO4) with x ranging from 0.0 to 0.15 have been prepared by the sol–gel auto-combustion method. Structural and morphology studies have been performed by X-ray Diffraction (XRD), Fourier Transform Infrared Spectroscopy (FTIR), Scanning Electron Microscopy (SEM) and Atomic Force Microscopy (AFM). XRD patterns revealed the formation of pure spinel phase ferrites without any impurity phase. Lattice parameter increases along with a decrease in crystallite size with increasing the concentration of Ho3+ in the parent nickel ferrite due to large ionic radius of Ho3+ (0.901 Å) as compared to Fe3+ (0.67 Å). SEM shows the spherical, uniformly distributed homogenous nanoparticles grown by controlled reaction parameters of the sol–gel method. Complex permittivity (ε*) and complex electric modulus (M*) have been studied for the present nanoferrites in the frequency ranges of 1 MHz–1 GHz. Frequency dependent dielectric parameters (relative permittivity (ε′), dielectric loss (ε″), dielectric loss tangent (tan δ)) decreases due to holmium substitution in nickel ferrites, showing the electrical conduction is decreasing in the nickel holmium ferrites with increase in the concentration of holmium. Complex modulus plots shows the poorly resolved semi circles and relaxation of nanoferrite is studied in the high frequency region. Also the relaxation time increases due to increase in x (0.0–0.15). DC electrical resistivity increases (107 Ω-cm–1010 Ω-cm) due to holmium ions substitution in nickel ferrites. Magnetic behavior was also characterized using a Vibrating Sample Magnetometer (VSM) under an applied magnetic field of 10 kOe and shows that magnetization decreases with increase in composition of holmium in nickel ferrites. High frequency behavior, low losses and very high DC electrical resistivity made the material a novel one for electromagnetic devices. - Highlights: • High purity

  19. A Brief Description of High Temperature Solid Oxide Fuel Cell’s Operation, Materials, Design, Fabrication Technologies and Performance

    Directory of Open Access Journals (Sweden)

    Muneeb Irshad


    Full Text Available Today’s world needs highly efficient systems that can fulfill the growing demand for energy. One of the promising solutions is the fuel cell. Solid oxide fuel cell (SOFC is considered by many developed countries as an alternative solution of energy in near future. A lot of efforts have been made during last decade to make it commercial by reducing its cost and increasing its durability. Different materials, designs and fabrication technologies have been developed and tested to make it more cost effective and stable. This article is focused on the advancements made in the field of high temperature SOFC. High temperature SOFC does not need any precious catalyst for its operation, unlike in other types of fuel cell. Different conventional and innovative materials have been discussed along with properties and effects on the performance of SOFC’s components (electrolyte anode, cathode, interconnect and sealing materials. Advancements made in the field of cell and stack design are also explored along with hurdles coming in their fabrication and performance. This article also gives an overview of methods required for the fabrication of different components of SOFC. The flexibility of SOFC in terms fuel has also been discussed. Performance of the SOFC with varying combination of electrolyte, anode, cathode and fuel is also described in this article.

  20. AC Analysis of PEO10LiCF3SO3 Polymeric Material for Memory Storage Application

    Directory of Open Access Journals (Sweden)

    Mahmoud Z. Iskandarani


    Full Text Available Problem statement: Intelligent systems that need to accurately represent human brain requires analogue devices such as a neural switch that processes decision signals and can actually remember the made decision. Polymeric material such as PEO10LiCF3SO3, which previously used in high energy, long life storage batteries, is used here to implement the principle of storage with the required analogue memory. Approach: A number of PEO10LiCF3SO3 devices tested in a controlled environment and their impedance response to both frequency and temperature recorded, analyzed and plotted for interpretation. Results: The tested devices showed ability for charge storage due to its variable impedance response at a range of frequencies, while sustaining very high impedance at DC. The device response found to be affected by intermediate temperatures, with symmetrical response at both low, mid and high temperatures. Conclusion: The designed and tested device showed promising characteristics in terms of memory storage as a neural switch. Its high impedance at DC and low impedance at high frequencies with logarithmic response represented the desired features in a reprogrammable analogue device.

  1. Cobalt based layered perovskites as cathode material for intermediate temperature Solid Oxide Fuel Cells: A brief review (United States)

    Pelosato, Renato; Cordaro, Giulio; Stucchi, Davide; Cristiani, Cinzia; Dotelli, Giovanni


    Nowadays, the cathode is the most studied component in Intermediate Temperature-Solid Oxide Fuel Cells (IT-SOFCs). Decreasing SOFCs operating temperature implies slow oxygen reduction kinetics and large polarization losses. Double perovskites with general formula REBaCo2O5+δ are promising mixed ionic-electronic conductors, offering a remarkable enhancement of the oxygen diffusivity and surface exchange respect to disordered perovskites. In this review, more than 250 compositions investigated in the literature were analyzed. The evaluation was performed in terms of electrical conductivity, Area Specific Resistance (ASR), chemical compatibility with electrolytes and Thermal Expansion Coefficient (TEC). The most promising materials have been identified as those bearing the mid-sized rare earths (Pr, Nd, Sm, Gd). Doping strategies have been analyzed: Sr doping on A site promotes higher electrical conductivity, but worsen ASR and TECs; B-site doping (Fe, Ni, Mn) helps lowering TECs, but is detrimental for the electrochemical properties. A promising boost of the electrochemical activity is obtained by simply introducing a slight Ba under-stoichiometry. Still, the high sensitivity of the electrochemical properties against slight changes in the stoichiometry hamper a conclusive comparison of all the investigated compounds. Opportunities for an improvement of double perovskite cathodes performance is tentatively foreseen in combining together the diverse effective doping strategies.

  2. Apuntes de Acústica


    Martín Domingo, Agustín


    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  3. Brief News

    Institute of Scientific and Technical Information of China (English)


    Huamei RE High-tech Intending to Raise the Price of Mixed RE Carbonate Recently announced by Baotou Huamei Rare Earth High-tech Co., Ltd, since 12 May 2005, price of mixed rare earth carbonate was RMB$420 raised per ton. Thus factory price of RE carbonate per ton (REO 45%) approached RMB$4,900. By 2005, Chinese RE industry has experienced 4 years' downturn. Prices of various RE products continuously falling, contrast to endlessly price rising of raw materials, coal,

  4. Brief news

    Institute of Scientific and Technical Information of China (English)


    More and more Chinese rare earth enterprises in- volving in production suspension to stabilize market Affected by economy depression, rare earth market underwent downturn since the second half of 2012. Price of rare earth products went downwardconstantly and dealings were slow in the market. To stabilize the market and balance supply and demand, more and more Chinese rare earth producers are involving in production suspension. Inner Mongolia Baotou Steel Rare-Earth Hi-Tech announced that the company decided to suspend production of its rare earth roasting, smelting and separation plants that process Baotou rare earth minerals and Quannan Jinghuan Technology Co., Ltd and Xinfeng Xinli Rare Earths Co., Ltd that deal with southern rare earth minerals for one month from October 23. Baotou Steel Rare-Earth will temporarily stop raw material supply to those plants.

  5. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun


    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  6. The Problem with Briefs, in Brief (United States)

    Conaway, Carrie L.


    Policy briefs written by academics--the kind typically published in "Education Finance and Policy"--should be a crucial source of information for policy makers. Yet too frequently these briefs fail to garner the consideration they deserve. Their authors are too focused on the potential objections of their fellow academics, who are…

  7. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  8. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  9. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE


    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  10. AC1 Wing


    Adrian DOBRE


    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  11. Prescribing Brief Psychotherapy


    Schuyler, Dean


    Brief psychotherapy has demonstrated its effectiveness in treating emotional disorders and helping with problems that typically present to primary care physicians. Because practitioners receive little instruction about this treatment option and often have erroneous preconceived ideas about it, psychotherapy remains underprescribed. Effective brief therapy enables the patient to problem-solve, facilitates the relationship with the provider, and ultimately clarifies the patient's situation. Ref...

  12. 浅析秸秆在建筑材料中的应用%Brief Analysis on the Application of Straw in Building Material

    Institute of Scientific and Technical Information of China (English)

    顾艺; 陈健


    this paper introduced the development history of the straw being used as building material in foreign countries, analyzed the features of the straw material, expounded the advantages of straw material, including natural, renewable, zero-emission, low-energy, highly heat-insulated features. Providing people with sustainable living environment and meeting their psychological need of being close to nature is the new developing direction for future building materials.%追溯国外秸秆建材的发展历史,分析了秸秆材料的特性,揭示出秸秆材料的天然可再生、零排放、低能耗、高隔热的优点,满足人们生存环境可持续发展要求以及亲近自然的心理需求,是未来建筑材料的新方向。

  13. Enzyme-based lignocellulose hydrolyzation – Brief data survey for cellulase performance characterization on behalf of the Sauter mean diameter of raw material particles

    Directory of Open Access Journals (Sweden)

    Robert Glaser


    Full Text Available The data presented here supports the informational background of enzyme-based lignocellulose hydrolyzation, cellulase characterization, and sugar yield prediction for the work “Enzyme-based lignocellulose hydrolyzation – Sauter mean diameter of raw materials as a basis for cellulase performance characterization and yield prediction” by Glaser [1]. Glucose yields from the enzymatic hydrolysis of the raw materials were shown as a function of cellulase enzyme loading as well as of particle size with different solid loading. The data for the proposed methods of the determination of enzyme activity in inhomogeneous samples of lignocellulosic raw materials are presented. The data of the empirical model that was developed for the prediction of hydrolysis yields for different enzyme concentrations, substrate specific particle size, and solid loadings, are given. Data are also given in relation of terms of scale-up opportunities.

  14. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter


    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  15. Organic Electrochromic Materials: A Brief Review of Viologens, Phthalocyanines and Some Complexes of Transition Metals [Materiais Eletrocrômicos Orgânicos: Uma Breve Revisão de Viológenos, Ftalocianinas e Alguns Complexos de Metais de Transição

    Directory of Open Access Journals (Sweden)

    Renato S. de Oliveira


    Full Text Available An electrochromic material is one that has the ability to change its color reversibly to undergo redox reactions when stimulated by an electrical current or by an adequate potential difference. The electrochromic materials can be classified as transition metal oxides,intercalation materials or organic materials. This work has proposed to do a brief review of the class of organic electrochromic materials, giving greater emphasis to subclasses of viologens, phthalocyan ines and transition metal complexes. These materials have a wide technological application, such as windows controllable transmittance (smart window displays, rear-view mirrors for vehicles, among other applications.

  16. Medicaid Issue Briefs (United States)

    U.S. Department of Health & Human Services — MS, in collaboration with Mathematica, has started the MAX Medicaid policy issue brief series, which highlights the essential role MAX data can play in analyzing...

  17. ac bidirectional motor controller (United States)

    Schreiner, K.


    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  18. Theoretical analysis of ac losses in high temperature superconducting bulks

    International Nuclear Information System (INIS)

    Ac loss behavior in HTS bulk materials is studied by developing an analytic method. The self-heating effect on the distributions of temperature in HTS bulks has been calculated. A critical frequency which sets the upper limit for driving frequency of the external field in sustaining a superconducting state is obtained. Our model provides useful information of understanding the experimental phenomena, including an anomalous ac loss behavior, a retardation of the inner field respect to the external ac field, etc., in HTS bulk materials

  19. NASA Tech Briefs, May 1999. Volume 23, No. 5 (United States)


    Topics include: special coverage sections on sensors and composites and plastics, and sections on electronic components and systems, software, materials, mechanics, machinery and automation, bio-medical, physical sciences, book and reports, and a special section of Photonics Tech Briefs and Rapid Product Development Tech Briefs.

  20. NASA Tech Briefs, October 1999. Volume 23, No. 10 (United States)


    Topics include: special coverage section on data acquisition and sensors and sections on electronic components and systems, software, materials, mechanics, machinery/automation, manufacturing/fabrication, bio-medical, physical sciences, information sciences, book and reports, and special section of Electronics Tech Briefs and Motion Control Tech briefs

  1. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  2. Hermetisk AC-Krets


    Hirsch, Carl; Smirnoff, Alexander


    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  3. Recent developments: Industry briefs

    International Nuclear Information System (INIS)

    This article is the 'Industry Briefs' portion of Nuexco's March 1991 'Recent Developments' section. Specific items discussed include: (1) a joint fuels venture between Nuexco and Energy Fuels, (2) bids for two nuclear units in Czechoslovakia, (3) plans for nuclear power in China, (4) uranium mining in Queensland, (5) marketing of nuclear power technology by India, and (6) uranium production in Australia

  4. Research in Brief. (United States)

    Mulder, Ronald; And Others


    Presents brief reports of research conducted in the following areas: media credibility, network television news audiences, influences of television newscasters' on-camera image, Blacks in introductory advertisements, children's television preferences, messages in Depression-era photographs, and journalism education issues covered in two…

  5. 2011 SREB Legislative Briefing (United States)

    Gaines, Gale F., Comp.


    The "2011 Legislative Briefing" is a topical summary of state budget and legislative actions that affect elementary, secondary and higher education across the Southern Regional Education Board (SREB) region. It outlines actions in areas such as tax and spending legislation, assistance to local districts, tuition and fees, student financial…

  6. Superintendent's Briefing Book, 2010 (United States)

    Educational Research Service, 2009


    The "2010 Superintendent's Briefing Book" provides comprehensive yet concise overviews of the best thinking available on a wide range of top-priority PreK-12 education concerns. This resource will prove invaluable in making research-based decisions with confidence, and in identifying programs and practices that will improve student achievement.…

  7. DCC Briefing Paper: Annotation


    Abbott, Daisy


    The DCC has assembled a group of briefing papers that together form an introduction to curation. These concise overviews are designed to help grow your basic understanding of key curation issues by providing a high-level introduction to a given topic.

  8. Superintendent's Briefing Book, 2011 (United States)

    Educational Research Service, 2010


    The "2011 Superintendent's Briefing Book" provides comprehensive yet concise overviews of the best thinking available on a wide range of top-priority PreK-12 education concerns. This resource will prove invaluable in making research-based decisions with confidence, and in identifying programs and practices that will improve student achievement.…

  9. Informatics: A Brief Survey. (United States)

    He, Shaoyi


    Provides a brief survey of informatics, defined as the application of information technology to various fields, with respect to its historical background, disciplinary identity, fundamental aspects, applications, and challenges. Highlights include biological, clinical, dental, environmental, geomatics, health, legal, management, medical, museum,…

  10. Research in Brief. (United States)

    Journalism Quarterly, 1984


    Brief research reports discuss Latin America as seen on United States network television; television news coverage of federal regulatory agencies; community perceptions of media impressions; active television viewing and cultivation hypothesis; the impact of cable on traditional television news viewing; George Kibbe Turner; advertising; and…

  11. A Brief Demographic Portrait (United States)

    Nieto, Sonia


    This article presents a brief demographic portrait, with particular emphasis on school-related issues, that points to the dire situation of Latino/a education. According to the 2010 Census, the number of Hispanics (the term used in government data) currently was 50,477,594 million, an increase of 43 percent since 2000, making this group the…

  12. Research in Brief. (United States)

    Journalism Quarterly, 1982


    Offers brief descriptions of research concerning (1) media bias toward business, (2) foreign affairs coverage in elite and mass periodicals, (3) how emphasis on people affects coverage of crime, (4) antisocial and prosocial behavior on prime-time television, (5) network news coverage of Iran, and (6) magazines' reporting on insects. (FL)

  13. Issue Brief on Diversity (United States)

    Division on Developmental Disabilities, Council for Exceptional Children (NJ1), 2013


    During the past year, the Diversity Committee of the Division of Developmental Disabilities (DDD) Board worked with the Board and the Issues Committee Chair to develop an issue brief addressing diversity, its impact on the membership and the wider community that is served by the work of DDD, resulting in recommendations that will influence policy…

  14. Academic Bankruptcy. Policy Brief. (United States)

    Anderson, Amy Berk; Lewis, Anne C.

    In an effort to improve student achievement in low-performing districts, 22 states have developed academic bankruptcy laws, allowing them to intervene in districts that consistently fail to satisfy state education performance standards. This policy brief presents an overview of these statutes. The text offers a comparative summary of state…

  15. NASA Tech Briefs, January 1999. Volume 23, Mp/ 1 (United States)


    Topics include: special coverage sections on sensors and data acquisition and sections on electronic components and circuits, electronic software, materials, mechanics, bio-medical physical sciences, book and reports, and a special section of Photonics Tech Briefs.

  16. NASA Tech Briefs, November 2002. Volume 26, No. 11 (United States)


    Topics include: a technology focus on engineering materials, electronic components and systems, software, mechanics, machinery/automation, manufacturing, bio-medical, physical sciences, information sciences book and reports, and a special section of Photonics Tech Briefs.

  17. NASA Tech Briefs, September 2001. Volume 25, No. 9 (United States)


    Topics include: special coverage section on sensors, and sections on electronic components systems, software, materials, machinery/automation, manufacturing/fabrication, bio-medical, book and reports, and a special section of Photonics Tech Briefs.

  18. NASA Tech Briefs, July 2002. Volume 26, No. 7 (United States)


    Topics include: a technology focus sensors, software, electronic components and systems, materials, mechanics, machinery/automation, manufacturing, bio-medical, physical sciences, information sciences, book and reports, and a special section of Photonics Tech Briefs.

  19. NASA Tech Briefs, September 2002. Volume 26, No. 9 (United States)


    Topics include: a technology focus on data acquisition, electronic components and systems, software, materials, mechanics, machinery/automation, bio-medical, physical sciences, book and reports, and a special section of Photonics Tech Briefs.

  20. Cybernetics of Brief Family Therapy. (United States)

    Keeney, Bradford P.; Ross, Jeffrey M.


    Presents a cybernetic view of brief family therapy. Includes a historical discussion of the key ideas underlying brief family therapy, a cybernetic model of therapeutic change, and a clinical case for exemplification. (Author/JAC)

  1. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar


    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  2. Superconducting ac cable

    International Nuclear Information System (INIS)

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  3. My brief history

    CERN Document Server

    Hawking, Stephen


    My Brief History recounts Stephen Hawking’s improbable journey, from his postwar London boyhood to his years of international acclaim and celebrity. Lavishly illustrated with rarely seen photographs, this concise, witty, and candid account introduces readers to a Hawking rarely glimpsed in previous books: the inquisitive schoolboy whose classmates nicknamed him Einstein; the jokester who once placed a bet with a colleague over the existence of a particular black hole; and the young husband and father struggling to gain a foothold in the world of physics and cosmology. Writing with characteristic humility and humor, Hawking opens up about the challenges that confronted him following his diagnosis of ALS at age twenty-one. Tracing his development as a thinker, he explains how the prospect of an early death urged him onward through numerous intellectual breakthroughs, and talks about the genesis of his masterpiece A Brief History of Time—one of the iconic books of the twentieth century.

  4. Strategic forces briefing

    Energy Technology Data Exchange (ETDEWEB)

    Bing, G.; Chrzanowski, P.; May, M.; Nordyke, M.


    The Strategic Forces Briefing'' is our attempt, accomplished over the past several months, to outline and highlight the more significant strategic force issues that must be addressed in the near future. Some issues are recurrent: the need for an effective modernized Triad and a constant concern for force survivability. Some issues derive from arms control: the Strategic Arms Reduction Talks (SALT) are sufficiently advanced to set broad numerical limits on forces, but not so constraining as to preclude choices among weapon systems and deployment modes. Finally, a new administration faced with serious budgetary problems must strive for the most effective strategic forces limited dollars can buy and support. A review of strategic forces logically begins with consideration of the missions the forces are charged with. We begin the briefing with a short review of targeting policy and implementation within the constraints of available unclassified information. We then review each element of the Triad with sections on SLBMs, ICBMs, and Air-Breathing (bomber and cruise missile) systems. A short section at the end deals with the potential impact of strategic defense on offensive force planning. We consider ABM, ASAT, and air defense; but we do not attempt to address the technical issues of strategic defense per se. The final section gives a brief overview of the tritium supply problem. We conclude with a summary of recommendations that emerge from our review. The results of calculation on the effectiveness of various weapon systems as a function of cost that are presented in the briefing are by Paul Chrzanowski.

  5. Recent developments: Industry briefs

    International Nuclear Information System (INIS)

    This article is the 'Industry Briefs' portion of Nuexco's July 1992 'Recent Developments' section. Specific items mentioned include: (1) the merger of Entergy and Gulf States Utilities, (2) restart of the Sequoyah Fuels facility in Oklahoma, (3) development of the 7th and 8th nuclear units in Taiwan, (4) purchase of interest in Rio Algom, Ltd, and (5) acquisition of the Italian firm AGIP by a Canadian company

  6. Brief review: delirium


    Schmitz ED; Vu JB


    No abstract available. Article truncated after 150 words. A significant number of patients develop a decline in cognitive function while hospitalized. Delirium in the intensive care increases mortality and healthcare costs and should be recognized and treated promptly (1,2). This is a brief review of delirium and important treatment options such as early percutaneous tracheostomy, neuroleptics, propofol, daily awakenings and reorientation by all team members. We recommend neither neuroimaging...

  7. Lecture notes on Elasto-plastic materials

    DEFF Research Database (Denmark)

    Hededal, Ole


    Brief introduction to material modelling within the framework of rate independent elasto-plastic constitutive modelling......Brief introduction to material modelling within the framework of rate independent elasto-plastic constitutive modelling...

  8. Electricity Storage. Technology Brief

    Energy Technology Data Exchange (ETDEWEB)

    Simbolotti, G. [Italian National Agency for New Technologies, Energy and Sustainable Economic Development ENEA, Rome (Italy); Kempener, R. [International Renewable Energy Agency IRENA, Bonn (Germany)


    Electricity storage is a key technology for electricity systems with a high share of renewables as it allows electricity to be generated when renewable sources (i.e. wind, sunlight) are available and to be consumed on demand. It is expected that the increasing price of fossil fuels and peak-load electricity and the growing share of renewables will result in electricity storage to grow rapidly and become more cost effective. However, electricity storage is technically challenging because electricity can only be stored after conversion into other forms of energy, and this involves expensive equipment and energy losses. At present, the only commercial storage option is pumped hydro power where surplus electricity (e.g. electricity produced overnight by base-load coal or nuclear power) is used to pump water from a lower to an upper reservoir. The stored energy is then used to produce hydropower during daily high-demand periods. Pumped hydro plants are large-scale storage systems with a typical efficiency between 70% and 80%, which means that a quarter of the energy is lost in the process. Other storage technologies with different characteristics (i.e. storage process and capacity, conversion back to electricity and response to power demand, energy losses and costs) are currently in demonstration or pre-commercial stages and discussed in this brief report: Compressed air energy storage (CAES) systems, Flywheels; Electrical batteries; Supercapacitors; Superconducting magnetic storage; and Thermal energy storage. No single electricity storage technology scores high in all dimensions. The technology of choice often depends on the size of the system, the specific service, the electricity sources and the marginal cost of peak electricity. Pumped hydro currently accounts for 95% of the global storage capacity and still offers a considerable expansion potential but does not suit residential or small-size applications. CAES expansion is limited due to the lack of suitable

  9. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam


    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  10. Brief introduction to relativity

    International Nuclear Information System (INIS)

    A brief, but rigorous and uncondensed, introduction to special relativity is given. The reader is assumed to be familiar with coordinate transformations in general and to have a reasonable grasp of advanced calculus and vector analysis. The subject is presented under the following topics: hypotheses underlying the Lorentz transformation, kinematics and algebraic properties of the Lorentz transformation, vectors and tensors in relativity, the electromagnetic field and Maxwell's equations, the dynamics of a particle and the Lorentz force equation, photons and relativistic optics, and applications of relativistic optics. 3 figures

  11. AcEST: BP920072 [AcEST

    Lifescience Database Archive (English)


  12. Analytical description of AC losses for high temperature superconductors

    International Nuclear Information System (INIS)

    Full text: AC losses for high temperature superconductors have been calculated by considering the effects of the temperature distribution and the flux flow resistance. Maxwell's equations and thermal diffusion equation are used to calculate the distribution of magnetic field and the temperature inside the superconductors, respectively. The flux flow effect on the AC losses is calculated by using the extended critical state model. An analytical expression of the AC losses is obtained using a superposition approximation in which the cases of complete and incomplete magnetic field penetration have been distinguished. The expression can well explain the experimental observations of the frequency dependence of the AC losses per cycle in high temperature superconductors. It is clearly shown from the analytical expression that the effect of the thermal distribution inside the superconductors is different from the effect caused by flux flow resistance. In the case of incomplete magnetic penetration, the temperature distribution results in the increase of the AC losses per cycle upon frequency whereas the flux flow leads to the decrease of the AC losses per cycle upon frequency. In the case of complete magnetic penetration the results are opposite to those in the previous case. Due to the extremely strong flux flow in high temperature superconducting materials, the effect of the flux flow on the AC losses is dominant, and the overall dependence of AC losses per cycle upon frequency is controlled by the flux flow. On the other hand, because the inhomogeneous distribution of the temperature inside the superconductors which is normal higher in the center than near the edge, there is an upper limit for the frequency beyond which the superconductivity will be totally destroyed by AC losses. Analytical expressions for the critical frequency, distributions of magnetic field and critical current density are also obtained

  13. Sustainable Markets Investment Briefings: Overview

    Energy Technology Data Exchange (ETDEWEB)

    Cotula, Lorenzo


    This is the first of a series of briefings which discuss the sustainable development issues raised by legal arrangements for the protection of foreign investment. The briefings are based on legal research by IIED and its partners. The goal is to provide accessible but accurate information for human rights, development and environmental organisations working on issues raised by foreign investment in low- and middle-income countries. Briefing 1 provides a general overview of key issues.

  14. 园林企业苗木材料信息库的应用研究%Brief Discussion on the Application of Nursery Stock Material Information Database in Landscape EnterpriseBrief Discussion on the Application of Nursery Stock Material Information Database in Landscape Enterprise

    Institute of Scientific and Technical Information of China (English)



    In general ,the purchase amount of nursery stock in landscape construction enterprise occupies the largest part of the overall amount of purchase .The control of the costs and quality in the nursery stock mate‐rial's procurement and supply process has become one of the key factors that determine the overall project cost control and landscape effects .Establishing a rational and effective nursery stock material database can enable enterprise's procurement and supply management reach a multiplier effect .T his article analyzes and il‐lustrates the establishment and application of information database in landscape construction enterprise .%分析了苗木材料信息库的建立和数据内容,从预算成本、苗木材料购价、采购供应方案管理、企业展示等方面探讨了园林企业苗木材料信息库的应用,以期提供参考。

  15. Induction Motor Control through AC/DC/AC Converters


    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid


    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  16. AcEST: BP920905 [AcEST

    Lifescience Database Archive (English)


  17. AcEST: DK950147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  18. AcEST: DK959344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  19. AcEST: DK949716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  20. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))


    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  1. Brief encounter networks

    CERN Document Server

    Kostakos, Vassilis; Penn, Alan


    Many complex human and natural phenomena can usefully be represented as networks describing the relationships between individuals. While these relationships are typically intermittent, previous research has used network representations that aggregate the relationships at discrete intervals. However, such an aggregation discards important temporal information, thus inhibiting our understanding of the networks dynamic behaviour and evolution. We have recorded patterns of human urban encounter using Bluetooth technology thus retaining the temporal properties of this network. Here we show how this temporal information influences the structural properties of the network. We show that the temporal properties of human urban encounter are scale-free, leading to an overwhelming proportion of brief encounters between individuals. While previous research has shown preferential attachment to result in scale-free connectivity in aggregated network data, we found that scale-free connectivity results from the temporal prope...

  2. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented and...... analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  3. NASA Tech Briefs, February 2009 (United States)


    Tech Briefs are short announcements of innovations originating from research and development activities of the National Aeronautics and Space Administration. They emphasize information considered likely to be transferable across industrial, regional, or disciplinary lines and are issued to encourage commercial application. Topics covered include: Measuring Low Concentrations of Liquid Water in Soil; The Mars Science Laboratory Touchdown Test Facility; Non-Contact Measurement of Density and Thickness Variation in Dielectric Materials; Compact Microwave Fourier Spectrum Analyzer; InP Heterojunction Bipolar Transistor Amplifiers to 255 GHz; Combinatorial Generation of Test Suites; In-Phase Power-Combined Frequency Tripler at 300 GHz; Electronic System for Preventing Airport Runway Incursions; Smaller but Fully Functional Backshell for Cable Connector; Glove-Box or Desktop Virtual-Reality System; Composite Layer Manufacturing with Fewer Interruptions; Improved Photoresist Coating for Making CNT Field Emitters; A Simplified Diagnostic Method for Elastomer Bond Durability; Complex Multifunctional Polymer/Carbon-Nanotube Composites; Very High Output Thermoelectric Devices Based on ITO Nanocomposites; Reducing Unsteady Loads on a Piggyback Miniature Submarine; Ultrasonic/Sonic Anchor; Grooved Fuel Rings for Nuclear Thermal Rocket Engines; Pulsed Operation of an Ion Accelerator; Autonomous Instrument Placement for Mars Exploration Rovers; Mission and Assets Database; TCP/IP Interface for the Satellite Orbit Analysis Program (SOAP); Trajectory Calculator for Finite-Radius Cutter on a Lathe; Integrated System Health Management Development Toolkit.

  4. Brief review: delirium

    Directory of Open Access Journals (Sweden)

    Schmitz ED


    Full Text Available No abstract available. Article truncated after 150 words. A significant number of patients develop a decline in cognitive function while hospitalized. Delirium in the intensive care increases mortality and healthcare costs and should be recognized and treated promptly (1,2. This is a brief review of delirium and important treatment options such as early percutaneous tracheostomy, neuroleptics, propofol, daily awakenings and reorientation by all team members. We recommend neither neuroimaging nor neurology consultation unless physical exam suggests an acute cerebral vascular accident or status epilepticus as the majority of these patients require no neurologic intervention and may be harmed by transportation to obtain additional testing. The DSM-5 defines delirium as a disturbance in attention (reduced ability to direct, focus, sustain, and shift attention and awareness (reduced orientation to the environment. The disturbance develops over a short period of time (usually hours to a few days, represents a change from baseline attention and awareness, and tends to fluctuate in severity ...

  5. A New Approach for RRR Determination of Niobium Single Crystal Based on AC Magnetic Susceptibility (United States)

    Ermakov, Alexey; Korolev, Alexander V.; Singer, Waldemar; Singer, Xenia


    Residual resistivity ratio RRR is an important integral characteristic of material purity. It was proposed to determine the RRR on base of the AC susceptibility. AC susceptibility of a number of single crystal niobium samples of different orientations types ( , rpar; and differently treated (BCP 70, 150 μm, annealing 800° C/2h) was measured. The RRR value was determined on base of these results using a relation between the imaginary part of χ″ of AC magnetic susceptibility at low frequency, AC magnetic field and resistivity ρ of the sample.

  6. AcEST: DK955197 [AcEST

    Lifescience Database Archive (English)


  7. AcEST: BP915640 [AcEST

    Lifescience Database Archive (English)


  8. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar


    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  9. Neuroophthalmology A brief Vademecum

    International Nuclear Information System (INIS)

    The stunning, intricate interaction between the visual, vestibular and optomotor systems--each a miracle on its own--ensures maintenance of orientation in space as well as visual recognition and target selection despite a host of sensory conflicts and adversary disturbances. Their main goals are to keep a target of interest on the fovea by either maintaining or shifting the direction of gaze in order to produce an accurate internal representation of the visual surroundings, in particular the selected target, and to continuously mirror the spatial relationship between these various visual elements and the self. Not surprising, the implementation of this host of elaborate neural networks encompasses almost every part of the brain, including the brainstem, cerebellum, extrapyramidal system and many areas of the cerebral cortex. Thus far, these systems are among the best investigated in brain research; and enormous knowledge was amassed over the last century employing a variety of techniques, including single cell recordings, eye movement studies, functional imaging and neuropsychological observations. In addition, this prolific line of research has enlightened many fundamental principles of neural and neuronal processing, which have subsequently enriched other fields of brain research as well as computational neuroscience, e.g. the discovery of receptive fields, which have now become a ubiquitous concept in many other areas of neurophysiology. This (improperly) brief, fractional and undoubtedly biased Vademecum is meant to accompany the reader into this marvellous field of neurophysiology and neurology. In particular, it stresses the clinical application of its functional neuroanatomy at the bedside, which, in many respects, is superior to other means of investigating a patient

  10. The Foreign Born with Science and Engineering Degrees: 2010. American Community Survey Briefs. ACSBR/10-06 (United States)

    Gambino, Christine; Gryn, Thomas


    This brief will discuss patterns of science and engineering educational attainment within the foreign-born population living in the United States, using data from the 2010 American Community Survey (ACS). The analysis is restricted to the population aged 25 and older, and the results are presented on science and engineering degree attainment by…

  11. ENDL transmittal format. Brief summary

    International Nuclear Information System (INIS)

    The LLNL Evaluated Neutron Data Library of 1982 (ENDL-82) and the LLNL Evaluated Charged Particle Library (ECPL-86) are available in the ENDL Transmittal Format, of which a brief user's guide is given in this document. (author)

  12. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O


    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  13. AcEST: BP920800 [AcEST

    Lifescience Database Archive (English)


  14. AcEST: DK945549 [AcEST

    Lifescience Database Archive (English)


  15. AcEST: BP917632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  16. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  17. AcEST: DK946687 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  18. AcEST: DK949372 [AcEST

    Lifescience Database Archive (English)


  19. NASA Tech Briefs, February 2012 (United States)


    This issue contains the following briefs: (1) Optical Comb from a Whispering Gallery Mode Resonator for Spectroscopy and Astronomy Instruments Calibration (2) Real-Time Flight Envelope Monitoring System (3) Nemesis Autonomous Test System (4) Mirror Metrology Using Nano-Probe Supports (5) Automated Lab-on-a-Chip Electrophoresis System (6) Techniques for Down-Sampling a Measured Surface Height Map for Model Validation (7) Multi-Component, Multi-Point Interferometric Rayleigh/Mie Doppler Velocimeter (8) Frequency to Voltage Converter Analog Front-End Prototype (9) Dust-Tolerant Intelligent Electrical Connection System (10) Gigabit Ethernet Asynchronous Clock Compensation FIFO (11) High-Speed, Multi-Channel Serial ADC LVDS Interface for Xilinx Virtex-5 FPGA (12) Glovebox for GeoLab Subsystem in HDU1-PEM (13) Modified Process Reduces Porosity when Soldering in Reduced Gravity Environments (14) Use of Functionalized Carbon Nanotubes for Covalent Attachment of Nanotubes to Silicon (15) Flexible Plug Repair for Shuttle Wing Leading Edge (16) Three Dimensionally Interlinked, Dense, Solid Form of Single-Walled CNT Ropes (17) Axel Robotic Platform for Crater and Extreme Terrain Exploration (18) Site Tamper and Material Plow Tool - STAMP (19) Magnetic Interface for Segmented Mirror Assembly (20) Transpiration-Cooled Spacecraft-Insulation-Repair Fasteners (21) Fluorescence-Based Sensor for Monitoring Activation of Lunar Dust (22) Aperture Ion Source (23) Virtual Ultrasound Guidance for Inexperienced Operators (24) Model-Based Fault Diagnosis: Performing Root Cause and Impact Analyses in Real Time (25) Interactive Schematic Integration Within the Propellant System Modeling Environment (26) Magnetic and Electric Field Polarizations of Oblique Magnetospheric Chorus Waves (27) Variable Sampling Mapping.

  20. Spanish Language Briefs for Parents, 1995. (United States)

    ERIC Clearinghouse on Rural Education and Small Schools, Charleston, WV.

    This packet contains six briefs developed specifically for Spanish-speaking parents of Mexican origin, and English translations of the briefs. In plain language, these briefs state what researchers and practitioners have learned about various ways parents can help their children do well in school. Titles of the briefs are (1) "Apoyando el…

  1. Energy saving in ac generators (United States)

    Nola, F. J.


    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  2. SSTI Clark ACS Technology Demonstrations


    Freesland, Douglas


    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  3. A Brief Discussion on the Application of the Ideas of Cleaner Production to the Dispose of Waste Materials Containing Zine%浅谈"清洁生产"思维在含锌废料处理中的应用

    Institute of Scientific and Technical Information of China (English)

    张德华; 魏昶; 戴永年


    The cleaner production is applied to quantitatively investigate the situation of pollution and waste materials produced by every procedure in whole production of enterprise in order to find out the reasons of high consumption and pollution discharge and the treatment program,The destination goal of cleaner production is to optimize the usage of resource minimize the discharge of waste materials and upgrade the capability of treatment of pollution of the enterprise.The technical principle are produced to dispose the waste material containing zinc using cleaner production,After the materials containing zinc can be recovered,therefore the amount of waste materials discharge can be decreased greatly.

  4. NASA Tech Briefs, December 1995. Volume 19, No. 12 (United States)


    Topics include: a special focus section on Bio/Medical technology, electronic components and circuits, electronic systems, physical sciences, materials, computer programs, mechanics, machinery, manufacturing/fabrication, mathematics and information sciences, book and reports, and a special section on Laser Tech Briefs.

  5. AcEST: DK950895 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  6. AcEST: BP914304 [AcEST

    Lifescience Database Archive (English)


  7. AcEST: BP911793 [AcEST

    Lifescience Database Archive (English)


  8. AcEST: BP921649 [AcEST

    Lifescience Database Archive (English)


  9. AcEST: BP919669 [AcEST

    Lifescience Database Archive (English)


  10. AcEST: DK957916 [AcEST

    Lifescience Database Archive (English)


  11. AcEST: DK956923 [AcEST

    Lifescience Database Archive (English)


  12. AcEST: BP921492 [AcEST

    Lifescience Database Archive (English)


  13. Usability Briefing for hospital design

    DEFF Research Database (Denmark)

    Fronczek-Munter, Aneta

    building project. In practice the process, led by experts, involves the users as data sources, and results in the program of requirements for the building.This PhD thesis synthesizes the research findings and proposes a Usability Briefing process model, where briefing is a dynamic and continuous process....../usability or form/beauty. Furthermore appropriate methods are selected specifically for hospital projects.The results are published in five scientific articles and are summarised in this PhD thesis. It provides tools that contribute to satisfying the needs of future building users and maximising the usability...

  14. Mind a brief introduction

    CERN Document Server

    Searle, John R


    "The philosophy of mind is unique among contemporary philosophical subjects," writes John Searle, "in that all of the most famous and influential theories are false." One of the world's most eminent thinkers, Searle dismantles these theories as he presents a vividly written, comprehensive introduction to the mind. He begins with a look at the twelve problems of philosophy of mind--which he calls "Descartes and Other Disasters"--problems which he returns to throughout the volume, as he illuminates such topics as materialism, consciousness, the mind-body problem, intentionality, mental causation, free will, and the self. The book offers a refreshingly direct and engaging introduction to one of the most intriguing areas of philosophy.

  15. Simultaneous distribution of AC and DC power (United States)

    Polese, Luigi Gentile


    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  16. A brief 'commercial message'

    International Nuclear Information System (INIS)

    Until recently, no customs service, apart from Russia's, provided details such as radionuclide name, activity and isotopic composition on the customs declaration. Consequently, a Russian firm, Green Star Ltd, has designed and built a gamma spectrometer which enables customs officers to check on radioactive materials in special containers without opening the containers. The measurement time is 30 min. The equipment indicates the type of radionuclide, its activity, the degree of enrichment in the case of uranium and the isotopic composition in the case of plutonium. Its precision is sufficient for customs checks. In February 1997, this equipment took part in an international trial comparison of methods for determining the degree of enrichment of uranium samples placed in containers. Fifteen laboratories and companies participated, from Argentina, Belgium, France, Germany, Hungary, the Russian Federation and the United Kingdom. The measurement precision of the spectrometer is on a par with that of the best European equipment. Forty-eight per cent of the measurement results obtained with the other equipment had a deviation relative to the true value which is greater than that of the Russian results. No equipment is comparable with the Russian equipment as regards measurement capacity and speed (the equipment has also been tested at Los Alamos National Laboratory, USA, in determining the isotopic composition of military plutonium). For the principal isotopes of plutonium, the measurement deviation relative to the reference value does not exceed 3.5%. Russia's customs service has acquired some experience of methods of detecting nuclear materials which are being smuggled in the course of legal import and export operations

  17. Public Health England Briefing Papers


    Public Health England


    -Social and economic inequalities in diet and physical activity - Obesity and disability - adults - Obesity and alcohol - an overview - A simple guide to classifying body mass index in children - Knowledge and attitudes towards healthy eating and physical activity - Brief intervetions for weight management - Data sources:environmental influences on physical activity and diet - Measuring diet and physical activity in weight management interventions - Obesity and Mental ...

  18. Brief Psychotherapy: The Multimodal Model. (United States)

    Lazarus, Arnold A.


    Outlines tenets of multimodal therapy (MMT) and argues for its cost-effective yet comprehensive value as a brief psychotherapy model. Describes MMT as an integrated, seven-modality model of personality and provides clinical examples of its use. Argues that MMT approach will be an important future alternative to more expensive, time-consuming, and…

  19. Inclusive Briefing and User Involvement

    DEFF Research Database (Denmark)

    Jensen, Per Anker


    number of different processes with varying purposes before and during the design and construction activities. Thus, briefing can be regarded as a continuous process but it should also be an inclusive and interactive process with the involvement of all stakeholders, including end users. This article...


    The SIMCorB Business Plan was discussed at the ORD Infrastructure Meeting held on July 17, 2000 in Washington, D.C.The briefing explained the purpose of the Plan as a vehicle to provide a road map to attain the ORD science IM vision. The road map includes defined milestones, bu...

  1. Blades and discs in gas turbines. Behaviour of material and components. Project department A-C. Final report; Schaufeln und Scheiben in Gasturbinen. Werkstoff- und Bauteilverhalten. Projektbereiche A bis C. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)



    The special research area 339 `Blades and discs in gas turbines, behaviour of material and components` was carried on from 1988 to the end of 1196. This final report deals with the work in the years 1994, 1995 and 1996. In the project area A `Development of material` manufacturing processes both for metallic and ceramic high temperature materials were developed, tested and optimised. In the area of optimising casting structure, it was shown that the making grains finer up to the medium temperature range can be a suitable means for significantly raising the resistance to LCF loading with nearly unchanged heat and creep strength properties. Another main point was the characterisation and optimisation of sprayed ceramic layers on metallic substrates (heat insulating layers) and compound ceramic materials. In project area B `Material behaviour` the mechanisms were studied, which, particularly in metallic high temperature materials such as nickel-based superalloys, lead to failure of the material under thermo-mechanical stresses. In project area C `Component design`, on the one hand models for estimating service life for metallic high temperature materials under different thermo-mechanical stresses were developed. [Deutsch] Der Sonderforschungsbereich 339, `Schaufeln und Scheiben in Gasturbinen - Werkstoff- und Bauteilverhalten` wurde von 1988 bis Ende 1996 gefoerdert. Dieser Abschlussbericht behandelt die Arbeiten der Jahre 1994, 1995 und 1996. Im Projektbereich A `Werkstoffentwicklung` wurden Herstellungsverfahren sowohl fuer metallische als auch fuer keramische Hochtemperaturwerkstoffe entwickelt, erprobt und optimiert. Auf dem Gebiet der Gussgefuegeoptimierung konnte gezeigt werden, dass die Kornfeinung bis in den mittleren Temperaturbereich ein geeignetes Mittel sein kann, um den Widerstand gegen LCF-Belastung bei annaehernd unveraenderten Warm- und Kriechfestigkeitseigenschaften signifikant zu erhoehen. Einen weiteren Schwerpunkt bildete die Charakterisierung und

  2. Physical and Chemical Sciences Center - research briefs. Volume 1-96

    Energy Technology Data Exchange (ETDEWEB)

    Mattern, P.L.


    This report provides brief summaries of research performed in chemical and physical sciences at Sandia National Laboratories. Programs are described in the areas of advanced materials and technology, applied physics and chemistry, lasers, optics, and vision, and resources and capabilities.

  3. AcEST: DK948526 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  4. AcEST: DK962916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  5. AcEST: DK955705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  6. AcEST: DK961330 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  7. AcEST: BP913772 [AcEST

    Lifescience Database Archive (English)


  8. AcEST: DK952954 [AcEST

    Lifescience Database Archive (English)


  9. AcEST: BP912540 [AcEST

    Lifescience Database Archive (English)


  10. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques


    Rakan Kh Antar


       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  11. Brief Counseling with Hispanic American College Students. (United States)

    Littrell, John M.; Cruz, Jeannette


    Hispanic-American college students (N=16) met with a Puerto-Rican counselor for two brief counseling sessions. Brief counseling was a viable and effective approach in helping the students reach their goals. Examined types of student concerns about, and student perceptions of, brief counseling. (Author)

  12. 50 CFR 37.33 - Environmental briefing. (United States)


    ... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Environmental briefing. 37.33 Section 37..., ARCTIC NATIONAL WILDLIFE REFUGE, ALASKA Environmental Protection § 37.33 Environmental briefing. The... briefings for all of its personnel involved in field operations prior to commencement of field work...

  13. Combined AC electroosmosis and dielectrophoresis for controlled rotation of microparticles. (United States)

    Walid Rezanoor, Md; Dutta, Prashanta


    Electrorotation is widely used for characterization of biological cells and materials using a rotating electric field. Generally, multiphase AC electric fields and quadrupolar electrode configuration are needed to create a rotating electric field for electrorotation. In this study, we demonstrate a simple method to rotate dielectrophoretically trapped microparticles using a stationary AC electric field. Coplanar interdigitated electrodes are used to create a linearly polarized nonuniform AC electric field. This nonuniform electric field is employed for dielectrophoretic trapping of microparticles as well as for generating electroosmotic flow in the vicinity of the electrodes resulting in rotation of microparticles in a microfluidic device. The rotation of barium titanate microparticles is observed in 2-propanol and methanol solvent at a frequency below 1 kHz. A particle rotation rate as high as 240 revolutions per minute is observed. It is demonstrated that precise manipulation (both rotation rate and equilibrium position) of the particles is possible by controlling the frequency of the applied electric field. At low frequency range, the equilibrium positions of the microparticles are observed between the electrode edge and electrode center. This method of particle manipulation is different from electrorotation as it uses induced AC electroosmosis instead of electric torque as in the case of electrorotation. Moreover, it has been shown that a microparticle can be rotated along its own axis without any translational motion. PMID:27014394

  14. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas


    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  15. A Brief History of Context

    CERN Document Server

    Wan, Kaiyu


    Context is a rich concept and is an elusive concept to define. The concept of context has been studied by philosophers, linguists, psychologists, and recently by computer scientists. Within each research community the term context was interpreted in a certain way that is well-suited for their goals, however no attempt was made to define context. In many areas of research in computer science, notably on web-based services, human-computer interaction (HCI), ubiquitous computing applications, and context-aware systems there is a need to provide a formal operational definition of context. In this brief survey an account of the early work on context, as well as the recent work on many working definitions of context, context modeling, and a formalization of context are given. An attempt is made to unify the different context models within the formalization. A brief commentary on the usefulness of the formalization in the development of context-aware and dependable systems is included.


    Directory of Open Access Journals (Sweden)



    Full Text Available Soft-switching techniques have gained popularity in recent times because they offer many advantages over hard-switched PWM inverters such as higher efficiency, higher power density and better performances. The resonant topologies employing soft-switching are classified based on the location of resonant network in the inverter with respect to load and dc link. This is an exhaustive study of various resonant link inverter topologies that appeared in the literature in recent times. This critical literature review brings out merits, demerits, and limitations besides giving the basic operating principles of various topologies.

  17. Brief Psychotherapy in Family Practice


    MacDonald, Peter J.; Brown, Alan


    A large number of patients with psychosocial or psychiatric disorders present to family physicians, and the family physician needs a model of psychotherapy with which to cope with their problems. A model of brief psychotherapy is presented which is time limited, goal directed and easy to learn. It consists of four facets drawn from established areas of psychotherapy: characteristics of the therapist; characteristics of the patient; Eriksonian developmental stages; and the process of therapy a...

  18. A brief history of videogames


    Simone Belli; Cristian López


    The following text contains a brief journey through a short and yet intense adventure, the history of videogames. Since its beginnings in the 1950's decade to the present time, videogames have progressively changed from a hobby for ingeneering studens to the most powerfull leisure industry. In order to gain a better understanding of this phenomenon it is necessary to look over the path of its transformation from a retrospecive point of view. Such a look has necessarily t...

  19. Geothermal reservoirs - A brief review


    Ganguly, Sayantan; Kumar, Mohan MS


    A brief discussion and review of the geothermal reservoir systems, geothermal energy and modeling and simulation of the geothermal reservoirs has been presented here. Different types of geothermal reservoirs and their governing equations have been discussed first. The conceptual and numerical modeling along with the representation of flow though fractured media, some issues related to non isothermal flow through fractured media, the efficiency of the geothermal reservoir, structure of the num...

  20. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department


    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  1. Pengaruh Penggunaan Limbah Serbuk Besi Terhadap Campuran Aspal Jenis AC-WC


    Pasaribu, Iffah Fathaniah


    Lapis Beton Aspal adalah lapisan penutup konstruksi perkerasan jalan yang mempunyai nilai struktural. Salah satu jenis lapis beton aspal tersebut adalah Asphalt Concrete – Wearing Course (AC-WC) sebagai lapisan yang paling atas dalam perkerasan lentur. Material utama penyusun adalah agregat dan aspal, termasuk jenis filler dalam penggunaannya. Penelitian ini mencoba menggunakan limbah serbuk besi dengan variasi kadar yang berbeda sebagai bahan campuran aspal panas jenis AC-WC yang diharapkan ...

  2. ac electroosmosis in rectangular microchannels. (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo


    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310


    Directory of Open Access Journals (Sweden)

    Alfredo Aguilar Valdés


    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  4. AcEST: BP920845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  5. AcEST: DK960083 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  6. AcEST: DK955376 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  7. AcEST: BP913416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  8. AcEST: DK947388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  9. AcEST: BP916217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  10. AcEST: DK953324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  11. AcEST: DK945049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  12. Briefs

    Institute of Scientific and Technical Information of China (English)


    Simpler forex rules According to the State Administration of Foreign Exchange,China began a trial program for simplifying the procedures for passing foreign currencies between banks and companies in the trading of goods.Effective from December 1,the new rules don’t require verification for information about prepayments for goods,payment cancellations or delays.

  13. Briefs

    Institute of Scientific and Technical Information of China (English)


    3 More competitive According to the Global Competitiveness Report 2011-12,China’s competitiveness ranking rose from 27th to 26th among 142 economies in the world this year, continuing to lead the way among large developing economies.The report said China is one of the world’s least indebted countries,boasts a savings rate of some 53 percent of GDP,and runs only moder ate budget deficits.However,China’s fairly poor results in the financial market development and technological readiness pillars pull down its overall competitiveness performance,said the report.

  14. Briefs

    Institute of Scientific and Technical Information of China (English)


    Benefits for Africa China’s investments in Africa have brought multiple benefits to the continent, providing better livelihood,more development opportunities and more choices for local people,said Liu Guijin, China’s special envoy on African affairs,at the end of the three-day World Economic Forum on Africa.He said China’s investments cater to Africa’s needs for a

  15. Briefs

    Institute of Scientific and Technical Information of China (English)


    RMB trade The Bank of China has opened trading in the yuan currency to U.S.customers. The bank’s New York Branch now lets companies and individuals buy and sell the yuan through accounts with its U.S. branches,although U.S.businesses and individuals can also trade the currency through Western banks.The bank said it offers yuan savings,demand deposit and time deposit accounts to business customers in New York and Los Angeles. A savings account requires a minimum balance of the equivalent of $5,000.

  16. Briefs

    Institute of Scientific and Technical Information of China (English)


    Pollution saver Pilot programs promoting the use of controlled-release fertilizer have been expanded to more than 20 provinces in China,compared with five in 2008,said the National Agro-Tech Extension and Service Center(NAESC),a department under the Ministry of Agriculture.The move is aimed at reducing pollution caused by the excessive use of fertilizer to protect the environment and save energy,the NAESC said.NAESC also predicted the use of controlled-release fertilizer could help increase agricultural production by 5 to 10 percent on average.

  17. Ac superconducting articles and a method for their manufacture

    International Nuclear Information System (INIS)

    A novel ac superconducting article is described comprising a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface. (auth)


    Institute of Scientific and Technical Information of China (English)

    汪艮忠; 周珉; 张鹏


    爆炸法销毁废旧爆炸物品是一项重要而又危险的工作,对销毁方案的设计和销毁地点的选择都要缜密、慎重,对于其中各个环节都需要精心布置和安排;否则,不但不能有效彻底地销毁爆炸物品,而且还有可能发生事故和产生次生灾害.通过实例对“销毁地点选择”这个重要环节进行了阐述和分析比较,为今后类似销毁工作提供参考.%It is dangerous but important to destroy waste explosive materials by explosion. So the design and the site for destruction must be decided with caution. Every step must be arranged carefully, or not only may waste materials be destroyed incompletely, but also it may cause an accident and induce secondary disaster. Different sites for destruction were elaborated and analyzed by engineering examples, which provide a reference for similar situations in future.

  19. Total loss of AC power analysis for EPR reactor

    Energy Technology Data Exchange (ETDEWEB)

    Darnowski, Piotr, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Skrzypek, Eleonora, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); National Centre for Nuclear Research (NCBJ), A. Sołtana 7, 05-400 Otwock-Świerk (Poland); Mazgaj, Piotr, E-mail: [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Świrski, Konrad [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Gandrille, Pascal [AREVA NP SAS, Tour AREVA, 1 place Jean Millier, 92084 Paris La Défense (France)


    Highlights: • Total loss of AC power (Station Blackout) was simulated for the EPR reactor model. • In-vessel phase of the accident is under consideration. • Comparison of MELCOR and MAAP results is presented. • MELCOR and MAAP results are comparable. - Abstract: In this paper the results of severe accident simulations for the EPR reactor in the case of loss of offsite power combined with total failure of all diesel generators (total loss of AC power) are presented. Calculations were performed with MELCOR 2.1 computer code for in-vessel phase of the accident. In this scenario, the unavailability of all offsite and onsite power sources and the lack of cooling leads directly to core degradation, material relocation to the lower plenum and rupture of the reactor pressure vessel. MELCOR results were compared qualitatively and quantitatively with MAAP4 code results and show a good agreement.

  20. Pengujian Kinerja Campuran (AC-WC) Subtitusi Buton Granular Aspal Sebagai Bahan Pengikat Dengan Metode Marshall


    Mantong, Mentari C.P.


    Along with improvement and development keeping of road infrastructure in Indonesia, it is important to be more far comprehends and does testing to exploiting of nature material. Development of the existing firm layer material technology is very fast, to create technological innovation motivated to efficient cost, optimize of material exploiting, expansion of natural material, and environmental friendliness like BGA (Buton Granular Asphalt) as a binder along with asphalt at mixture AC-WC. Expl...

  1. My brief history. 2. ed.

    International Nuclear Information System (INIS)

    For the first time, Stephen Hawking turns his gaze inward for a revealing look at his own life and intellectual evolution. My Brief History recounts Stephen Hawking's improbable journey, from his post-war London boyhood to his years of international acclaim and celebrity. Illustrated with rarely seen photographs, this concise, witty and candid account introduces readers to the inquisitive schoolboy whose classmates nicknamed him 'Einstein'; the jokester who once placed a bet with a colleague over the existence of a black hole; and the young husband and father striving to gain a foothold in the world of academia. Writing with humility and humour, Hawking opens up about the challenges that confronted him following his diagnosis of ALS aged twenty-one. Tracing his development as a thinker, he explains how the prospect of an early death urged him onward through numerous intellectual breakthroughs, and talks about the genesis of his masterpiece A Brief History of Time - one of the iconic books of the twentieth century.

  2. Sustainable Markets Investment Briefings: Investment Treaties

    Energy Technology Data Exchange (ETDEWEB)

    Cotula, Lorenzo


    This is the second of a series of briefings which discuss the sustainable development issues raised by legal arrangements for the protection of foreign investment. The briefings are based on legal research by IIED and its partners. The goal is to provide accessible but accurate information for human rights, development and environmental organisations working on issues raised by foreign investment in low- and middle-income countries. Briefing 2 explains how investment treaties between states work to protect and promote foreign investment.

  3. Market Brief : Turkey oil and gas pipelines

    International Nuclear Information System (INIS)

    This report presented some quick facts about oil and gas pipelines in Turkey and presented opportunities for trade. The key players and customers in the oil and gas sector were described along with an export check list. Turkey is looking into becoming an energy bridge between oil and gas producing countries in the Middle East, Central Asia and Europe. The oil and gas sectors are dominated by the Turkish Petroleum Corporation, a public enterprise dealing with exploration and production, and the State Pipeline Corporation which deals with energy transmission. They are also the key buyers of oil and gas equipment in Turkey. There are several pipelines connecting countries bordering the Caspian Sea. Opportunities exist in the areas of engineering consulting as well as contracting services for oil and gas pipeline transmission and distribution. Other opportunities lie in the area of pipeline construction, rehabilitation, materials, equipment, installation, and supervisory control and data acquisition (SCADA) systems. Currently, the major players are suppliers from Italy, Germany, France, United States and Japan. Turkey has no trade barriers and imported equipment and materials are not subjected to any restriction. The oil and gas market in Turkey expected in increase by an average annual growth rate of 15 per cent from 2001 to 2003. A brief description of pipeline projects in Turkey was presented in this report along with a list of key contacts and support services. 25 refs., 1 append



    M.A INAYATHULLAAH,; Dr. R. Anita


    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  5. Structural and AC loss study for pure and doped MgB{sub 2} superconductor

    Energy Technology Data Exchange (ETDEWEB)

    Hansdah, J. S.; Sarun, P. M., E-mail: [Functional Ceramics Lab, Department of Applied Physics, Indian School of Mines (ISM), Dhanbad – 826004 (India)


    Superconducting polycrystalline bulk MgB{sub 2} samples doped with n-C, n-Y{sub 2}O{sub 3} and n-Ho{sub 2}O{sub 3} were prepared by powder-in-sealed (PIST) method. XRD measurement shows the influence of dopants on phase and lattice parameters of samples. The ac susceptibility measurement reveals ac loss and activation energy of the samples. Nano-C doped sample shows less ac loss in all frequency (208 Hz – 999 Hz) among the doped samples; whereas n-Ho{sub 2}O{sub 3} doped sample shows highest ac loss. The activation energy is high for rare earth (n-Y{sub 2}O{sub 3} and n-Ho{sub 2}O{sub 3}) doped samples as compare to n-C doped samples which reveals the enhancement in flux-pinning properties of these materials.

  6. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN


    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  7. Continuous Briefing and User Participation in Building Projects


    Jensen, Per Anker


    Briefing is not just about specifying needs as requirements but also about evaluating how well design pro-posals fulfill the needs and aspirations. Furthermore, briefing is not only about building design. Briefing starts at the pre-project stage to create a basis for the project decision. It includes an initial strategic brief-ing to define the overall vision and objectives. Parallel to the design briefing it is necessary to carry out a briefing process related to interior design and building...

  8. Institutional Advancement Brief, Communicating NPS Value


    Haska, Christine


    Naval Postgraduate School Institutional Advancement Brief, Communicating NPS Value. NPS Board of Advisors, April 2012, Presented by Dr. Christine Haska, Vice President for Information Resources and CIO.

  9. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke


    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  10. Noise reduction in AC-coupled amplifiers


    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon


    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  11. Towards the European strategy for particle physics the Briefing Book

    CERN Document Server

    Åkesson, T; Allanach, Benjamin C; Bertolucci, S; Blondel, A; Butterworth, J; Cavalli-Sforza, M; Cervera-Villanueva, Anselmo; Davidson, S; De Naurois, Mathieu; Desch, K; Egede, U; Glover, N; Heuer, R D; Huber, P; Höcker, A; Jungmann, K; Landua, Rolf; Le Goff, J M; Linde, Frank L; Lombardi, A; Mangano, Michelangelo L; Mezzetto, M; Onderwater, G; Palanque-Delabrouille, Nathalie; Peach, Kenneth J; Polosa, A; Rondio, E; Webber, Bryan R; Weiglein, G; Womersley, J; Wurr, K


    This document was prepared as part of the briefing material for the Workshop of the CERN Council Strategy Group, held in DESY Zeuthen from 2nd to 6th May 2006. It gives an overview of the physics issues and of the technological challenges that will shape the future of the field, and incorporates material presented and discussed during the Symposium on the European Strategy for Particle Physics, held in Orsay from 30th January to 2nd February 2006, reflecting the various opinions of the European community as recorded in written submissions to the Strategy Group and in the discussions at the Symposium.

  12. AC electrokinetic manipulation of selenium nanoparticles for potential nanosensor applications

    International Nuclear Information System (INIS)

    Highlights: ► Se nanoparticles were synthesized using a reverse-microemulsion process. ► AC osmotic fluid flow repulses the particles from electrode edges. ► Dielectrophoretic force attracts the particles to electrode edges. ► Dielectrophoresis electrode showed non-ohmic behavior. ► The device can potentially be used as a nanosensor. - Abstract: We report the AC electrokinetic behavior of selenium (Se) nanoparticles for electrical characterization and possible application as micro/nano devices. selenium Se nanoparticles were successfully synthesized using a reverse-microemulsion process and investigated structurally using X-ray diffraction and transmission electron microscope. Interdigitated castellated ITO and non-castellated platinum electrodes were employed for manipulation of suspended materials in the fluid. Using ITO electrodes at low frequency limits resulted in deposition of Se particles on electrode surface. When Se particles exposed to platinum electrodes in the 10 Hz–1 kHz range and V p−p> 8, AC osmotic fluid flow repulses the particles from electrode edges. However, in 10 kHz–10 MHz range and V p−p> 5, dielectrophoretic force attracts the particles to electrode edges. As the Se particle concentration increased, the trapped Se particles were aligned along the electric field line and bridged the electrode gap. The device was characterized and can potentially be useful in making micro/nano electronic devices

  13. AC electrokinetic manipulation of selenium nanoparticles for potential nanosensor applications

    Energy Technology Data Exchange (ETDEWEB)

    Mahmoodi, Seyed Reza [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Bayati, Marzieh, E-mail: [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Hosseinirad, Somayeh [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Foroumadi, Alireza [Department of Medicinal Chemistry, Faculty of Pharmacy and Pharmaceutical Sciences Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Gilani, Kambiz [Department of Pharmaceutics, School of Pharmacy, Tehran University of Medical Science, Tehran (Iran, Islamic Republic of); Rezayat, Seyed Mahdi [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of)


    Highlights: ► Se nanoparticles were synthesized using a reverse-microemulsion process. ► AC osmotic fluid flow repulses the particles from electrode edges. ► Dielectrophoretic force attracts the particles to electrode edges. ► Dielectrophoresis electrode showed non-ohmic behavior. ► The device can potentially be used as a nanosensor. - Abstract: We report the AC electrokinetic behavior of selenium (Se) nanoparticles for electrical characterization and possible application as micro/nano devices. selenium Se nanoparticles were successfully synthesized using a reverse-microemulsion process and investigated structurally using X-ray diffraction and transmission electron microscope. Interdigitated castellated ITO and non-castellated platinum electrodes were employed for manipulation of suspended materials in the fluid. Using ITO electrodes at low frequency limits resulted in deposition of Se particles on electrode surface. When Se particles exposed to platinum electrodes in the 10 Hz–1 kHz range and V {sub p−p}> 8, AC osmotic fluid flow repulses the particles from electrode edges. However, in 10 kHz–10 MHz range and V {sub p−p}> 5, dielectrophoretic force attracts the particles to electrode edges. As the Se particle concentration increased, the trapped Se particles were aligned along the electric field line and bridged the electrode gap. The device was characterized and can potentially be useful in making micro/nano electronic devices.

  14. A brief history of videogames

    Directory of Open Access Journals (Sweden)

    Simone Belli


    Full Text Available The following text contains a brief journey through a short and yet intense adventure, the history of videogames. Since its beginnings in the 1950's decade to the present time, videogames have progressively changed from a hobby for ingeneering studens to the most powerfull leisure industry. In order to gain a better understanding of this phenomenon it is necessary to look over the path of its transformation from a retrospecive point of view. Such a look has necessarily to focus on those devices and games that had made a landmark in the history of videogames, taking them to their current position. Besides, it is crucial to address their implications in contemporary visual culture, along with current prejudices against them. This is a short account about a great history.

  15. A brief examination of optical tagging technologies.

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, Mark R.; Cahill, Paul A. (Aspecular Optics, Dayton, OH); Drummond, Timothy J.; Wilcoxon, Jess Patrick


    Presented within this report are the results of a brief examination of optical tagging technologies funded by the Laboratory Directed Research and Development (LDRD) program at Sandia National Laboratories. The work was performed during the summer months of 2002 with total funding of $65k. The intent of the project was to briefly examine a broad range of approaches to optical tagging concentrating on the wavelength range between ultraviolet (UV) and the short wavelength infrared (SWIR, {lambda} < 2{micro}m). Tagging approaches considered include such things as simple combinations of reflective and absorptive materials closely spaced in wavelength to give a high contrast over a short range of wavelengths, rare-earth oxides in transparent binders to produce a narrow absorption line hyperspectral tag, and fluorescing materials such as phosphors, dies and chemically precipitated particles. One technical approach examined in slightly greater detail was the use of fluorescing nano particles of metals and semiconductor materials. The idea was to embed such nano particles in an oily film or transparent paint binder. When pumped with a SWIR laser such as that produced by laser diodes at {lambda}=1.54{micro}m, the particles would fluoresce at slightly longer wavelengths, thereby giving a unique signal. While it is believed that optical tags are important for military, intelligence and even law enforcement applications, as a business area, tags do not appear to represent a high on return investment. Other government agencies frequently shop for existing or mature tag technologies but rarely are interested enough to pay for development of an untried technical approach. It was hoped that through a relatively small investment of laboratory R&D funds, enough technologies could be identified that a potential customers requirements could be met with a minimum of additional development work. Only time will tell if this proves to be correct.

  16. UNESCO Policy Briefs on Early Childhood, 2002. (United States)

    United Nations Educational, Scientific, and Cultural Organization, Paris (France). Early Childhood and Family Education Unit.

    This document consists of eight double-sided briefs addressing aspects of the field of early childhood education. Titles of the briefs are as follows: (1) "Early Childhood Care? Development? Education?," outlining the distinctions between these terms; (2) "Planning for Access: Develop a Data System First," highlighting Brazil's census to collect…

  17. Negotiating Visualities in Briefing and Design

    DEFF Research Database (Denmark)

    Koch, Christian; Bendixen, Mads


    Building on an in-depth ethnographic study and the approaches of ‘practice-based studies’ and ‘science and technology studies’, the role of visual representations is explored in briefing and design processes. Three characteristic ways in which drawings contribute to ongoing negotiations are...... approaches should be chosen to promote innovative briefing and design....

  18. Brief Psychotherapy Methods in Clinical Research. (United States)

    Koss, Mary P.; And Others


    After a concise overview of the technical characteristics that define brief psychotherapy, the current use and misuse of these methods in clinical research on the outcome and process of treatment is examined. Suggests that brief psychotherapy methods possess unique technical advantages to the researcher. (Author/BL)

  19. Internship or Indenture? Research Brief. Edition 2 (United States)

    Sutton Trust, 2014


    This brief analyzes the latest higher education data and government wage statistics to examine the number of unpaid graduate interns in the United Kingdom and the cost to an individual of doing an unpaid internship. It also includes newly published Ipsos Mori polling on attitudes to unpaid internships. Key findings in this brief include: (1) 31%…

  20. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  1. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E


    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  2. Microwave-induced crystallization of AC/TiO{sub 2} for improving the performance of rhodamine B dye degradation

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Fei [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Wu, Zhansheng, E-mail: [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Chen, Qiuyu; Yan, Yujun [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Cravotto, Giancarlo; Wu, Zhilin [Dipartimento di Scienza e Tecnologia del Farmaco, University of Turin, Torino 10125 (Italy)


    Graphical abstract: - Highlights: • Mixed phase titania coated with AC was obtained by microwave irradiation method. • The TiO{sub 2} nanoparticles were spherical and well distributed on the surface of AC. • The light absorption edges of AC/TiO{sub 2} showed red-shift compared to the pure TiO{sub 2}. • Higher surface and TiO{sub 2} content of AC/TiO{sub 2} could improve photocatalytic efficiency. - Abstract: Titanium dioxide (TiO{sub 2}) deposition on activated carbon (AC) is widely used for pollutant photodegradation. In this study, a simple and efficient method for preparing AC/TiO{sub 2} composites under microwave irradiation was developed for photocatalytic degradation of rhodamine B (RhB) under UV light. Results of X-ray diffraction, scanning electron microscopy, and transmission electron microscopy revealed that TiO{sub 2} nanoparticles are anatase and rutile, with a spherical shape and a particle size of 20–50 nm and are well distributed on the AC surface. The UV–vis spectrum of TiO{sub 2} coated on AC showed an evident red-shift and exhibited stronger optical absorption capacity than pure TiO{sub 2}. The AC/TiO{sub 2} nanoparticles prepared at a microwave power of 700 W for 15 min exhibited 98% efficiency in removing RhB dye under UV irradiation for 30 min. The high photocatalytic activity of AC/TiO{sub 2}-700 W could be mainly attributed to the high sorption capacity of the mesoporous carbon material and high TiO{sub 2} content, which could produce higher quantity of ·OH. This study provides a rapid synthesis technique to prepare AC/TiO{sub 2} and a novel method to improve photocatalytic efficiency via synergistic effect for other catalytic systems.

  3. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System


    Marian GAICEANU; Emil ROSU


    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  4. Total synthesis and allelopathic activity of cytosporones A-C

    Energy Technology Data Exchange (ETDEWEB)

    Zamberlam, Charles E.M.; Meza, Alisson; Lima, Denis P. de; Beatriz, Adilson [Centro de Ciencias Exatas e Tecnologia, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil); Leite, Carla Braga; Marques, Maria Rita [Centro de Ciencias Biologicas e da Saude, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil)


    The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)

  5. Total synthesis and allelopathic activity of cytosporones A-C

    International Nuclear Information System (INIS)

    The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)

  6. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)


    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  7. Calorimetric method of ac loss measurement in a rotating magnetic field

    International Nuclear Information System (INIS)

    A method is described for calorimetric ac-loss measurements of high-Tc superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  8. Calorimetric method of ac loss measurement in a rotating magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)


    A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  9. Calorimetric method of ac loss measurement in a rotating magnetic field (United States)

    Ghoshal, P. K.; Coombs, T. A.; Campbell, A. M.


    A method is described for calorimetric ac-loss measurements of high-Tc superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  10. 223Ra for endoradiotherapeutic applications prepared from an immobilized 227Ac/227Th source

    International Nuclear Information System (INIS)

    A method is described for the production of 223Ra (t1/2 = 11.4 d) in a quality useful for endoradiotherapeutic applications. The method is based on a long term operating generator with a source of 227Ac (t1/2 = 21.7 years), from which 223Ra is eluted. The 227Ac was isolated from a 231Pa source using the f-element selective extraction chromatographic material TRU-resin. The purified 227Ac/227Th source was subsequently applied to another extraction chromatographic resin, containing the extractant P,P'-di(2-ethylhexyl)methanediphosphonic acid on silica (Dipex-2) and used as a generator for 223Ra. From the generator column, the yield of 223Ra was about 60 kBq per 100 kBq of 227Ac with a highly effective separation of 223Ra from the precursors. In production runs, the activity of 227Ac was found to be 6 x 10-6 relative to the eluted activity of 223Ra. By using a second column of Dipex-2 for additional purification, the activity of Ac was reduced to below 7 x 10-8 relative to 223Ra with nearly quantitative recovery of 223Ra. The described procedure resulted in a high purity 223Ra preparation, potentially useful in, e.g., targeted radiotherapy of tumors. (orig.)

  11. NASA Tech Briefs, August 2010 (United States)


    Topics covered include: Technology Focus: Mechanical Components; Electronics/Computers; Software; Materials; Mechanics/Machinery; Manufacturing; Bio-Medical; Physical Sciences; Information Sciences; and Books and Reports.

  12. 76 FR 50715 - Briefing on Partner Vetting System Pilot Program (United States)


    ...; ] DEPARTMENT OF STATE Agency for International Development Briefing on Partner Vetting System Pilot Program... briefing. SUMMARY: Notice is hereby given of a briefing on the Partner Vetting System (PVS) pilot...

  13. Maine State Briefing Book on low-level radioactive waste management

    Energy Technology Data Exchange (ETDEWEB)


    The Maine State Briefing Book is one of a series of state briefing books on low-level radioactive waste management practices. It has been prepared to assist state and Federal agency officials in planning for safe low-level radioactive waste disposal. The report contains a profile of low-level radioactive waste generators in Maine. The profile is the result of a survey of radioactive material licensees in Maine. The briefing book also contains a comprehensive assessment of low-level radioactive waste management issues and concerns as defined by all major interested partices including industry, government, the media, and interest groups. The assessment was developed through personal communications with representatives of interested parties, and through a review of media sources. Lastly, the briefing book provides demographic and socioeconomic data and a discussion of relevant goverment agencies and activities, all of which may impact management practices in Maine.

  14. Kansas State Briefing Book on low-level radioactive waste management

    International Nuclear Information System (INIS)

    The Kansas State Briefing Book is one of a series of state briefing books on low-level radioactive waste management practices. It has been prepared to assist state and federal agency officials in planning for safe low-level radioactive waste disposal. The report contains a profile of low-level radioactive waste generators in Kansas. The profile is the result of a survey of radioactive material licensees in Kansas. The briefing book also contains a comprehensive assessment of low-level radioactive waste management issues and concerns as defined by all major interested parties including industry, government, the media, and interest groups. The assessment was developed through personal communications with representatives of interested parties, and through a review of media sources. Lastly, the briefing book provides demographic and socioeconomic data and a discussion of relevant government agencies and activities, all of which may affect waste management practices in Kansas

  15. Rhode Island State Briefing Book on low-level radioactive-waste management

    International Nuclear Information System (INIS)

    The Rhode Island State Briefing Book is one of a series of state briefing books on low-level radioactive waste management practices. It has been prepared to assist state and federal agency officials in planning for safe low-level radioactive waste disposal. The report contains a profile of low-level radioactive waste generators in Rhode Island. The profile is the result of a survey of radioactive material licensees in Rhode Island. The briefing book also contains a comprehensive assessment of low-level radioactive waste management issues and concerns as defined by all major interested parties including industry, government, the media, and interest groups. The assessment was developed through personal communications with representatives of interested parties, and through a review of media sources. Lastly, the briefing book provides demographic and socioeconomic data and a discussion of relevant government agencies and activities, all of which may affect waste management practices in Rhode Island

  16. Rhode Island State Briefing Book on low-level radioactive-waste management

    Energy Technology Data Exchange (ETDEWEB)


    The Rhode Island State Briefing Book is one of a series of state briefing books on low-level radioactive waste management practices. It has been prepared to assist state and federal agency officials in planning for safe low-level radioactive waste disposal. The report contains a profile of low-level radioactive waste generators in Rhode Island. The profile is the result of a survey of radioactive material licensees in Rhode Island. The briefing book also contains a comprehensive assessment of low-level radioactive waste management issues and concerns as defined by all major interested parties including industry, government, the media, and interest groups. The assessment was developed through personal communications with representatives of interested parties, and through a review of media sources. Lastly, the briefing book provides demographic and socioeconomic data and a discussion of relevant government agencies and activities, all of which may affect waste management practices in Rhode Island.

  17. Engineering Technical Review Planning Briefing (United States)

    Gardner, Terrie


    The general topics covered in the engineering technical planning briefing are 1) overviews of NASA, Marshall Space Flight Center (MSFC), and Engineering, 2) the NASA Systems Engineering(SE) Engine and its implementation , 3) the NASA Project Life Cycle, 4) MSFC Technical Management Branch Services in relation to the SE Engine and the Project Life Cycle , 5) Technical Reviews, 6) NASA Human Factor Design Guidance , and 7) the MSFC Human Factors Team. The engineering technical review portion of the presentation is the primary focus of the overall presentation and will address the definition of a design review, execution guidance, the essential stages of a technical review, and the overall review planning life cycle. Examples of a technical review plan content, review approaches, review schedules, and the review process will be provided and discussed. The human factors portion of the presentation will focus on the NASA guidance for human factors. Human factors definition, categories, design guidance, and human factor specialist roles will be addressed. In addition, the NASA Systems Engineering Engine description, definition, and application will be reviewed as background leading into the NASA Project Life Cycle Overview and technical review planning discussion.

  18. Elliptic flow: a brief review (United States)

    Snellings, Raimond


    One of the fundamental questions in the field of subatomic physics is the question of what happens to matter at extreme densities and temperatures as may have existed in the first microseconds after the Big Bang and exists, perhaps, in the core of dense neutron stars. The aim of heavy-ion physics is to collide nuclei at very high energies and thereby create such a state of matter in the laboratory. The experimental program began in the 1990s with collisions made available at the Brookhaven Alternating Gradient Synchrotron (AGS) and the CERN Super Proton Synchrotron (SPS), and continued at the Brookhaven Relativistic Heavy-Ion Collider (RHIC) with the maximum center-of-mass energies of \\sqrt{s_{NN}} = 4.75 , 17.2 and 200 GeV, respectively. Collisions of heavy ions at the unprecedented energy of 2.76 TeV recently became available at the LHC collider at CERN. In this review, I give a brief introduction to the physics of ultrarelativistic heavy-ion collisions and discuss the current status of elliptic flow measurements.

  19. Dissipation and AC loss in high Tc superconductors destined for power applications

    International Nuclear Information System (INIS)

    Full text: Superconductivity, which was discovered at the beginning of this century, has long been promoted as a solution to many power engineering problems. This was because a superconductor exhibits zero resistance to DC currents and a very low resistance to AC currents. Historically however, power utility applications, whilst technically feasible, were not economically viable. With the discovery of high temperature superconductors in the late 80's there has been a resurgence of interest in the use of superconductivity for power applications: cables, motors, generators, transformers, fault current limiters. In order for power applications of superconductors to be realized, in addition to a high current density, low AC losses and transient stability are also necessary. Whilst much work worldwide has been devoted to increasing critical current densities of high Tc materials, reliable AC loss characterisation of power applications and low loss conductor designs optimized for each application still remain to be developed. Here, calorimetric methods for the measurement of AC losses for high Tc wires will be compared to electric and magnetization methods. The relative merits of each method will be discussed. One of the key differences between high and low Tc superconductors is in the nature of E-J curves. In high Tc materials these curves are extended, i.e. E increases gradually with J. This has consequences for both AC losses and stability. In this article the nature of AC losses and stability in high temperature superconducting wires will be discussed: hysteretic losses, eddy current losses, role of flux creep, anisotropy, dimensional effects ..., and compared to those for low temperature wires such as multifilamentary NbTi and NbSn. In conclusion, the key requirements will be discussed that must be achieved in order that superconducting technologies gain acceptance in power engineering applications: current density, AC losses, transient response, mechanical

  20. Sustainable Markets Investment Briefings: Foreign investment contracts

    Energy Technology Data Exchange (ETDEWEB)

    Cotula, Lorenzo


    This is the fourth of a series of briefings which discuss the sustainable development issues raised by legal arrangements for the protection of foreign investment. The briefings are based on legal research by IIED and its partners. The goal is to provide accessible but accurate information for human rights, development and environmental organisations working on issues raised by foreign investment in low- and middle-income countries. Briefing 4 sets out some of the ways in which foreign investment contracts can impact on sustainable development.

  1. Sustainable Markets Investment Briefings: International arbitration

    Energy Technology Data Exchange (ETDEWEB)

    Cotula, Lorenzo


    This is the fifth of a series of briefings which discuss the sustainable development issues raised by legal arrangements for the protection of foreign investment. The briefings are based on legal research by IIED and its partners. The goal is to provide accessible but accurate information for human rights, development and environmental organisations working on issues raised by foreign investment in low- and middle-income countries. Briefing 5 explains how international arbitration works to resolve disputes between foreign investors and host states, and outlines some of the problems associated with its use, from a sustainable development perspective.

  2. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.


    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  3. AC barrier pin-plane corona: similarities and distinctions to DC positive and negative coronas and dielectric barrier discharge

    International Nuclear Information System (INIS)

    Alternative current (AC) atmospheric pressure corona between the sharpened pin and metallic plane covered with a thin dielectric material is widely used in applications. This kind of discharge can be classified the AC barrier corona (ACBC), because one would expect that ACBC exhibits the properties, which are close to those of both AC dielectric barrier discharge (DBD) and DC (direct current) positive and negative pin-plane coronas. Experimental and numerical study on properties of ACBC in air, nitrogen, Ar, He at atmospheric pressure was carried out. A detailed comparison between ACBC and DC positive and negative pin-plane coronas was made. (author)

  4. Hemicellulose as barrier material


    Jonas, Hartman


    Polysaccharides constitute an important source of raw materials for the packaging industry today. Polysaccharides have good natural barrier properties which are necessary for packaging films. Cellulose is the forerunner among renewable polymers for such applications. Hemicelluloses represent a new interesting breed of barrier materials. We have chosen to work with the hemicellulose O-acetyl-galactoglucomannan (AcGGM). The high water solubility of this particular hemicellulose extracted from p...

  5. The application of prepared porous carbon materials: Effect of different components on the heavy metal adsorption. (United States)

    Song, Min; Wei, Yuexing; Yu, Lei; Tang, Xinhong


    In this study, five typical municipal solid waste (MSW) components (tyres, cardboard, polyvinyl chloride (PVC), acrylic textile, toilet paper) were used as raw materials to prepare four kinds of MSW-based carbon materials (paperboard-based carbon materials (AC1); the tyres and paperboard-based carbon materials (AC2); the tyres, paperboard and PVC-based carbon materials (AC3); the tyres, paperboard, toilet paper, PVC and acrylic textile-based carbon materials (AC4)) by the KOH activation method. The characteristic results illustrate that the prepared carbon adsorbents exhibited a large pore volume, high surface area and sufficient oxygen functional groups. Furthermore, the application of AC1, AC2, AC3, AC4 on different heavy metal (Cu(2+), Zn(2+), Pb(2+), Cr(3+)) removals was explored to investigate their adsorption properties. The effects of reaction time, pH, temperature and adsorbent dosage on the adsorption capability of heavy metals were investigated. Comparisons of heavy metal adsorption on carbon of different components were carried out. Among the four samples, AC1 exhibits the highest adsorption capacity for Cu(2+); the highest adsorption capacities of Pb(2+) and Zn(2+) are obtained for AC2; that of Cr(3+) are obtained for AC4. In addition, the carbon materials exhibit better adsorption capability of Cu(2+) and Pb(2+) than the other two kind of metal ions (Zn(2+) and Cr(3+)). PMID:26951338

  6. AC losses in filamentary YBCO/hastelloy

    International Nuclear Information System (INIS)

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  7. Magnetization loop modelling for superconducting/ferromagnetic tube of an ac magnetic cloak

    International Nuclear Information System (INIS)

    From the combination of superconducting (SC) and ferromagnetic (FM) materials, one can prepare composites with unusual magnetic properties, e.g. for the cloaking of a dc or low-frequency ac magnetic field by a shell from a SC/FM composite. In the design and optimisation of such SC/FM structures, numerical modelling is essential. Non-linear magnetic permeability, as well as the hysteresis of both kinds of materials, are to be incorporated in the calculations aimed at achieving reliable estimates. We present a technique that allows the prediction of the ac magnetization loops of SC/FM composites. The critical state model-based approach is used to describe the properties of the superconducting material. The ferromagnetic part is characterized by its (non-hysteretic) nonlinear permeability. With these ingredients, the distributions of the magnetic field are calculated in subsequent instants of the ac cycle and are used to evaluate the preliminary data for the magnetization loop, which is still missing the hysteresis of the FM part. Afterward, the latter component is added to the magnetization loop by an approximation deduced from the known dependence of the hysteresis loss in the FM material on the ac magnetic field. In spite of its approximate nature, this approach demonstrated very good predictability in experimental tests. (paper)

  8. The correlation between superparamagnetic blocking temperatures and peak temperatures obtained from ac magnetization measurements

    DEFF Research Database (Denmark)

    Madsen, Daniel Esmarch; Hansen, Mikkel Fougt; Mørup, Steen


    We study the correlation between the superparamagnetic blocking temperature TB and the peak positions Tp observed in ac magnetization measurements for nanoparticles of different classes of magnetic materials. In general, Tp=α+βTB . The parameters α and β are different for the in-phase (χ') and out...

  9. Critical conducting networks in disordered solids: ac universality from topological arguments

    DEFF Research Database (Denmark)

    Milovanov, A.V.; Juul Rasmussen, Jens


    This paper advocates an unconventional description of charge transport processes in disordered solids, which brings together the ideas of fractal geometry, percolation theory, and topology of manifolds. We demonstrate that the basic features of ac conductivity in disordered materials as seen in...

  10. An Automated Ac Susceptibility Set up Fabricated Using a Closed-Cycle Helium Refrigerator

    CERN Document Server

    Kundu, S


    We have described here the design and operation of an automated ac susceptibility set up using a closed cycle helium refrigerator. This set up is useful for measuring linear and nonlinear magnetic susceptibilities of various magnetic materials. The working temperature range is 2 K to 300 K. The overall sensitivity of the set up is found to be 10-3 emu.

  11. Kurdish. Materials Status Report. (United States)

    Center for Applied Linguistics, Washington, DC. Language/Area Reference Center.

    The materials status report for Kurdish is one of a series intended to provide the nonspecialist with a picture of the availability and quality of texts for teaching a given language to English speakers. Each report consists of: (1) a brief narrative description of the language, the areas where it is spoken, its major dialects, its writing system,…

  12. Investigations of surface characterization of silicone rubber due to tracking phenomena under a.c. and d.c. voltages

    Indian Academy of Sciences (India)

    Uma Maheswar Rao; S S M S Abdul Majeed; C Venkataseshaiah; R Sarathi


    In the present work, tracking phenomena has been studied with silicone rubber material under the a.c. and d.c. voltages following IEC-587 standards. The surface condition of the tracked zone was analysed using wide angle X-ray diffraction (WAXD) and thermogravimetric differential thermal analysis (TG–DTA) studies. The tracking time was different for a.c. and d.c. voltages.

  13. Membrane processes for removal of pharmaceutically active compounds (PhACs) from water and wastewaters. (United States)

    Taheran, Mehrdad; Brar, Satinder K; Verma, M; Surampalli, R Y; Zhang, T C; Valero, J R


    Pharmaceutically active compounds (PhACs), which find their way easily into the water sources, are emerging as a major concern for drinking water quality and aquatic species. Therefore, their removal from water sources is a priority from environmental point of view. During the past decade, different methods including membrane separation, adsorption systems and chemical transformation have been evaluated for removal of these compounds. This paper reviews different aspects of PhAC removal by using membrane separation processes, as they have been conventionally known to show high potential in the production of superior quality drinking and industrial water. In brief, osmosis membranes can efficiently remove almost all PhACs though its operational cost is relatively high and nanofiltration (NF) membranes are highly influenced by electrostatic and hydrophobic interaction. Moreover, the efficiency of membrane bioreactors (MBRs) is difficult to predict due to the complex interaction of compounds with microorganisms. To improve the performance and robustness of membrane technology, it is suggested to combine membranes with other systems, such as activated carbon and enzymatic degradation. PMID:26789358

  14. Brief Review on the Relevance Theory

    Institute of Scientific and Technical Information of China (English)

    龚腾龙; 阿勒腾


    Relevance theory has had an impact on the study in various disciplines including linguistics,literature and so on. This paper gives a brief review of the relevance theory and two principles of relevance.

  15. Briefing statement : Waubay Wetland Management District (United States)

    US Fish and Wildlife Service, Department of the Interior — This briefing statement details the Waubay National Wildlife Refuge, staff, funding, history, refuges facts and maps, general management, public use and depredation...


    The brochure gives an executive briefing of EPA's Conventional Combustion Environmental Assessment (CCEA) Program. The CCEA Program was established recently to coordinate and integrate EPA's research and development efforts for assessing the environmental effects of pollutants fr...

  17. Advances in electronic materials

    CERN Document Server

    Kasper, Erich; Grimmeiss, Hermann G


    This special-topic volume, Advances in Electronic Materials, covers various fields of materials research such as silicon, silicon-germanium hetero-structures, high-k materials, III-V semiconductor alloys and organic materials, as well as nano-structures for spintronics and photovoltaics. It begins with a brief summary of the formative years of microelectronics; now the keystone of information technology. The latter remains one of the most important global technologies, and is an extremely complex subject-area. Although electronic materials are primarily associated with computers, the internet

  18. Environmental actual situation in Guatemala. Executive brief

    International Nuclear Information System (INIS)

    In this brief prepared by the Consejo Permanente de Cambio y Variabilidad Climatica the climate in Guatemala is described including the current situation on variation of rainy season, air humidity, influence of the Nino current. This brief was prepared in order to plan a strategy to be adopted by all the institutions that are involved in environmental issues and in this way to deal with the climate change and the impact of the different energy sources in the environment

  19. Urban Teacher Retention Policy: A Research Brief


    Quartz, Karen Hunter; Kimberly Barraza Lyons; Katherine Masyn; Brad Olsen; Lauren Anderson; Andrew Thomas; Joanna Goode; Eileen Lai Horng


    This research brief summarizes interim results from a longitudinal study designed to inform policies aimed at curbing the high rate of attrition from hard-to-staff urban schools. These policies range from ensuring specialized teacher preservice education that willthat will prepare teachers for the challenges ahead to ongoing support for professional development and advancement. As an initial step in assessing the impact of specialized urban teacher preparation on retention, the research brief...

  20. Brief to the Cluff Lake Board of Inquiry

    International Nuclear Information System (INIS)

    The purpose of this brief is to describe the structure and operations of the Atomic Energy Control Board, and to indicate how these relate to current activities and to possible future developments with respect to the nuclear fuel cycle. The problem areas from the regulatory viewpoint may be identified as follows: protection of the health of workers and the public; protection of the environment; the safe use of nuclear materials, equipment and technology for peaceful and lawful purposes. The attention of regulatory authorities has been focused on all these areas, perhaps without much public awareness, but today the increasing public concern necessitates a parallel increase in public information and participation

  1. AC loss performance of CS insert coil

    International Nuclear Information System (INIS)

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  2. ac propulsion system for an electric vehicle (United States)

    Geppert, S.


    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  3. Propiedades acústicas de los paneles de carrizo

    Directory of Open Access Journals (Sweden)

    Díaz, César


    Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems. This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.

    El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos. En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.

  4. AC loss in superconducting tapes and cables (United States)

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  5. ACS air bearing test-bed design


    Glitt, Sascha


    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  6. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing


    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  7. Spin backflow and ac voltage generation by spin pumping and the inverse spin Hall effect. (United States)

    Jiao, HuJun; Bauer, Gerrit E W


    The spin current pumped by a precessing ferromagnet into an adjacent normal metal has a constant polarization component parallel to the precession axis and a rotating one normal to the magnetization. The former is now routinely detected as a dc voltage induced by the inverse spin Hall effect (ISHE). Here we compute ac ISHE voltages much larger than the dc signals for various material combinations and discuss optimal conditions to observe the effect. The backflow of spin is shown to be essential to distill parameters from measured ISHE voltages for both dc and ac configurations. PMID:23745937

  8. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S


    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)


    Directory of Open Access Journals (Sweden)



    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  10. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769. (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming


    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  11. Non-Federal participation in AC Intertie: Final environmental impact statement

    International Nuclear Information System (INIS)

    This document contains the appendices for the Non-Federal Participation in AC Intertie Final Environmental Impact Statement. It contains all the supporting materials, documents and data for the EIS in nine appendices: A. Life-of-facilities capacity ownership proposal; B. Long-term Intertie access policy; C. Glossary; D. Biological assessment and supporting materials; E. Environmental impacts of generic resource types; F. Technical information on analysis methods and results; G. Affected environment supporting documentation; H. Public involvement activities; and I. Bibliography

  12. ac driving amplitude dependent systematic error in scanning Kelvin probe microscope measurements: Detection and correction

    International Nuclear Information System (INIS)

    The dependence of the contact potential difference (CPD) reading on the ac driving amplitude in scanning Kelvin probe microscope (SKPM) hinders researchers from quantifying true material properties. We show theoretically and demonstrate experimentally that an ac driving amplitude dependence in the SKPM measurement can come from a systematic error, and it is common for all tip sample systems as long as there is a nonzero tracking error in the feedback control loop of the instrument. We further propose a methodology to detect and to correct the ac driving amplitude dependent systematic error in SKPM measurements. The true contact potential difference can be found by applying a linear regression to the measured CPD versus one over ac driving amplitude data. Two scenarios are studied: (a) when the surface being scanned by SKPM is not semiconducting and there is an ac driving amplitude dependent systematic error; (b) when a semiconductor surface is probed and asymmetric band bending occurs when the systematic error is present. Experiments are conducted using a commercial SKPM and CPD measurement results of two systems: platinum-iridium/gap/gold and platinum-iridium/gap/thermal oxide/silicon are discussed

  13. Modelling and measurement of ac loss in BSCCO/Ag-tape windings

    International Nuclear Information System (INIS)

    High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications

  14. Modelling and measurement of ac loss in BSCCO/Ag-tape windings (United States)

    Oomen, M. P.; Nanke, R.; Leghissa, M.


    High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications.

  15. AC power generation from microbial fuel cells (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason


    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  16. Performance of Halbach magnetized brushless AC motors


    Zhu, Z.Q.; Xia, Z.P.; Shi, Y.F.; Howe, D.; Pride, A.; X. J. Chen


    The steady-state performance of Halbach magnetized brushless ac machines when operated in constant torque and flux-weakening modes is investigated both theoretically and experimentally, with particular emphasis on the influence of cross-coupling magnetic saturation on the torque capability.

  17. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  18. DCC Briefing Paper: Genre classification


    Abbott, Daisy; Kim, Yunhyong


    Genre classification is the process of grouping objects together based on defined similarities such as subject, format, style, or purpose. Genre classification as a means of managing information is already established in music (e.g. folk, blues, jazz) and text and is used, alongside topic classification, to organise materials in the commercial sector (the children's section of a bookshop) and intellectually (for example, in the Usenet newsgroup directory hierarchy). However, in the case o...

  19. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)


    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  20. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak


    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  1. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte (United States)

    Abbas, Qamar; Béguin, François


    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  2. Rapid cycling synchrotron magnet with separate ac and dc circuit

    International Nuclear Information System (INIS)

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  3. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique


    Sagar.S.Pawar; Prakash.T.Patil


    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  4. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar


    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  5. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters


    Pawel Szczesniak


    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  6. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.


    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  7. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter


    S. Arumugam S. Ramareddy M. Sridhar


    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  8. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters


    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara


    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  9. Robust control of synchronous motors through AC/DC/AC converters


    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara


    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  10. A new class of hybrid AC/AC direct power converters


    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick


    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  11. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.


    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  12. Brief Cognitive-Behavioral Therapy for Anxious Youth: Feasibility and Initial Outcomes (United States)

    Crawley, Sarah A.; Kendall, Philip C.; Benjamin, Courtney L.; Brodman, Douglas M.; Wei, Chiaying; Beidas, Rinad S.; Podell, Jennifer L.; Mauro, Christian


    We developed and evaluated a brief (8-session) version of cognitive-behavioral therapy (BCBT) for anxiety disorders in youth ages 6 to 13. This report describes the design and development of the BCBT program and intervention materials (therapist treatment manual and child treatment workbook) and an initial evaluation of child treatment outcomes.…

  13. Preserving Knowledge: The Case for Alkaline Paper. ARL Briefing Package Number 3. (United States)

    Association of Research Libraries, Washington, DC.

    This briefing package consists of a compilation of over 15 papers, fact sheets, and other materials focusing on the use of acid-free papers in books and other publications. The document contains the following: Executive Summary and List of Contents; Some Frequently Asked Questions; "Paper Preservation in Library Collections: Basic Information.…

  14. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  15. 21 CFR 880.5500 - AC-powered patient lift. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  16. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊


    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  17. NASA Tech Briefs, July 2005 (United States)


    Thin-Film Resistance Heat-Flux Sensors Circuit Indicates that Voice-Recording Disks are Nearly Full Optical Sensing of Combustion Instabilities in Gas Turbines Topics include: Crane-Load Contact Sensor; Hexagonal and Pentagonal Fractal Multiband Antennas; Multifunctional Logic Gate Controlled by Temperature; Multifunctional Logic Gate Controlled by Supply Voltage; Power Divider for Waveforms Rich in Harmonics; SCB Quantum Computers Using iSWAP and 1-Qubit Rotations; CSAM Metrology Software Tool; Update on Rover Sequencing and Visualization Program; Selecting Data from a Star Catalog; Rotating Desk for Collaboration by Two Computer Programmers; Variable-Pressure Washer; Magnetically Attached Multifunction Maintenance Rover; Improvements in Fabrication of Sand/Binder Cores for Casting; Solid Freeform Fabrication of Composite-Material Objects; Efficient Computational Model of Hysteresis; Gauges for Highly Precise Metrology of a Compound Mirror; Improved Electrolytic Hydrogen Peroxide Generator; High-Power Fiber Lasers Using Photonic Band Gap Materials; Ontology-Driven Information Integration; Quantifying Traversability of Terrain for a Mobile Robot; More About Arc-Welding Process for Making Carbon Nanotubes; Controlling Laser Spot Size in Outer Space; or Software-Reconfigurable Processors for Spacecraft.

  18. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  19. The AC multi-harmonic magnetic susceptibility measurement setup at the LNF-INFN

    CERN Document Server

    Wang, Shenghao; Di Gioacchino, Daniele; Wu, Ziyu


    The AC magnetic susceptibility is a fundamental method in materials science, which allows to probe the dynamic magnetic response of magnetic materials and superconductors. The LAMPS laboratory at the Laboratori Nazionali di Frascati of the INFN hosts an AC multi-harmonic magnetometer that allows performing experiments with an AC magnetic field ranging from 0.1 to 20 Gauss and in the frequency range from 17 to 2070 Hz. A DC magnetic field from 0 to 8 T produced by a superconducting magnet can be applied, while data may be collected in the temperature range 4.2-300 K using a liquid He cryostat under different temperature cycles setups. The first seven AC magnetic multi-harmonic susceptibility components can be measured with a magnetic sensitivity of 1x10-6 emu and a temperature precision of 0.01 K. Here we will describe in detail about schematic of the magnetometer, special attention will be dedicated to the instruments control, data acquisition framework and the user-friendly LabVIEW-based software platform.

  20. NASA Tech Briefs, June 2013 (United States)


    Topics include: Cloud Absorption Radiometer Autonomous Navigation System - CANS, Software Method for Computed Tomography Cylinder Data Unwrapping, Re-slicing, and Analysis, Discrete Data Qualification System and Method Comprising Noise Series Fault Detection, Simple Laser Communications Terminal for Downlink from Earth Orbit at Rates Exceeding 10 Gb/s, Application Program Interface for the Orion Aerodynamics Database, Hyperspectral Imager-Tracker, Web Application Software for Ground Operations Planning Database (GOPDb) Management, Software Defined Radio with Parallelized Software Architecture, Compact Radar Transceiver with Included Calibration, Software Defined Radio with Parallelized Software Architecture, Phase Change Material Thermal Power Generator, The Thermal Hogan - A Means of Surviving the Lunar Night, Micromachined Active Magnetic Regenerator for Low-Temperature Magnetic Coolers, Nano-Ceramic Coated Plastics, Preparation of a Bimetal Using Mechanical Alloying for Environmental or Industrial Use, Phase Change Material for Temperature Control of Imager or Sounder on GOES Type Satellites in GEO, Dual-Compartment Inflatable Suitlock, Modular Connector Keying Concept, Genesis Ultrapure Water Megasonic Wafer Spin Cleaner, Piezoelectrically Initiated Pyrotechnic Igniter, Folding Elastic Thermal Surface - FETS, Multi-Pass Quadrupole Mass Analyzer, Lunar Sulfur Capture System, Environmental Qualification of a Single-Crystal Silicon Mirror for Spaceflight Use, Planar Superconducting Millimeter-Wave/Terahertz Channelizing Filter, Qualification of UHF Antenna for Extreme Martian Thermal Environments, Ensemble Eclipse: A Process for Prefab Development Environment for the Ensemble Project, ISS Live!, Space Operations Learning Center (SOLC) iPhone/iPad Application, Software to Compare NPP HDF5 Data Files, Planetary Data Systems (PDS) Imaging Node Atlas II, Automatic Calibration of an Airborne Imaging System to an Inertial Navigation Unit, Translating MAPGEN to ASPEN for

  1. NASA Tech Briefs, September 2005 (United States)


    Topivs include: Diamond-Coated Carbon Nanotubes for Efficient Field Emission; Improved Anode Coatings for Direct Methanol Fuel Cells; Advanced Ablative Insulators and Methods of Making Them; PETIs as High-Temperature Resin-Transfer-Molding Materials; Stable Polyimides for Terrestrial and Space Uses; Low-Density, Aerogel-Filled Thermal-Insulation Tiles; High-Performance Polymers Having Low Melt Viscosities; Nonflammable, Hydrophobic Aerogel Composites for Insulation; Front-Side Microstrip Line Feeding a Raised Antenna Patch; Medium-Frequency Pseudonoise Georadar; Facilitating Navigation Through Large Archives; Program for Weibull Analysis of Fatigue Data; Comprehensive Micromechanics-Analysis Code - Version 4.0; Component-Based Visualization System; Software for Engineering Simulations of a Spacecraft; LabVIEW Interface for PCI-SpaceWire Interface Card; Path Following with Slip Compensation for a Mars Rover; International Space Station Electric Power System Performance Code-SPACE; Software for Automation of Real-Time Agents, Version 2; Software for Optimizing Plans Involving Interdependent Goals; Computing Gravitational Fields of Finite-Sized Bodies; Custom Sky-Image Mosaics from NASA's Information Power Grid; ANTLR Tree Grammar Generator and Extensions; Generic Kalman Filter Software; Alignment Stage for a Cryogenic Dilatometer; Rugged Iris Mechanism; Treatments To Produce Stabilized Aluminum Mirrors for Cryogenic Uses; Making AlNx Tunnel Barriers Using a Low-Energy Nitrogen-Ion Beam; Making Wide-IF SIS Mixers with Suspended Metal-Beam Leads; Sol-Gel Glass Holographic Light-Shaping Diffusers; Automated Counting of Particles To Quantify Cleanliness; Phase Correction for GPS Antenna with Nonunique Phase Center; Compact Infrasonic Windscreen; Broadband External-Cavity Diode Laser; High-Efficiency Solar Cells Using Photonic-Bandgap Materials; Generating Solid Models from Topographical Data; Computationally Lightweight Air-Traffic-Control Simulation; Spool Valve for

  2. NASA Tech Briefs, July 2012 (United States)


    Topics covered include: Instrument Suite for Vertical Characterization of the Ionosphere-Thermosphere System; Terahertz Radiation Heterodyne Detector Using Two-Dimensional Electron Gas in a GaN Heterostructure; Pattern Recognition Algorithm for High-Sensitivity Odorant Detection in Unknown Environments; Determining Performance Acceptability of Electrochemical Oxygen Sensors; Versatile Controller for Infrared Lamp and Heater Arrays; High-Speed Scanning Interferometer Using CMOS Image Sensor and FPGA Based on Multifrequency Phase-Tracking Detection; Ultra-Low-Power MEMS Selective Gas Sensors; Compact Receiver Front Ends for Submillimeter-Wave Applications; Dynamically Reconfigurable Systolic Array Accelerator; Blocking Losses With a Photon Counter; Motion-Capture-Enabled Software for Gestural Control of 3D Mod; Orbit Software Suite; CoNNeCT Baseband Processor Module Boot Code SoftWare (BCSW); Trajectory Software With Upper Atmosphere Model; ALSSAT Version 6.0; Employing a Grinding Technology to Assess the Microbial Density for Encapsulated Organisms; Demonstration of Minimally Machined Honeycomb Silicon Carbide Mirrors; Polyimide Aerogel Thin Films; Nanoengineered Thermal Materials Based on Carbon Nanotube Array Composites; Composite Laminate With Coefficient of Thermal Expansion Matching D263 Glass; Robust Tensioned Kevlar Suspension Design; Focal Plane Alignment Utilizing Optical CMM; Purifying, Separating, and Concentrating Cells From a Sample Low in Biomass; Virtual Ultrasound Guidance for Inexperienced Operators; Beat-to-Beat Blood Pressure Monitor; Non-Contact Conductivity Measurement for Automated Sample Processing Systems; An MSK Radar Waveform; Telescope Alignment From Sparsely Sampled Wavefront Measurements Over Pupil Subapertures; Method to Remove Particulate Matter from Dusty Gases at Low Pressures; Terahertz Quantum Cascade Laser With Efficient Coupling and Beam Profile; Measurement Via Optical Near-Nulling and Subaperture Stitching; 885-nm Pumped

  3. NASA Tech Briefs, August 2012 (United States)


    Topics covered include: Mars Science Laboratory Drill; Ultra-Compact Motor Controller; A Reversible Thermally Driven Pump for Use in a Sub-Kelvin Magnetic Refrigerator; Shape Memory Composite Hybrid Hinge; Binding Causes of Printed Wiring Assemblies with Card-Loks; Coring Sample Acquisition Tool; Joining and Assembly of Bulk Metallic Glass Composites Through Capacitive Discharge; 670-GHz Schottky Diode-Based Subharmonic Mixer with CPW Circuits and 70-GHz IF; Self-Nulling Lock-in Detection Electronics for Capacitance Probe Electrometer; Discontinuous Mode Power Supply; Optimal Dynamic Sub-Threshold Technique for Extreme Low Power Consumption for VLSI; Hardware for Accelerating N-Modular Redundant Systems for High-Reliability Computing; Blocking Filters with Enhanced Throughput for X-Ray Microcalorimetry; High-Thermal-Conductivity Fabrics; Imidazolium-Based Polymeric Materials as Alkaline Anion-Exchange Fuel Cell Membranes; Electrospun Nanofiber Coating of Fiber Materials: A Composite Toughening Approach; Experimental Modeling of Sterilization Effects for Atmospheric Entry Heating on Microorganisms; Saliva Preservative for Diagnostic Purposes; Hands-Free Transcranial Color Doppler Probe; Aerosol and Surface Parameter Retrievals for a Multi-Angle, Multiband Spectrometer LogScope; TraceContract; AIRS Maps from Space Processing Software; POSTMAN: Point of Sail Tacking for Maritime Autonomous Navigation; Space Operations Learning Center; OVERSMART Reporting Tool for Flow Computations Over Large Grid Systems; Large Eddy Simulation (LES) of Particle-Laden Temporal Mixing Layers; Projection of Stabilized Aerial Imagery Onto Digital Elevation Maps for Geo-Rectified and Jitter-Free Viewing; Iterative Transform Phase Diversity: An Image-Based Object and Wavefront Recovery; 3D Drop Size Distribution Extrapolation Algorithm Using a Single Disdrometer; Social Networking Adapted for Distributed Scientific Collaboration; General Methodology for Designing Spacecraft Trajectories

  4. NASA Tech Briefs, November 2006 (United States)


    Topics include: Simulator for Testing Spacecraft Separation Devices; Apparatus for Hot Impact Testing of Material Specimens; Instrument for Aircraft-Icing and Cloud-Physics Measurements; Advances in Measurement of Skin Friction in Airflow; Improved Apparatus for Testing Monoball Bearings; High-Speed Laser Scanner Maps a Surface in Three Dimensions; Electro-Optical Imaging Fourier-Transform Spectrometer; Infrared Instrument for Detecting Hydrogen Fires; Modified Coaxial Probe Feeds for Layered Antennas; Detecting Negative Obstacles by Use of Radar; Cryogenic Pound Circuits for Cryogenic Sapphire Oscillators; PixelLearn; New Software for Predicting Charging of Spacecraft; Conversion Between Osculating and Mean Orbital Elements; Generating a 2D Representation of a Complex Data Structure; Making Activated Carbon by Wet Pressurized Pyrolysis; Composite Solid Electrolyte Containing Li+- Conducting Fibers; Electrically Conductive Anodized Aluminum Surfaces; Rapid-Chill Cryogenic Coaxial Direct-Acting Solenoid Valve; Variable-Tension-Cord Suspension/Vibration- Isolation System; Techniques for Connecting Superconducting Thin Films; Versatile Friction Stir Welding/Friction Plug Welding System; Thermal Spore Exposure Vessels; Enumerating Spore-Forming Bacteria Airborne with Particles; Miniature Oxidizer Ionizer for a Fuel Cell; Miniature Ion-Array Spectrometer; Promoted-Combustion Chamber with Induction Heating Coil; Miniature Ion-Mobility Spectrometer; Mixed-Salt/Ester Electrolytes for Low-Temperature Li+ Cells; Miniature Free-Space Electrostatic Ion Thrusters; Miniature Bipolar Electrostatic Ion Thruster; Holographic Plossl Retroreflectors; Miniature Electrostatic Ion Thruster With Magnet; Using Apex To Construct CPM-GOMS Models; Sequence Detection for PPM Optical Communication With ISI; Algorithm for Rapid Searching Among Star-Catalog Entries; Expectation-Based Control of Noise and Chaos; Radio Heating of Lunar Soil to Release Gases; Using Electrostriction to Manipulate

  5. Engine Development Design Margins Briefing Charts (United States)

    Bentz, Chuck


    New engines experience durability problems after entering service. The most prevalent and costly is the hot section, particularly the high-pressure turbine. The origin of durability problems can be traced back to: 1) the basic aero-mechanical design systems, assumptions, and design margins used by the engine designers, 2) the available materials systems, and 3) to a large extent, aggressive marketing in a highly competitive environment that pushes engine components beyond the demonstrated capability of the basic technology available for the hardware designs. Unfortunately the user must operate the engine in the service environment in order to learn the actual thrust loading and the time at max effort take-off conditions used in service are needed to determine the hot section life. Several hundred thousand hours of operational service will be required before the demonstrated reliability of a fleet of engines or the design deficiencies of the engine hot section parts can be determined. Also, it may take three to four engine shop visits for heavy maintenance on the gas path hardware to establish cost effective build standards. Spare parts drive the oerator's engine maintenance costs but spare parts also makes lots of money for the engine manufacturer during the service life of an engine. Unless competition prevails for follow-on engine buys, there is really no motivation for an OEM to spend internal money to improve parts durability and reduce earnings derived from a lucrative spare parts business. If the hot section life is below design goals or promised values, the OEM migh argue that the engine is being operated beyond its basic design intent. On the other hand, the airframer and the operator will continue to remind the OEM that his engine was selected based on a lot of promises to deliver spec thrust with little impact on engine service life if higher thrust is used intermittently. In the end, a standoff prevails and nothing gets fixed. This briefing will propose

  6. Fractional ac Josephson effect in unconventional superconductors

    International Nuclear Information System (INIS)

    For certain orientations of Josephson junctions between two px-wave or two d-wave superconductors, the subgap Andreev bound states produce a 4π-periodic relation between the Josephson current I and the phase difference ψ: I propor to sin(ψ/2) . Consequently, the ac Josephson current has the fractional frequency eV/h where V is the dc voltage. In the tunneling limit, the Josephson current is proportional to the first power (not square) of the electron tunneling amplitude. Thus, the Josephson current between unconventional superconductors is carried by single electrons, rather than by Cooper pairs. The fractional ac Josephson effect can be observed experimentally by measuring frequency spectrum of microwave radiation from the junction

  7. AC motor drive system for electric cars

    Energy Technology Data Exchange (ETDEWEB)

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))


    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  8. β-delayed fission from 230Ac

    International Nuclear Information System (INIS)

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  9. AC Dielectrophoresis Using Elliptic Electrode Geometry


    S. M. Rezaul Hasan; Aanan Khurma


    This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number) fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of...

  10. Lazy AC-Pattern Matching for Rewriting

    CERN Document Server

    Belkhir, Walid; 10.4204/EPTCS.82.3


    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  11. Entropy production in ac-calorimetry


    Garden, Jean-Luc; Richard, Jacques


    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  12. NASA Tech Briefs, June 2014 (United States)


    Topics include: Real-Time Minimization of Tracking Error for Aircraft Systems; Detecting an Extreme Minority Class in Hyperspectral Data Using Machine Learning; KSC Spaceport Weather Data Archive; Visualizing Acquisition, Processing, and Network Statistics Through Database Queries; Simulating Data Flow via Multiple Secure Connections; Systems and Services for Near-Real-Time Web Access to NPP Data; CCSDS Telemetry Decoder VHDL Core; Thermal Response of a High-Power Switch to Short Pulses; Solar Panel and System Design to Reduce Heating and Optimize Corridors for Lower-Risk Planetary Aerobraking; Low-Cost, Very Large Diamond-Turned Metal Mirror; Very-High-Load-Capacity Air Bearing Spindle for Large Diamond Turning Machines; Elevated-Temperature, Highly Emissive Coating for Energy Dissipation of Large Surfaces; Catalyst for Treatment and Control of Post-Combustion Emissions; Thermally Activated Crack Healing Mechanism for Metallic Materials; Subsurface Imaging of Nanocomposites; Self-Healing Glass Sealants for Solid Oxide Fuel Cells and Electrolyzer Cells; Micromachined Thermopile Arrays with Novel Thermo - electric Materials; Low-Cost, High-Performance MMOD Shielding; Head-Mounted Display Latency Measurement Rig; Workspace-Safe Operation of a Force- or Impedance-Controlled Robot; Cryogenic Mixing Pump with No Moving Parts; Seal Design Feature for Redundancy Verification; Dexterous Humanoid Robot; Tethered Vehicle Control and Tracking System; Lunar Organic Waste Reformer; Digital Laser Frequency Stabilization via Cavity Locking Employing Low-Frequency Direct Modulation; Deep UV Discharge Lamps in Capillary Quartz Tubes with Light Output Coupled to an Optical Fiber; Speech Acquisition and Automatic Speech Recognition for Integrated Spacesuit Audio Systems, Version II; Advanced Sensor Technology for Algal Biotechnology; High-Speed Spectral Mapper; "Ascent - Commemorating Shuttle" - A NASA Film and Multimedia Project DVD; High-Pressure, Reduced-Kinetics Mechanism for N

  13. NASA Tech Briefs, January 2013 (United States)


    Topics include: Single-Photon-Sensitive HgCdTe Avalanche Photodiode Detector; Surface-Enhanced Raman Scattering Using Silica Whispering-Gallery Mode Resonators; 3D Hail Size Distribution Interpolation/Extrapolation Algorithm; Color-Changing Sensors for Detecting the Presence of Hypergolic Fuels; Artificial Intelligence Software for Assessing Postural Stability; Transformers: Shape-Changing Space Systems Built with Robotic Textiles; Fibrillar Adhesive for Climbing Robots; Using Pre-Melted Phase Change Material to Keep Payloads in Space Warm for Hours without Power; Development of a Centrifugal Technique for the Microbial Bioburden Analysis of Freon (CFC-11); Microwave Sinterator Freeform Additive Construction System (MS-FACS); DSP/FPGA Design for a High-Speed Programmable S-Band Space Transceiver; On-Chip Power-Combining for High-Power Schottky Diode-Based Frequency Multipliers; FPGA Vision Data Architecture; Memory Circuit Fault Simulator; Ultra-Compact Transputer-Based Controller for High-Level, Multi-Axis Coordination; Regolith Advanced Surface Systems Operations Robot Excavator; Magnetically Actuated Seal; Hybrid Electrostatic/Flextensional Mirror for Lightweight, Large-Aperture, and Cryogenic Space Telescopes; System for Contributing and Discovering Derived Mission and Science Data; Remote Viewer for Maritime Robotics Software; Stackfile Database; Reachability Maps for In Situ Operations; JPL Space Telecommunications Radio System Operating Environment; RFI-SIM: RFI Simulation Package; ION Configuration Editor; Dtest Testing Software; IMPaCT - Integration of Missions, Programs, and Core Technologies; Integrated Systems Health Management (ISHM) Toolkit; Wind-Driven Wireless Networked System of Mobile Sensors for Mars Exploration; In Situ Solid Particle Generator; Analysis of the Effects of Streamwise Lift Distribution on Sonic Boom Signature; Rad-Tolerant, Thermally Stable, High-Speed Fiber-Optic Network for Harsh Environments; Towed Subsurface Optical

  14. NASA Tech Briefs, August 2011 (United States)


    Topics covered include: Miniature, Variable-Speed Control Moment Gyroscope; NBL Pistol Grip Tool for Underwater Training of Astronauts; HEXPANDO Expanding Head for Fastener-Retention Hexagonal Wrench; Diagonal-Axes Stage for Pointing an Optical Communications Transceiver; Improvements in Speed and Functionality of a 670-GHz Imaging Radar; IONAC-Lite; Large Ka-Band Slot Array for Digital Beam-Forming Applications; Development of a 150-GHz MMIC Module Prototype for Large-Scale CMB Radiation; Coupling Between Waveguide-Fed Slot Arrays; PCB-Based Break-Out Box; Multiple-Beam Detection of Fast Transient Radio Sources; Router Agent Technology for Policy-Based Network Management; Remote Asynchronous Message Service Gateway; Automatic Tie Pointer for In-Situ Pointing Correction; Jitter Correction; MSLICE Sequencing; EOS MLS Level 2 Data Processing Software Version 3; DspaceOgre 3D Graphics Visualization Tool; Metallization for Yb14MnSb11-Based Thermoelectric Materials; Solvent/Non-Solvent Sintering To Make Microsphere Scaffolds; Enhanced Fuel-Optimal Trajectory-Generation Algorithm for Planetary Pinpoint Landing; Self-Cleaning Coatings and Materials for Decontaminating Field-Deployable Land and Water-Based Optical Systems; Separation of Single-Walled Carbon Nanotubes with DEP-FFF; Li Anode Technology for Improved Performance; Post-Fragmentation Whole Genome Amplification-Based Method; Microwave Tissue Soldering for Immediate Wound Closure; Principles, Techniques, and Applications of Tissue Microfluidics; Robotic Scaffolds for Tissue Engineering and Organ Growth; Stress-Driven Selection of Novel Phenotypes; Method for Accurately Calibrating a Spectrometer Using Broadband Light; Catalytic Microtube Rocket Igniter; Stage Cylindrical Immersive Display; Vacuum Camera Cooler; Atomic Oxygen Fluence Monitor; Thermal Management Tools for Propulsion System Trade Studies and Analysis; Introduction to Physical Intelligence; Technique for Solving Electrically Small to Large Structures

  15. Competency-Based Business Degree. Issue Brief (United States)

    Washington State Board for Community and Technical Colleges, 2014


    In January 2015, thirteen Washington community colleges launched an online, competency-based business transfer degree--the first in the state's community and technical college system. This issue brief provides answers to commonly asked questions about the new competency-based degree.

  16. A Brief Introduction to SLA Theories

    Institute of Scientific and Technical Information of China (English)



    There are a large number of theories,models or hypotheses in the history of SLA research.A brief introduction is made in this paper on several typical ones which have a great influence on foreign language teaching and it is hoped to be useful for the study of SLA research and foreign language teaching.

  17. Genre Identification of Very Brief Musical Excerpts (United States)

    Mace, Sandra T.; Wagoner, Cynthia L.; Teachout, David J.; Hodges, Donald A.


    The purpose of this study was to examine how well individuals were able to identify different music genres from very brief excerpts and whether musical training, gender and preference played a role in genre identification. Listeners were asked to identify genre from classical, jazz, country, metal, and rap/hip hop excerpts that were 125, 250, 500,…

  18. Monitoring Climate Finance and ODA Issues Brief


    Huhtala, Ari; Curto, Stefano; Ambrosi, Philippe


    This issues brief examines the challenges of monitoring financial flows related to climate change. The first part focuses on tracking, monitoring, and reporting various types of flows, primarily from official development assistance (ODA) and other public sources but also from private sources. The second part explores possible ways of tracking additionality in ODA flows, with the aim of sti...

  19. Quality Physical Education. NASPE Resource Brief (United States)

    National Association for Sport and Physical Education, 2013


    A quality physical education program provides learning opportunities, appropriate instruction, meaningful and challenging content, and student and program assessment. In addition, a quality physical education improves mental alertness, academic performance, and readiness and enthusiasm for learning in the nation's youth. This brief provides a list…

  20. 14 CFR 91.519 - Passenger briefing. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Passenger briefing. 91.519 Section 91.519 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC... be supplemented by printed cards for the use of each passenger containing— (1) A diagram of,...

  1. A brief history of the universe

    International Nuclear Information System (INIS)

    The failure of the Big Bang Theory to explain the experimental (cosmological) data is well known. Attempts have been made to give a new interpretation of the above theory to explain the existing cosmological problems and a brief history of the universe. (author). 2 refs, 1 fig

  2. Attention Deficit Disorder. NICHCY Briefing Paper. (United States)

    Fowler, Mary

    This briefing paper uses a question-and-answer format to provide basic information about children with attention deficit disorder (ADD). Questions address the following concerns: nature and incidence of ADD; causes of ADD; signs of ADD (impulsivity, hyperactivity, disorganization, social skill deficits); the diagnostic ADD assessment; how to get…

  3. Update: Preparation Briefing Meeting for Shanghai

    Institute of Scientific and Technical Information of China (English)


    @@ On March 9,the preparation briefing meeting for Shanghai World Expo was held in Beijing.Shanghai Mayor Han Zheng,CCPIT Chairman Wan Jifei,Assistant Foreign Minister Liu Jieyi and three deputy directors of Shanghai World Expo Organizing Committee addressed the meeting.

  4. Sustainable investment in Turkey: issue brief


    Ararat, Melsa; Yurtoğlu, Burçin B.; Yurtoglu, Burcin B.; Suel, Esra


    IFC launched a series of sustainable investment country reports initially covering the largest emerging capital markets attracting global portfolio investors: Brazil, India, and China. Further reports have been added to the series covering Sub-Saharan Africa, the Middle East and North Africa, and Turkey. This Issue Brief 's the summary version of the report, “Sustainable Investment in Turkey,”

  5. A brief history of dosage compensation

    Indian Academy of Sciences (India)

    Stanley M. Gartler


    In 1914, H. J. Muller postulated the origin of the Y chromosome as having resulted from restricted recombination between homologous sex chromosomes in the male and the accumulation of deleterious mutations. This evolutionary process leads to dosage compensation. This article lays out a brief history of dosage compensation in genetics.

  6. Universities and Development: Global Cooperation. Policy Briefing (United States)

    Universities UK, 2010


    This policy briefing aims to demonstrate that universities are key organisations in international development. Universities are involved in a wide range of international development activities, including collaborative research projects, developing entrepreneurial and employability skills and the evaluation of non-governmental organisation (NGO)…

  7. A brief review on nuclear fragmentation

    International Nuclear Information System (INIS)

    In this article a brief review on nuclear fragmentation has been presented on both theoretical and experimental ground. On the theoretical aspects discussion on different models has been done. On experimental overview the multiplicity distribution, angular distribution, correlation and intermittent type of fluctuations have been discussed for black and grey particles is presented. An experimental review on projectile fragments is also given. (author)

  8. The Neighboring Field of Brief Individual Psychotherapy. (United States)

    Gustafson, Jim


    Presents field of brief individual psychotherapy as coherent set of conventions, despite its diverse origins in schools of dynamic, behavioral, interpersonal or cognitive, and strategic psychotherapy. Proposes advantages and drawbacks of shared conventions and discusses how neighboring field could help field of family therapy reduce its errors.…

  9. Counseling Services and Student Success. Research Brief (United States)

    Francis, Perry C.; Horn, Aaron S.


    The purpose of this research brief is to provide an overview of mental health issues and counseling services on college campuses. The findings from several national surveys are reviewed to estimate the prevalence of anxiety and depression, suicide and suicidal ideation, and violence among college students. Common prevention and treatment programs…

  10. Reinventing Teacher Compensation Systems. CPRE Finance Briefs. (United States)

    Kelley, Carolyn; Odden, Allan

    Other organizations in the United States have successfully implemented new compensation structures. This publication argues that it is time for education to join these successful efforts and revise teacher-pay systems. The brief provides a short history of changes in teacher compensation over the last century and a discussion of key organizational…

  11. NASA Ames Fluid Mechanics Laboratory research briefs (United States)

    Davis, Sanford (Editor)


    The Ames Fluid Mechanics Laboratory research program is presented in a series of research briefs. Nineteen projects covering aeronautical fluid mechanics and related areas are discussed and augmented with the publication and presentation output of the Branch for the period 1990-1993.

  12. Briefs for English-Speaking Parents, 1996. (United States)

    Howley, Craig

    In plain language, these six ready-to-copy briefs state what researchers and practitioners have learned about various ways parents can help their children do well in school. "Calculating the Risks: When Should Parents Add or Subtract?" discusses the normal risks of life, the intensification of risk by poverty, and how parents can keep children…

  13. Characteristics of Improved School Districts. Research Brief (United States)

    Center for Comprehensive School Reform and Improvement, 2006


    This research brief presents an overview of a 2004 study by G.S. Shannon and P. Bylsma entitled "Characteristics of Improved School Districts: Themes from Research" (Olympia, WA: Office of Superintendent of Public Instruction). The authors reviewed more than 80 research articles that investigated the attributes of schools and districts that have…

  14. Pseudoangiomatous stromal hyperplasia (PASH): a brief review. (United States)

    Jaunoo, S S; Thrush, S; Dunn, P


    Pseudoangiomatous stromal hyperplasia (PASH) is a benign entity of the breast and typically found incidentally. It warrants thorough investigation in order to exclude more sinister pathology masquerading as this form of benign breast disease and can often be managed expectantly without the need for surgical intervention. We provide a brief review of the literature on PASH, discussing its clinicopathological features and management. PMID:20887819

  15. NASA Tech Briefs, September 2004 (United States)


    Topics covered include: Brazing SiC/SiC Composites to Metals; Composite-Material Tanks with Chemically Resistant Liners; Thermally Conductive Metal-Tube/Carbon-Composite Joints; Improved BN Coatings on SiC Fibers in SiC Matrices; Iterative Demodulation and Decoding of Non-Square QAM; Measuring Radiation Patterns of Reconfigurable Patch Antennas on Wafers; Low-Cutoff, High-Pass Digital Filtering of Neural Signals; Further Improvement in 3DGRAPE; Ground Support Software for Spaceborne Instrumentation; MER SPICE Interface; Simulating Operation of a Planetary Rover; Analyzing Contents of a Computer Cache; Discrepancy Reporting Management System; Silicone-Rubber Microvalves Actuated by Paraffin; Hydraulic Apparatus for Mechanical Testing of Nuts; Heat Control via Torque Control in Friction Stir Welding; Manufacturing High-Quality Carbon Nanotubes at Lower Cost; Setup for Visual Observation of Carbon-Nanotube Arc Process; Solution Preserves Nucleic Acids in Body-Fluid Specimens; Oligodeoxynucleotide Probes for Detecting Intact Cells; Microwave-Spectral Signatures Would Reveal Concealed Objects; Digital Averaging Phasemeter for Heterodyne Interferometry; Optoelectronic Instrument Monitors pH in a Culture Medium; Imaging of gamma-Irradiated Regions of a Crystal; Photodiode-Based, Passive Ultraviolet Dosimeters; Discrete Wavelength-Locked External Cavity Laser; Flexible Shields for Protecting Spacecraft Against Debris; Part 2 of a Computational Study of a Drop-Laden Mixing Layer; Controllable Curved Mirrors Made from Single-Layer EAP Films; and Demonstration of a Pyrotechnic Bolt-Retractor System.

  16. NASA Tech Briefs, June 2003 (United States)


    Topics covered include: Nulling Infrared Radiometer for Measuring Temperature; The Ames Power Monitoring System; Hot Films on Ceramic Substrates for Measuring Skin Friction; Probe Without Moving Parts Measures Flow Angle; Detecting Conductive Liquid Leaking from Nonconductive Pipe; Adaptive Suppression of Noise in Voice Communications; High-Performance Solid-State W-Band Power Amplifiers; Microbatteries for Combinatorial Studies of Conventional Lithium-Ion Batteries; Correcting for Beam Aberrations in a Beam-Waveguide Antenna; Advanced Rainbow Solar Photovoltaic Arrays; Metal Side Reflectors for Trapping Light in QWIPs; Software for Collaborative Engineering of Launch Rockets; Software Assists in Extensive Environmental Auditing; Software Supports Distributed Operations via the Internet; Software Estimates Costs of Testing Rocket Engines; yourSky: Custom Sky-Image Mosaics via the Internet; Software for Managing Inventory of Flight Hardware; Lower-Conductivity Thermal-Barrier Coatings; Process for Smoothing an Si Substrate after Etching of SiO2; Flexible Composite-Material Pressure Vessel; Treatment to Destroy Chlorohydrocarbon Liquids in the Ground; Noncircular Cross Sections Could Enhance Mixing in Sprays; Small, Untethered, Mobile Roots for Inspecting Gas Pipes; Paint-Overspray Catcher; Preparation of Regular Specimens for Atom Probes; Inverse Tomo-Lithography for Making Microscopic 3D Parts; Predicting and Preventing Incipient Flameout in Combustors; MEMS-Based Piezoelectric/Electrostatic Inchworm Actuator; Metallized Capillaries as Probes for Raman Spectroscopy; Adaptation of Mesoscale Weather Models to Local Forecasting; Aerodynamic Design using Neural Networks; Combining Multiple Gyroscope Outputs for Increased Accuracy; and Improved Collision-Detection Method for Robotic Manipulator.

  17. NASA Tech Briefs, August 2013 (United States)


    Topics covered include: Radial Internal Material Handling System (RIMS) for Circular Habitat Volumes; Conical Seat Shut-Off Valve; Impact-Actuated Digging Tool for Lunar Excavation; Flexible Mechanical Conveyors for Regolith Extraction and Transport; Remote Memory Access Protocol Target Node Intellectual Property; Soft Decision Analyzer; Distributed Prognostics and Health Management with a Wireless Network Architecture; Minimal Power Latch for Single-Slope ADCs; Bismuth Passivation Technique for High-Resolution X-Ray Detectors; High-Strength, Super-elastic Compounds; Cu-Cr-Nb-Zr Alloy for Rocket Engines and Other High-Heat- Flux Applications; Microgravity Storage Vessels and Conveying-Line Feeders for Cohesive Regolith; CRUQS: A Miniature Fine Sun Sensor for Nanosatellites; On-Chip Microfluidic Components for In Situ Analysis, Separation, and Detection of Amino Acids; Spectroscopic Determination of Trace Contaminants in High-Purity Oxygen; Method of Separating Oxygen From Spacecraft Cabin Air to Enable Extravehicular Activities; Atomic Force Microscope Mediated Chromatography; Sample Analysis at Mars Instrument Simulator; Access Control of Web- and Java-Based Applications; Tool for Automated Retrieval of Generic Event Tracks (TARGET); Bilayer Protograph Codes for Half-Duplex Relay Channels; Influence of Computational Drop Representation in LES of a Droplet-Laden Mixing Layer.

  18. NASA Tech Briefs, August 2006 (United States)


    Topics covered include: Measurement and Controls Data Acquisition System IMU/GPS System Provides Position and Attitude Data Using Artificial Intelligence to Inform Pilots of Weather Fast Lossless Compression of Multispectral-Image Data Developing Signal-Pattern-Recognition Programs Implementing Access to Data Distributed on Many Processors Compact, Efficient Drive Circuit for a Piezoelectric Pump; Dual Common Planes for Time Multiplexing of Dual-Color QWIPs; MMIC Power Amplifier Puts Out 40 mW From 75 to 110 GHz; 2D/3D Visual Tracker for Rover Mast; Adding Hierarchical Objects to Relational Database General-Purpose XML-Based Information Managements; Vaporizable Scaffolds for Fabricating Thermoelectric Modules; Producing Quantum Dots by Spray Pyrolysis; Mobile Robot for Exploring Cold Liquid/Solid Environments; System Would Acquire Core and Powder Samples of Rocks; Improved Fabrication of Lithium Films Having Micron Features; Manufacture of Regularly Shaped Sol-Gel Pellets; Regulating Glucose and pH, and Monitoring Oxygen in a Bioreactor; Satellite Multiangle Spectropolarimetric Imaging of Aerosols; Interferometric System for Measuring Thickness of Sea Ice; Microscale Regenerative Heat Exchanger Protocols for Handling Messages Between Simulation Computers Statistical Detection of Atypical Aircraft Flights NASA's Aviation Safety and Modeling Project Multimode-Guided-Wave Ultrasonic Scanning of Materials Algorithms for Maneuvering Spacecraft Around Small Bodies Improved Solar-Radiation-Pressure Models for GPS Satellites Measuring Attitude of a Large, Flexible, Orbiting Structure

  19. Development of a hardware-based AC microgrid for AC stability assessment (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  20. Brief history of laser AGEX

    Energy Technology Data Exchange (ETDEWEB)

    Perry, T S


    A great deal of physics understanding is required for the design and construction of thermonuclear weapons. Since the days of the Manhattan Project, physicists have relied on a combination of theory and experiment for the successful creation of nuclear weapons. One of the great experimental difficulties faced by the designers of nuclear weapons is that nuclear weapons operate in a high energy density regime not found on the earth except during a nuclear weapon detonation. Replicating these conditions is difficult unless a nuclear weapon is actually detonated. One of the reasons for the large number of expensive tests at the Nevada Test Site was that there was no other way to obtain the required data. When the laser was first developed many in the weapons program realized that the ability of a laser to concentrate a large amount of energy in a small volume could create experimental conditions that would be useful for studying the physics of nuclear weapons. The national weapons labs began investigating this possibility and started building ever bigger and better lasers. The vast difference in energy scales between the laboratory and a nuclear weapons explosion meant large and powerful lasers were required. By the early '80s concrete plans for the use of lasers in weapon physics experiments were beginning to be proposed. One of the earliest was the ''Proposals for Laboratory Weapon Physics Experiments'' in 1982 put out by the Physics Experiments Advisory Panel. The radiation hydrodynamics experiments described in these early proposals formed the basis for many of the experiments on lasers that have performed for the last two decades. The Nova laser, which operated between 1984 and 1998 successfully, showed that many of these proposals could be carried out on a large laser system. One of the earliest experiments on Nova was in the area of x-ray opacity. Materials vary in the degree to which they absorb and re-emit radiation of given

  1. NASA Tech Briefs, September 2013 (United States)


    Topics include: ISS Ammonia Leak Detection Through X-Ray Fluorescence; A System for Measuring the Sway of the Vehicle Assembly Building; Fast, High-Precision Readout Circuit for Detector Arrays; Victim Simulator for Victim Detection Radar; Hydrometeor Size Distribution Measurements by Imaging the Attenuation of a Laser Spot; Quasi-Linear Circuit; High-Speed, High-Resolution Time-to-Digital Conversion; Li-Ion Battery and Supercapacitor Hybrid Design for Long Extravehicular Activities; Ultrasonic Low-Friction Containment Plate for Thermal and Ultrasonic Stir Weld Processes; High-Powered, Ultrasonically Assisted Thermal Stir Welding; Next-Generation MKIII Lightweight HUT/Hatch Assembly; Centrifugal Sieve for Gravity-Level-Independent Size; Segregation of Granular Materials; Ion Exchange Technology Development in Support of the Urine Processor Assembly; Nickel-Graphite Composite Compliant Interface and/or Hot Shoe Material; UltraSail CubeSat Solar Sail Flight Experiment; Mechanism for Deploying a Long, Thin-Film Antenna From a Rover; Counterflow Regolith Heat Exchanger; Acquisition and Retaining Granular Samples via a Rotating Coring Bit; Very-Low-Cost, Rugged Vacuum System; Medicine Delivery Device With Integrated Sterilization and Detection; FRET-Aptamer Assays for Bone Marker Assessment, C-Telopeptide, Creatinine, and Vitamin D; Multimode Directional Coupler for Utilization of Harmonic Frequencies from TWTAs; Dual-Polarization, Multi-Frequency Antenna Array for use with Hurricane Imaging Radiometer; Complementary Barrier Infrared Detector (CBIRD) Contact Methods; Autonomous Control of Space Nuclear Reactors; High-Power, High-Speed Electro-Optic Pockels Cell Modulator; Covariance Analysis Tool (G-CAT) for Computing Ascent, Descent, and Landing Errors; Enigma Version 12; Micrometeoroid and Orbital Debris (MMOD) Shield Ballistic Limit Analysis Program; Spitzer Telemetry Processing System; Planetary Protection Bioburden Analysis Program; Wing Leading Edge RCC Rapid

  2. NASA Tech Briefs, February 2011 (United States)


    Topics covered include: Multi-Segment Radius Measurement Using an Absolute Distance Meter Through a Null Assembly; Fiber-Optic Magnetic-Field-Strength Measurement System for Lightning Detection; Photocatalytic Active Radiation Measurements and Use; Computer Generated Hologram System for Wavefront Measurement System Calibration; Non-Contact Thermal Properties Measurement with Low-Power Laser and IR Camera System; SpaceCube 2.0: An Advanced Hybrid Onboard Data Processor; CMOS Imager Has Better Cross-Talk and Full-Well Performance; High-Performance Wireless Telemetry; Telemetry-Based Ranging; JWST Wavefront Control Toolbox; Java Image I/O for VICAR, PDS, and ISIS; X-Band Acquisition Aid Software; Antimicrobial-Coated Granules for Disinfecting Water; Range 7 Scanner Integration with PaR Robot Scanning System; Methods of Antimicrobial Coating of Diverse Materials; High-Operating-Temperature Barrier Infrared Detector with Tailorable Cutoff Wavelength; A Model of Reduced Kinetics for Alkane Oxidation Using Constituents and Species for N-Heptane; Thermally Conductive Tape Based on Carbon Nanotube Arrays; Two Catalysts for Selective Oxidation of Contaminant Gases; Nanoscale Metal Oxide Semiconductors for Gas Sensing; Lightweight, Ultra-High-Temperature, CMC-Lined Carbon/Carbon Structures; Sample Acquisition and Handling System from a Remote Platform; Improved Rare-Earth Emitter Hollow Cathode; High-Temperature Smart Structures for Engine Noise Reduction and Performance Enhancement; Cryogenic Scan Mechanism for Fourier Transform Spectrometer; Piezoelectric Rotary Tube Motor; Thermoelectric Energy Conversion Technology for High-Altitude Airships; Combustor Computations for CO2-Neutral Aviation; Use of Dynamic Distortion to Predict and Alleviate Loss of Control; Cycle Time Reduction in Trapped Mercury Ion Atomic Frequency Standards; and A (201)Hg+ Comagnetometer for (199)Hg+ Trapped Ion Space Atomic Clocks.

  3. NASA Tech Briefs, March 2014 (United States)


    Topics include: Data Fusion for Global Estimation of Forest Characteristics From Sparse Lidar Data; Debris and Ice Mapping Analysis Tool - Database; Data Acquisition and Processing Software - DAPS; Metal-Assisted Fabrication of Biodegradable Porous Silicon Nanostructures; Post-Growth, In Situ Adhesion of Carbon Nanotubes to a Substrate for Robust CNT Cathodes; Integrated PEMFC Flow Field Design for Gravity-Independent Passive Water Removal; Thermal Mechanical Preparation of Glass Spheres; Mechanistic-Based Multiaxial-Stochastic-Strength Model for Transversely-Isotropic Brittle Materials; Methods for Mitigating Space Radiation Effects, Fault Detection and Correction, and Processing Sensor Data; Compact Ka-Band Antenna Feed with Double Circularly Polarized Capability; Dual-Leadframe Transient Liquid Phase Bonded Power Semiconductor Module Assembly and Bonding Process; Quad First Stage Processor: A Four-Channel Digitizer and Digital Beam-Forming Processor; Protective Sleeve for a Pyrotechnic Reefing Line Cutter; Metabolic Heat Regenerated Temperature Swing Adsorption; CubeSat Deployable Log Periodic Dipole Array; Re-entry Vehicle Shape for Enhanced Performance; NanoRacks-Scale MEMS Gas Chromatograph System; Variable Camber Aerodynamic Control Surfaces and Active Wing Shaping Control; Spacecraft Line-of-Sight Stabilization Using LWIR Earth Signature; Technique for Finding Retro-Reflectors in Flash LIDAR Imagery; Novel Hemispherical Dynamic Camera for EVAs; 360 deg Visual Detection and Object Tracking on an Autonomous Surface Vehicle; Simulation of Charge Carrier Mobility in Conducting Polymers; Observational Data Formatter Using CMOR for CMIP5; Propellant Loading Physics Model for Fault Detection Isolation and Recovery; Probabilistic Guidance for Swarms of Autonomous Agents; Reducing Drift in Stereo Visual Odometry; Future Air-Traffic Management Concepts Evaluation Tool; Examination and A Priori Analysis of a Direct Numerical Simulation Database for High

  4. NASA Tech Briefs, May 2013 (United States)


    Topics include: Test Waveform Applications for JPL STRS Operating Environment; Pneumatic Proboscis Heat-Flow Probe; Method to Measure Total Noise Temperature of a Wireless Receiver During Operation; Cursor Control Device Test Battery; Functional Near-Infrared Spectroscopy Signals Measure Neuronal Activity in the Cortex; ESD Test Apparatus for Soldering Irons; FPGA-Based X-Ray Detection and Measurement for an X-Ray Polarimeter; Sequential Probability Ratio Test for Spacecraft Collision Avoidance Maneuver Decisions; Silicon/Carbon Nanotube Photocathode for Splitting Water; Advanced Materials and Fabrication Techniques for the Orion Attitude Control Motor; Flight Hardware Packaging Design for Stringent EMC Radiated Emission Requirements; RF Reference Switch for Spaceflight Radiometer Calibration; An Offload NIC for NASA, NLR, and Grid Computing; Multi-Scale CNT-Based Reinforcing Polymer Matrix Composites for Lightweight Structures; Ceramic Adhesive and Methods for On-Orbit Repair of Re-Entry Vehicles; Self-Healing Nanocomposites for Reusable Composite Cryotanks; Pt-Ni and Pt-Co Catalyst Synthesis Route for Fuel Cell Applications; Aerogel-Based Multilayer Insulation with Micrometeoroid Protection; Manufacturing of Nanocomposite Carbon Fibers and Composite Cylinders; Optimized Radiator Geometries for Hot Lunar Thermal Environments; A Mission Concept: Re-Entry Hopper-Aero-Space-Craft System on-Mars (REARM-Mars); New Class of Flow Batteries for Terrestrial and Aerospace Energy Storage Applications; Reliability of CCGA 1152 and CCGA 1272 Interconnect Packages for Extreme Thermal Environments; Using a Blender to Assess the Microbial Density of Encapsulated Organisms; Mixed Integer Programming and Heuristic Scheduling for Space Communication; Video Altimeter and Obstruction Detector for an Aircraft; Control Software for Piezo Stepping Actuators; Galactic Cosmic Ray Event-Based Risk Model (GERM) Code; Sasquatch Footprint Tool; and Multi-User Space Link Extension (SLE) System.

  5. NASA Tech Briefs, January 2010 (United States)


    Topics covered include: Cryogenic Flow Sensor; Multi-Sensor Mud Detection; Gas Flow Detection System; Mapping Capacitive Coupling Among Pixels in a Sensor Array; Fiber-Based Laser Transmitter for Oxygen A-Band Spectroscopy and Remote Sensing; Low-Profile, Dual-Wavelength, Dual-Polarized Antenna; Time-Separating Heating and Sensor Functions of Thermistors in Precision Thermal Control Applications; Cellular Reflectarray Antenna; A One-Dimensional Synthetic-Aperture Microwave Radiometer; Electrical Switching of Perovskite Thin-Film Resistors; Two-Dimensional Synthetic-Aperture Radiometer; Ethernet-Enabled Power and Communication Module for Embedded Processors; Electrically Variable Resistive Memory Devices; Improved Attachment in a Hybrid Inflatable Pressure Vessel; Electrostatic Separator for Beneficiation of Lunar Soil; Amorphous Rover; Space-Frame Antenna; Gear-Driven Turnbuckle Actuator; In-Situ Focusing Inside a Thermal Vacuum Chamber; Space-Frame Lunar Lander; Wider-Opening Dewar Flasks for Cryogenic Storage; Silicon Oxycarbide Aerogels for High-Temperature Thermal Insulation; Supercapacitor Electrolyte Solvents with Liquid Range Below -80 C; Designs and Materials for Better Coronagraph Occulting Masks; Fuel-Cell-Powered Vehicle with Hybrid Power Management; Fine-Water-Mist Multiple-Orientation-Discharge Fire Extinguisher; Fuel-Cell Water Separator; Turbulence and the Stabilization Principle; Improved Cloud Condensation Nucleus Spectrometer; Better Modeling of Electrostatic Discharge in an Insulator; Sub-Aperture Interferometers; Terahertz Mapping of Microstructure and Thickness Variations; Multiparallel Three-Dimensional Optical Microscopy; Stabilization of Phase of a Sinusoidal Signal Transmitted Over Optical Fiber; Vacuum-Compatible Wideband White Light and Laser Combiner Source System; Optical Tapers as White-Light WGM Resonators; EPR Imaging at a Few Megahertz Using SQUID Detectors; Reducing Field Distortion in Magnetic Resonance Imaging; Fluorogenic Cell

  6. NASA Tech Briefs, September 2010 (United States)


    Topics covered include: Instrument for Measuring Thermal Conductivity of Materials at Low Temperatures; Multi-Axis Accelerometer Calibration System; Pupil Alignment Measuring Technique and Alignment Reference for Instruments or Optical Systems; Autonomous System for Monitoring the Integrity of Composite Fan Housings; A Safe, Self-Calibrating, Wireless System for Measuring Volume of Any Fuel at Non-Horizontal Orientation; Adaptation of the Camera Link Interface for Flight-Instrument Applications; High-Performance CCSDS Encapsulation Service Implementation in FPGA; High-Performance CCSDS AOS Protocol Implementation in FPGA; Advanced Flip Chips in Extreme Temperature Environments; Diffuse-Illumination Systems for Growing Plants; Microwave Plasma Hydrogen Recovery System; Producing Hydrogen by Plasma Pyrolysis of Methane; Self-Deployable Membrane Structures; Reactivation of a Tin-Oxide-Containing Catalys; Functionalization of Single-Wall Carbon Nanotubes by Photo-Oxidation; Miniature Piezoelectric Macro-Mass Balance; Acoustic Liner for Turbomachinery Applications; Metering Gas Strut for Separating Rocket Stages; Large-Flow-Area Flow-Selective Liquid/Gas Separator; Counterflowing Jet Subsystem Design; Water Tank with Capillary Air/Liquid Separation; True Shear Parallel Plate Viscometer; Focusing Diffraction Grating Element with Aberration Control; Universal Millimeter-Wave Radar Front End; Mode Selection for a Single-Frequency Fiber Laser; Qualification and Selection of Flight Diode Lasers for Space Applications; Plenoptic Imager for Automated Surface Navigation; Maglev Facility for Simulating Variable Gravity; Hybrid AlGaN-SiC Avalanche Photodiode for Deep-UV Photon Detection; High-Speed Operation of Interband Cascade Lasers; 3D GeoWall Analysis System for Shuttle External Tank Foreign Object Debris Events; Charge-Spot Model for Electrostatic Forces in Simulation of Fine Particulates; Hidden Statistics Approach to Quantum Simulations; Reconstituted Three

  7. NASA Tech Briefs, November 2009 (United States)


    Topics covered include: Cryogenic Chamber for Servo-Hydraulic Materials Testing; Apparatus Measures Thermal Conductance Through a Thin Sample from Cryogenic to Room Temperature; Rover Attitude and Pointing System Simulation Testbed; Desktop Application Program to Simulate Cargo-Air-Drop Tests; Multimodal Friction Ignition Tester; Small-Bolt Torque-Tension Tester; Integrated Spacesuit Audio System Enhances Speech Quality and Reduces Noise; Hardware Implementation of a Bilateral Subtraction Filter; Simple Optoelectronic Feedback in Microwave Oscillators; Small X-Band Oscillator Antennas; Free-Space Optical Interconnect Employing VCSEL Diodes; Discrete Fourier Transform Analysis in a Complex Vector Space; Miniature Scroll Pumps Fabricated by LIGA; Self-Assembling, Flexible, Pre-Ceramic Composite Preforms; Flight-speed Integral Image Analysis Toolkit; Work Coordination Engine; Multi-Mission Automated Task Invocation Subsystem; Autonomously Calibrating a Quadrupole Mass Spectrometer; Determining Spacecraft Reaction Wheel Friction Parameters; Composite Silica Aerogels Opacified with Titania; Multiplexed Colorimetric Solid-Phase Extraction; Detecting Airborne Mercury by Use of Polymer/Carbon Films; Lattice-Matched Semiconductor Layers on Single Crystalline Sapphire Substrate; Pressure-Energized Seal Rings to Better Withstand Flows; Rollerjaw Rock Crusher; Microwave Sterilization and Depyrogenation System; Quantifying Therapeutic and Diagnostic Efficacy in 2D Microvascular Images; NiF2/NaF:CaF2/Ca Solid-State High-Temperature Battery Cells; Critical Coupling Between Optical Fibers and WGM Resonators; Microwave Temperature Profiler Mounted in a Standard Airborne Research Canister; Alternative Determination of Density of the Titan Atmosphere; Solar Rejection Filter for Large Telescopes; Automated CFD for Generation of Airfoil Performance Tables; Progressive Classification Using Support Vector Machines; Active Learning with Irrelevant Examples; A Data Matrix Method for

  8. NASA Tech Briefs, April 2012 (United States)


    Topics include: Computational Ghost Imaging for Remote Sensing; Digital Architecture for a Trace Gas Sensor Platform; Dispersed Fringe Sensing Analysis - DFSA; Indium Tin Oxide Resistor-Based Nitric Oxide Microsensors; Gas Composition Sensing Using Carbon Nanotube Arrays; Sensor for Boundary Shear Stress in Fluid Flow; Model-Based Method for Sensor Validation; Qualification of Engineering Camera for Long-Duration Deep Space Missions; Remotely Powered Reconfigurable Receiver for Extreme Environment Sensing Platforms; Bump Bonding Using Metal-Coated Carbon Nanotubes; In Situ Mosaic Brightness Correction; Simplex GPS and InSAR Inversion Software; Virtual Machine Language 2.1; Multi-Scale Three-Dimensional Variational Data Assimilation System for Coastal Ocean Prediction; Pandora Operation and Analysis Software; Fabrication of a Cryogenic Bias Filter for Ultrasensitive Focal Plane; Processing of Nanosensors Using a Sacrificial Template Approach; High-Temperature Shape Memory Polymers; Modular Flooring System; Non-Toxic, Low-Freezing, Drop-In Replacement Heat Transfer Fluids; Materials That Enhance Efficiency and Radiation Resistance of Solar Cells; Low-Cost, Rugged High-Vacuum System; Static Gas-Charging Plug; Floating Oil-Spill Containment Device; Stemless Ball Valve; Improving Balance Function Using Low Levels of Electrical Stimulation of the Balance Organs; Oxygen-Methane Thruster; Lunar Navigation Determination System - LaNDS; Launch Method for Kites in Low-Wind or No-Wind Conditions; Supercritical CO2 Cleaning System for Planetary Protection and Contamination Control Applications; Design and Performance of a Wideband Radio Telescope; Finite Element Models for Electron Beam Freeform Fabrication Process Autonomous Information Unit for Fine-Grain Data Access Control and Information Protection in a Net-Centric System; Vehicle Detection for RCTA/ANS (Autonomous Navigation System); Image Mapping and Visual Attention on the Sensory Ego-Sphere; HyDE Framework for

  9. NASA Tech Briefs, March 2013 (United States)


    Topics covered include: Remote Data Access with IDL Data Compression Algorithm Architecture for Large Depth-of-Field Particle Image Velocimeters Vectorized Rebinning Algorithm for Fast Data Down-Sampling Display Provides Pilots with Real-Time Sonic-Boom Information Onboard Algorithms for Data Prioritization and Summarization of Aerial Imagery Monitoring and Acquisition Real-time System (MARS) Analog Signal Correlating Using an Analog-Based Signal Conditioning Front End Micro-Textured Black Silicon Wick for Silicon Heat Pipe Array Robust Multivariable Optimization and Performance Simulation for ASIC Design; Castable Amorphous Metal Mirrors and Mirror Assemblies; Sandwich Core Heat-Pipe Radiator for Power and Propulsion Systems; Apparatus for Pumping a Fluid; Cobra Fiber-Optic Positioner Upgrade; Improved Wide Operating Temperature Range of Li-Ion Cells; Non-Toxic, Non-Flammable, -80 C Phase Change Materials; Soft-Bake Purification of SWCNTs Produced by Pulsed Laser Vaporization; Improved Cell Culture Method for Growing Contracting Skeletal Muscle Models; Hand-Based Biometric Analysis; The Next Generation of Cold Immersion Dry Suit Design Evolution for Hypothermia Prevention; Integrated Lunar Information Architecture for Decision Support Version 3.0 (ILIADS 3.0); Relay Forward-Link File Management Services (MaROS Phase 2); Two Mechanisms to Avoid Control Conflicts Resulting from Uncoordinated Intent; XTCE GOVSAT Tool Suite 1.0; Determining Temperature Differential to Prevent Hardware Cross-Contamination in a Vacuum Chamber; SequenceL: Automated Parallel Algorithms Derived from CSP-NT Computational Laws; Remote Data Exploration with the Interactive Data Language (IDL); Mixture-Tuned, Clutter Matched Filter for Remote Detection of Subpixel Spectral Signals; Partitioned-Interval Quantum Optical Communications Receiver; and Practical UAV Optical Sensor Bench with Minimal Adjustability.

  10. NASA Tech Briefs, February 2003 (United States)


    opics covered include: Integrated Electrode Arrays for Neuro-Prosthetic Implants; Eroding Potentiometers; Common/Dependent-Pressure-Vessel Nickel-Hydrogen Batteries; 120-GHz HEMT Oscillator With Surface-Wave-Assisted Antenna; 80-GHz MMIC HEMT Voltage-Controlled Oscillator; High-Energy-Density Capacitors; Microscale Thermal-Transpiration Gas Pump; Instrument for Measuring Temperature of Water; Improved Measurement of Coherence in Presence of Instrument Noise; Compact Instruments Measure Helium-Leak Rates; Irreversible Entropy Production in Two-Phase Mixing Layers; Subsonic and Supersonic Effects in Bose-Einstein Condensate; Nanolaminate Mirrors With "Piston" Figure-Control Actuators; Mixed Conducting Electrodes for Better AMTEC Cells; Process for Encapsulating Protein Crystals; Lightweight, Self-Deployable Wheels; Grease-Resistant O Rings for Joints in Solid Rocket Motors; LabVIEW Serial Driver Software for an Electronic Load; Software Computes Tape-Casting Parameters; Software for Tracking Costs of Mars Projects; Software for Replicating Data Between X.500 and LDAP Directories; The Technical Work Plan Tracking Tool; Improved Multiple-DOF SAW Piezoelectric Motors; Propulsion Flight-Test Fixture; Mechanical Amplifier for a Piezoelectric Transducer; Swell Sleeves for Testing Explosive Devices; Linear Back-Drive Differentials; Miniature Inchworm Actuators Fabricated by Use of LIGA; Using ERF Devices to Control Deployments of Space Structures; High-Temperature Switched-Reluctance Electric Motor; System for Centering a Turbofan in a Nacelle During Tests; Fabricating Composite-Material Structures Containing SMA Ribbons; Optimal Feedback Control of Thermal Networks; Artifacts for Calibration of Submicron Width Measurements; Navigating a Mobile Robot Across Terrain Using Fuzzy Logic; Designing Facilities for Collaborative Operations; and Quantitating Iron in Serum Ferritin by Use of ICP-MS.

  11. NASA Tech Briefs, September 2008 (United States)


    Topics covered include: Nanotip Carpets as Antireflection Surfaces; Nano-Engineered Catalysts for Direct Methanol Fuel Cells; Capillography of Mats of Nanofibers; Directed Growth of Carbon Nanotubes Across Gaps; High-Voltage, Asymmetric-Waveform Generator; Magic-T Junction Using Microstrip/Slotline Transitions; On-Wafer Measurement of a Silicon-Based CMOS VCO at 324 GHz; Group-III Nitride Field Emitters; HEMT Amplifiers and Equipment for their On-Wafer Testing; Thermal Spray Formation of Polymer Coatings; Improved Gas Filling and Sealing of an HC-PCF; Making More-Complex Molecules Using Superthermal Atom/Molecule Collisions; Nematic Cells for Digital Light Deflection; Improved Silica Aerogel Composite Materials; Microgravity, Mesh-Crawling Legged Robots; Advanced Active-Magnetic-Bearing Thrust- Measurement System; Thermally Actuated Hydraulic Pumps; A New, Highly Improved Two-Cycle Engine; Flexible Structural-Health-Monitoring Sheets; Alignment Pins for Assembling and Disassembling Structures; Purifying Nucleic Acids from Samples of Extremely Low Biomass; Adjustable-Viewing-Angle Endoscopic Tool for Skull Base and Brain Surgery; UV-Resistant Non-Spore-Forming Bacteria From Spacecraft-Assembly Facilities; Hard-X-Ray/Soft-Gamma-Ray Imaging Sensor Assembly for Astronomy; Simplified Modeling of Oxidation of Hydrocarbons; Near-Field Spectroscopy with Nanoparticles Deposited by AFM; Light Collimator and Monitor for a Spectroradiometer; Hyperspectral Fluorescence and Reflectance Imaging Instrument; Improving the Optical Quality Factor of the WGM Resonator; Ultra-Stable Beacon Source for Laboratory Testing of Optical Tracking; Transmissive Diffractive Optical Element Solar Concentrators; Delaying Trains of Short Light Pulses in WGM Resonators; Toward Better Modeling of Supercritical Turbulent Mixing; JPEG 2000 Encoding with Perceptual Distortion Control; Intelligent Integrated Health Management for a System of Systems; Delay Banking for Managing Air Traffic; and Spline

  12. NASA Tech Briefs, August 2008 (United States)


    Customizable Digital Receivers for Radar Two-Camera Acquisition and Tracking of a Flying Target Visual Data Analysis for Satellites A Data Type for Efficient Representation of Other Data Types Hand-Held Ultrasonic Instrument for Reading Matrix Symbols Broadband Microstrip-to-Coplanar Strip Double-Y Balun A Topographical Lidar System for Terrain-Relative Navigation Programmable Low-Voltage Circuit Breaker and Tester Electronic Switch Arrays for Managing Microbattery Arrays Topics covered include: Lower-Dark-Current, Higher-Blue-Response CMOS Imagers; Fabricating Large-Area Sheets of Single-Layer Graphene by CVD; Support for Diagnosis of Custom Computer Hardware; Providing Goal-Based Autonomy for Commanding a Spacecraft; Dynamic Method for Identifying Collected Sample Mass; Optimal Planning and Problem-Solving; Attitude-Control Algorithm for Minimizing Maneuver Execution Errors; Grants Document-Generation System; Heat-Storage Modules Containing LiNO3 3H2O and Graphite Foam; Precipitation-Strengthened, High-Temperature, High-Force Shape Memory Alloys; Improved Relief Valve Would Be Less Susceptible to Failure; Safety Modification of Cam-and-Groove Hose Coupling; Using Composite Materials in a Cryogenic Pump; Using Electronic Noses to Detect Tumors During Neurosurgery; Producing Newborn Synchronous Mammalian Cells; Smaller, Lower-Power Fast-Neutron Scintillation Detectors; Rotationally Vibrating Electric-Field Mill; Estimating Hardness from the USDC Tool-Bit Temperature Rise; Particle-Charge Spectrometer; Automated Production of Movies on a Cluster of Computers; FIDO-Class Development Rover; and Tone-Based Command of Deep Space Probes Using Ground Antennas.

  13. NASA Tech Briefs, November 2004 (United States)


    Topics include: Multifunction Imaging and Spectroscopic Instrument; Position-Finding Instrument Built Around a Magnetometer; Improved Measurement of Dispersion in an Optical Fiber; Probe for Sampling of Interstitial Fluid From Bone; Neuropsychological Testing of Astronauts; Method of Calibration for a Large Cathetometer System; Four-Channel PC/104 MIL-STD-1553 Circuit Board; Improved Method of Locating Defects in Wiring Insulation; Strobe Traffic Lights Warn of Approaching Emergency Vehicles; Improved Timing Scheme for Spaceborne Precipitation Radar; Concept for Multiple-Access Free-Space Laser Communications; Variable Shadow Screens for Imaging Optical Devices; Verifying Diagnostic Software; Initial Processing of Infrared Spectral Data; Activity-Centric Approach to Distributed Programming; Controlling Distributed Planning; New Material for Surface-Enhanced Raman Spectroscopy; Treated Carbon Nanofibers for Storing Energy in Aqueous KOH; Advanced Infant Car Seat Would Increase Highway Safety; Development of Biomorphic Flyers; Second-Generation Six-Limbed Experimental Robot; Miniature Linear Actuator for Small Spacecraft; Process for Making Single-Domain Magnetite Crystals; A New Process for Fabricating Random Silicon Nanotips; Resin-Transfer-Molding of a Tool Face; Improved Phase-Mask Fabrication of Fiber Bragg Gratings; Tool for Insertion of a Fiber-Optic Terminus in a Connector; Nanofluidic Size-Exclusion Chromatograph; Lightweight, Low-CTE Tubes Made From Biaxially Oriented LCPs; Using Redundancy To Reduce Errors in Magnetometer Readings; Compact Instrument for Measuring Profile of a Light Beam; Multilayer Dielectric Transmissive Optical Phase Modulator; Second-Generation Multi-Angle Imaging Spectroradiometer; Real-Time Adaptive Color Segmentation by Neural Networks; Research and Development in Optical Communications; Tests of Multibeam Scintillation Mitigation on Laser Uplinks; and Spaceborne Infrared Atmospheric Sounder.

  14. Citizens Science for Sustainability (SuScit) Project Briefing

    DEFF Research Database (Denmark)

    Eames, Malcolm; Mortensen, Jonas Egmose; Adebowale, Maria;

    This project briefing gives a short overview of the Citizens Science for Sustainability (SuScit) Project.......This project briefing gives a short overview of the Citizens Science for Sustainability (SuScit) Project....

  15. ETV Tech Brief: Rapid Fungi and Bacteria Detection Technologies (United States)

    Technical brief that summarizes the results for Mycometer, Inc. Mycometer®-test and Bactiquant®-test, which are rapid detection technologies for fungi and bacteria. The brief summarizes the results of the verification report and statement.

  16. A two-dimensional finite element method to calculate the AC loss in superconducting cables, wires and coated conductors

    International Nuclear Information System (INIS)

    In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB2 wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB2 wires. The results demonstrate that the multi-element MgB2 wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement

  17. A two-dimensional finite element method to calculate the AC loss in superconducting cables, wires and coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Z; Jiang, Y; Pei, R; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, CB2 1PZ (United Kingdom); Ye, L [Department of Electrical Power Engineering, CAU, P. O. Box 210, Beijing 100083 (China); Campbell, A M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, CB3 0HE (United Kingdom)], E-mail:


    In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB{sub 2} wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB{sub 2} wires. The results demonstrate that the multi-element MgB{sub 2} wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement.

  18. NASA Tech Briefs, October 2010 (United States)


    Topics covered include: Hybrid Architecture Active Wavefront Sensing and Control; Carbon-Nanotube-Based Chemical Gas Sensor; Aerogel-Positronium Technology for the Detection of Small Quantities of Organic and/or Toxic Materials; Graphene-Based Reversible Nano-Switch/Sensor Schottky Diode; Inductive Non-Contact Position Sensor; High-Temperature Surface-Acoustic-Wave Transducer; Grid-Sphere Electrodes for Contact with Ionospheric Plasma; Enabling IP Header Compression in COTS Routers via Frame Relay on a Simplex Link; Ka-Band SiGe Receiver Front-End MMIC for Transponder Applications; Robust Optimization Design Algorithm for High-Frequency TWTs; Optimal and Local Connectivity Between Neuron and Synapse Array in the Quantum Dot/Silicon Brain; Method and Circuit for In-Situ Health Monitoring of Solar Cells in Space; BGen: A UML Behavior Network Generator Tool; Platform for Post-Processing Waveform-Based NDE; Electrochemical Hydrogen Peroxide Generator; Fabrication of Single, Vertically Aligned Carbon Nanotubes in 3D Nanoscale Architectures; Process to Create High-Fidelity Lunar Dust Simulants; Lithium-Ion Electrolytes Containing Phosphorous-Based, Flame-Retardant Additives; InGaP Heterojunction Barrier Solar Cells; Straight-Pore Microfilter with Efficient Regeneration; Determining Shear Stress Distribution in a Laminate; Self-Adjusting Liquid Injectors for Combustors; Handling Qualities Prediction of an F-16XL-Based Reduced Sonic Boom Aircraft; Tele-Robotic ATHLETE Controller for Kinematics - TRACK; Three-Wheel Brush-Wheel Sampler; Heterodyne Interferometer Angle Metrology; Aligning Astronomical Telescopes via Identification of Stars; Generation of Optical Combs in a WGM Resonator from a Bichromatic Pump; Large-Format AlGaN PIN Photodiode Arrays for UV Images; Fiber-Coupled Planar Light-Wave Circuit for Seed Laser Control in High Spectral Resolution Lidar Systems; On Calculating the Zero-Gravity Surface Figure of a Mirror; Optical Modification of Casimir Forces for

  19. NASA Tech Briefs, September 2007 (United States)


    Topics covered include; Rapid Fabrication of Carbide Matrix/Carbon Fiber Composites; Coating Thermoelectric Devices To Suppress Sublimation; Ultrahigh-Temperature Ceramics; Improved C/SiC Ceramic Composites Made Using PIP; Coating Carbon Fibers With Platinum; Two-Band, Low-Loss Microwave Window; MCM Polarimetric Radiometers for Planar Arrays; Aperture-Coupled Thin-Membrane L-Band Antenna; WGM-Based Photonic Local Oscillators and Modulators; Focal-Plane Arrays of Quantum-Dot Infrared Photodetectors; Laser Range and Bearing Finder With No Moving Parts; Microrectenna: A Terahertz Antenna and Rectifier on a Chip; Miniature L-Band Radar Transceiver; Robotic Vision-Based Localization in an Urban Environment; Programs for Testing an SSME-Monitoring System; Cathodoluminescent Source of Intense White Light; Displaying and Analyzing Antenna Radiation Patterns; Payload Operations Support Team Tools; Space-Shuttle Emulator Software; Soft Real-Time PID Control on a VME Computer; Analyzing Radio-Frequency Coverage for the ISS; Nanorod-Based Fast-Response Pressure-Sensitive Paints; Capacitors Would Help Protect Against Hypervelocity Impacts; Diaphragm Pump With Resonant Piezoelectric Drive; Improved Quick-Release Pin Mechanism; Designing Rolling-Element Bearings; Reverse-Tangent Injection in a Centrifugal Compressor; Inertial Measurements for Aero-assisted Navigation (IMAN); Analysis of Complex Valve and Feed Systems; Improved Path Planning Onboard the Mars Exploration Rovers; Robust, Flexible Motion Control for the Mars Explorer Rovers; Solar Sail Spaceflight Simulation; Fluorine-Based DRIE of Fused Silica; Mechanical Alloying for Making Thermoelectric Compounds; Process for High-Rate Fabrication of Alumina Nanotemplates; Electroform/Plasma-Spray Laminates for X-Ray Optics; An Automated Flying-Insect Detection System; Calligraphic Poling of Ferroelectric Material; Blackbody Cavity for Calibrations at 200 to 273 K; KML Super Overlay to WMS Translator; High-Performance Tiled WMS

  20. NASA Tech Briefs, September 2012 (United States)


    Topics covered include: Beat-to-Beat Blood Pressure Monitor; Measurement Techniques for Clock Jitter; Lightweight, Miniature Inertial Measurement System; Optical Density Analysis of X-Rays Utilizing Calibration Tooling to Estimate Thickness of Parts; Fuel Cell/Electrochemical Cell Voltage Monitor; Anomaly Detection Techniques with Real Test Data from a Spinning Turbine Engine-Like Rotor; Measuring Air Leaks into the Vacuum Space of Large Liquid Hydrogen Tanks; Antenna Calibration and Measurement Equipment; Glass Solder Approach for Robust, Low-Loss, Fiber-to-Waveguide Coupling; Lightweight Metal Matrix Composite Segmented for Manufacturing High-Precision Mirrors; Plasma Treatment to Remove Carbon from Indium UV Filters; Telerobotics Workstation (TRWS) for Deep Space Habitats; Single-Pole Double-Throw MMIC Switches for a Microwave Radiometer; On Shaft Data Acquisition System (OSDAS); ASIC Readout Circuit Architecture for Large Geiger Photodiode Arrays; Flexible Architecture for FPGAs in Embedded Systems; Polyurea-Based Aerogel Monoliths and Composites; Resin-Impregnated Carbon Ablator: A New Ablative Material for Hyperbolic Entry Speeds; Self-Cleaning Particulate Prefilter Media; Modular, Rapid Propellant Loading System/Cryogenic Testbed; Compact, Low-Force, Low-Noise Linear Actuator; Loop Heat Pipe with Thermal Control Valve as a Variable Thermal Link; Process for Measuring Over-Center Distances; Hands-Free Transcranial Color Doppler Probe; Improving Balance Function Using Low Levels of Electrical Stimulation of the Balance Organs; Developing Physiologic Models for Emergency Medical Procedures Under Microgravity; PMA-Linked Fluorescence for Rapid Detection of Viable Bacterial Endospores; Portable Intravenous Fluid Production Device for Ground Use; Adaptation of a Filter Assembly to Assess Microbial Bioburden of Pressurant Within a Propulsion System; Multiplexed Force and Deflection Sensing Shell Membranes for Robotic Manipulators; Whispering Gallery Mode

  1. NASA Tech Briefs, March 2012 (United States)


    The topics include: 1) Spectral Profiler Probe for In Situ Snow Grain Size and Composition Stratigraphy; 2) Portable Fourier Transform Spectroscopy for Analysis of Surface Contamination and Quality Control; 3) In Situ Geochemical Analysis and Age Dating of Rocks Using Laser Ablation-Miniature Mass Spectrometer; 4) Physics Mining of Multi-Source Data Sets; 5) Photogrammetry Tool for Forensic Analysis; 6) Connect Global Positioning System RF Module; 7) Simple Cell Balance Circuit; 8) Miniature EVA Software Defined Radio; 9) Remotely Accessible Testbed for Software Defined Radio Development; 10) System-of-Systems Technology-Portfolio-Analysis Tool; 11) VESGEN Software for Mapping and Quantification of Vascular Regulators; 12) Constructing a Database From Multiple 2D Images for Camera Pose Estimation and Robot Localization; 13) Adaption of G-TAG Software for Validating Touch and Go Asteroid Sample Return Design Methodology; 14) 3D Visualization for Phoenix Mars Lander Science Operations; 15) RxGen General Optical Model Prescription Generator; 16) Carbon Nanotube Bonding Strength Enhancement Using Metal Wicking Process; 17) Multi-Layer Far-Infrared Component Technology; 18) Germanium Lift-Off Masks for Thin Metal Film Patterning; 19) Sealing Materials for Use in Vacuum at High Temperatures; 20) Radiation Shielding System Using a Composite of Carbon Nanotubes Loaded With Electropolymers; 21) Nano Sponges for Drug Delivery and Medicinal Applications; 22) Molecular Technique to Understand Deep Microbial Diversity; 23) Methods and Compositions Based on Culturing Microorganisms in Low Sedimental Fluid Shear Conditions; 24) Secure Peer-to-Peer Networks for Scientific Information Sharing; 25) Multiplexer/Demultiplexer Loading Tool (MDMLT); 26) High-Rate Data-Capture for an Airborne Lidar System; 27) Wavefront Sensing Analysis of Grazing Incidence Optical Systems; 28) Foam-on-Tile Damage Model; 29) Instrument Package Manipulation Through the Generation and Use of an Attenuated

  2. NASA Tech Briefs, November 2010 (United States)


    Topics covered include: Portable Handheld Optical Window Inspection Device; Salience Assignment for Multiple-Instance Data and Its Application to Crop Yield Prediction; Speech Acquisition and Automatic Speech Recognition for Integrated Spacesuit Audio Systems ; Predicting Long-Range Traversability from Short-Range Stereo-Derived Geometry; Browser-Based Application for Telemetry Monitoring of Robotic Assets; Miniature Low-Noise G-Band I-Q Receiver; Methods of Using a Magnetic Field Response Sensor Within Closed, Electrically Conductive Containers; Differential Resonant Ring YIG Tuned Oscillator; Microfabricated Segmented-Involute-Foil Regenerator for Stirling Engines; Reducing Seal Adhesion in Low Impact Docking Systems; Optimal Flow Control Design; Corrosion-Resistant Container for Molten-Material Processing; Reusable Hot-Wire Cable Cutter; Deployment of a Curved Truss; High-Volume Airborne Fluids Handling Technologies to Fight Wildfires; Modeling of Alkane Oxidation Using Constituents and Species; Fabrication of Lanthanum Telluride 14-1-11 Zintl High-Temperature Thermoelectric Couple; A Computer Model for Analyzing Volatile Removal Assembly; Analysis of Nozzle Jet Plume Effects on Sonic Boom Signature; Optical Sidebands Multiplier; Single Spatial-Mode Room-Temperature-Operated 3.0 to 3.4 micrometer Diode Lasers; Self-Nulling Beam Combiner Using No External Phase Inverter; Portable Dew Point Mass Spectrometry System for Real-Time Gas and Moisture Analysis; Maximum Likelihood Time-of-Arrival Estimation of Optical Pulses via Photon-Counting Photodetectors; Handheld White Light Interferometer for Measuring Defect Depth in Windows; Decomposition Algorithm for Global Reachability on a Time-Varying Graph; Autonomous GN and C for Spacecraft Exploration of Comets and Asteroids; Efficient Web Services Policy Combination; Using CTX Image Features to Predict HiRISE-Equivalent Rock Density; Isolation of the Paenibacillus phoenicis, a Spore-Forming Bacterium; Monolithically

  3. NASA Tech Briefs, July 2009 (United States)


    Topics covered include: Dual Cryogenic Capacitive Density Sensor; Hail Monitor Sensor; Miniature Six-Axis Load Sensor for Robotic Fingertip; Improved Blackbody Temperature Sensors for a Vacuum Furnace; Wrap-Around Out-the-Window Sensor Fusion System; Wide-Range Temperature Sensors with High-Level Pulse Train Output; Terminal Descent Sensor Simulation; A Robust Mechanical Sensing System for Unmanned Sea Surface Vehicles; Additive for Low-Temperature Operation of Li-(CF)n Cells; Li/CFx Cells Optimized for Low-Temperature Operation; Number Codes Readable by Magnetic-Field-Response Recorders; Determining Locations by Use of Networks of Passive Beacons; Superconducting Hot-Electron Submillimeter-Wave Detector; Large-Aperture Membrane Active Phased-Array Antennas; Optical Injection Locking of a VCSEL in an OEO; Measuring Multiple Resistances Using Single-Point Excitation; Improved-Bandwidth Transimpedance Amplifier; Inter-Symbol Guard Time for Synchronizing Optical PPM; Novel Materials Containing Single-Wall Carbon Nanotubes Wrapped in Polymer Molecules; Light-Curing Adhesive Repair Tapes; Thin-Film Solid Oxide Fuel Cells; Zinc Alloys for the Fabrication of Semiconductor Devices; Small, Lightweight, Collapsible Glove Box; Radial Halbach Magnetic Bearings; Aerial Deployment and Inflation System for Mars Helium Balloons; Steel Primer Chamber Assemblies for Dual Initiated Pyrovalves; Voice Coil Percussive Mechanism Concept for Hammer Drill; Inherently Ducted Propfans and Bi-Props; Silicon Nanowire Growth at Chosen Positions and Orientations; Detecting Airborne Mercury by Use of Gold Nanowires; Detecting Airborne Mercury by Use of Palladium Chloride; Micro Electron MicroProbe and Sample Analyzer; Nanowire Electron Scattering Spectroscopy; Electron-Spin Filters Would Offer Spin Polarization Greater than 1; Subcritical-Water Extraction of Organics from Solid Matrices; A Model for Predicting Thermoelectric Properties of Bi2Te3; Integrated Miniature Arrays of Optical Biomolecule

  4. NASA Tech Briefs, Februrary 2013 (United States)


    Topics covered include: Measurements of Ultra-Stable Oscillator (USO) Allan Deviations in Space; Gaseous Nitrogen Orifice Mass Flow Calculator; Validation of Proposed Metrics for Two-Body Abrasion Scratch Test Analysis Standards; Rover Low Gain Antenna Qualification for Deep Space Thermal Environments; Automated, Ultra-Sterile Solid Sample Handling and Analysis on a Chip; Measuring and Estimating Normalized Contrast in Infrared Flash Thermography; Spectrally and Radiometrically Stable, Wideband, Onboard Calibration Source; High-Reliability Waveguide Vacuum/Pressure Window; Methods of Fabricating Scintillators With Radioisotopes for Beta Battery Applications; Magnetic Shield for Adiabatic Demagnetization Refrigerators (ADR); CMOS-Compatible SOI MESFETS for Radiation-Hardened DC-to-DC Converters; Silicon Heat Pipe Array; Adaptive Phase Delay Generator; High-Temperature, Lightweight, Self-Healing Ceramic Composites for Aircraft Engine Applications; Treatment to Control Adhesion of Silicone-Based Elastomers; High-Temperature Adhesives for Thermally Stable Aero-Assist Technologies; Rockballer Sample Acquisition Tool; Rock Gripper for Sampling, Mobility, Anchoring, and Manipulation; Advanced Magnetic Materials Methods and Numerical Models for Fluidization in Microgravity and Hypogravity; Data Transfer for Multiple Sensor Networks Over a Broad Temperature Range; Using Combustion Synthesis to Reinforce Berms and Other Regolith Structures; Visible-Infrared Hyperspectral Image Projector; Three-Axis Attitude Estimation With a High-Bandwidth Angular Rate Sensor Change_Detection.m; AGATE: Adversarial Game Analysis for Tactical Evaluation; Ionospheric Simulation System for Satellite Observations and Global Assimilative; Modeling Experiments (ISOGAME); An Extensible, User- Modifiable Framework for Planning Activities; Mission Operations Center (MOC) - Precipitation Processing System (PPS) Interface Software System (MPISS); Automated 3D Damaged Cavity Model Builder for Lower

  5. NASA Tech Briefs, March 2010 (United States)


    Topics covered include: Software Tool Integrating Data Flow Diagrams and Petri Nets; Adaptive Nulling for Interferometric Detection of Planets; Reducing the Volume of NASA Earth-Science Data; Reception of Multiple Telemetry Signals via One Dish Antenna; Space-Qualified Traveling-Wave Tube; Smart Power Supply for Battery-Powered Systems; Parallel Processing of Broad-Band PPM Signals; Inexpensive Implementation of Many Strain Gauges; Constant-Differential-Pressure Two-Fluid Accumulator; Inflatable Tubular Structures Rigidized with Foams; Power Generator with Thermo-Differential Modules; Mechanical Extraction of Power From Ocean Currents and Tides; Nitrous Oxide/Paraffin Hybrid Rocket Engines; Optimized Li-Ion Electrolytes Containing Fluorinated Ester Co-Solvents; Probabilistic Multi-Factor Interaction Model for Complex Material Behavior; Foldable Instrumented Bits for Ultrasonic/Sonic Penetrators; Compact Rare Earth Emitter Hollow Cathode; High-Precision Shape Control of In-Space Deployable Large Membrane/Thin-Shell Reflectors; Rapid Active Sampling Package; Miniature Lightweight Ion Pump; Cryogenic Transport of High-Pressure-System Recharge Gas; Water-Vapor Raman Lidar System Reaches Higher Altitude; Compact Ku-Band T/R Module for High-Resolution Radar Imaging of Cold Land Processes; Wide-Field-of-View, High-Resolution, Stereoscopic Imager; Electrical Capacitance Volume Tomography with High-Contrast Dielectrics; Wavefront Control and Image Restoration with Less Computing; Polarization Imaging Apparatus; Stereoscopic Machine-Vision System Using Projected Circles; Metal Vapor Arcing Risk Assessment Tool; Performance Bounds on Two Concatenated, Interleaved Codes; Parameterizing Coefficients of a POD-Based Dynamical System; Confidence-Based Feature Acquisition; Algorithm for Lossless Compression of Calibrated Hyperspectral Imagery; Universal Decoder for PPM of any Order; Algorithm for Stabilizing a POD-Based Dynamical System; Mission Reliability Estimation for

  6. NASA Tech Briefs, December 2008 (United States)


    Topics covered include: Crew Activity Analyzer; Distributing Data to Hand-Held Devices in a Wireless Network; Reducing Surface Clutter in Cloud Profiling Radar Data; MODIS Atmospheric Data Handler; Multibeam Altimeter Navigation Update Using Faceted Shape Model; Spaceborne Hybrid-FPGA System for Processing FTIR Data; FPGA Coprocessor for Accelerated Classification of Images; SiC JFET Transistor Circuit Model for Extreme Temperature Range; TDR Using Autocorrelation and Varying-Duration Pulses; Update on Development of SiC Multi-Chip Power Modules; Radio Ranging System for Guidance of Approaching Spacecraft; Electromagnetically Clean Solar Arrays; Improved Short-Circuit Protection for Power Cells in Series; Electromagnetically Clean Solar Arrays; Logic Gates Made of N-Channel JFETs and Epitaxial Resistors; Improved Short-Circuit Protection for Power Cells in Series; Communication Limits Due to Photon-Detector Jitter; System for Removing Pollutants from Incinerator Exhaust; Sealing and External Sterilization of a Sample Container; Converting EOS Data from HDF-EOS to netCDF; HDF-EOS 2 and HDF-EOS 5 Compatibility Library; HDF-EOS Web Server; HDF-EOS 5 Validator; XML DTD and Schemas for HDF-EOS; Converting from XML to HDF-EOS; Simulating Attitudes and Trajectories of Multiple Spacecraft; Specialized Color Function for Display of Signed Data; Delivering Alert Messages to Members of a Work Force; Delivering Images for Mars Rover Science Planning; Oxide Fiber Cathode Materials for Rechargeable Lithium Cells; Electrocatalytic Reduction of Carbon Dioxide to Methane; Heterogeneous Superconducting Low-Noise Sensing Coils; Progress toward Making Epoxy/Carbon-Nanotube Composites; Predicting Properties of Unidirectional-Nanofiber Composites; Deployable Crew Quarters; Nonventing, Regenerable, Lightweight Heat Absorber; Miniature High-Force, Long-Stroke SMA Linear Actuators; "Bootstrap" Configuration for Multistage Pulse-Tube Coolers; Reducing Liquid Loss during Ullage Venting in

  7. AC Electrochemical Deposition of CdS Nanowire Arrays

    Institute of Scientific and Technical Information of China (English)

    QIN; DongHuan


    Since the successful growth of carbon nanotubes, one-dimensional materials have been a focused research field both because of their fundamental importance and the wide-ranging potential applications in nano devices. Many approaches are used to fabricate nanowires, such as crystal growth. In order to obtain nanowires whose growth is more easily controlled, electrochemical synthesis in a template is taken as one of the most efficient methods. To date, Co, Fe, Ni, CuCo1-3 and other nanowire arrays have been fabricated successfully by electrodepositing corresponding metal ion into the porous aluminum oxide (PAO) membrane or other non-magnetic materials. Cadmium sulfide(CdS), as one of the most important semiconductor material, is a n-type semiconductor. The ability to fine tune their fundamental electronic and optical properties by simply varying the cruster size, rather than composition, makes them highly attractive for a variety of possible application. In this paper, we report our work of fabricating CdS nanowire arrays based on AC electrolysis into the pores of an anodic aluminum oxide(AAO), the structure and morphology were characterized by XRD and TEM.  ……

  8. AC Electrochemical Deposition of CdS Nanowire Arrays

    Institute of Scientific and Technical Information of China (English)

    QIN DongHuan; LI HuLin


    @@ Since the successful growth of carbon nanotubes, one-dimensional materials have been a focused research field both because of their fundamental importance and the wide-ranging potential applications in nano devices. Many approaches are used to fabricate nanowires, such as crystal growth. In order to obtain nanowires whose growth is more easily controlled, electrochemical synthesis in a template is taken as one of the most efficient methods. To date, Co, Fe, Ni, CuCo1-3 and other nanowire arrays have been fabricated successfully by electrodepositing corresponding metal ion into the porous aluminum oxide (PAO) membrane or other non-magnetic materials. Cadmium sulfide(CdS), as one of the most important semiconductor material, is a n-type semiconductor. The ability to fine tune their fundamental electronic and optical properties by simply varying the cruster size, rather than composition, makes them highly attractive for a variety of possible application. In this paper, we report our work of fabricating CdS nanowire arrays based on AC electrolysis into the pores of an anodic aluminum oxide(AAO), the structure and morphology were characterized by XRD and TEM.

  9. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar


    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  10. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application


    Oliveira, J. G.; Schettino, H.; Gama, V; Carvalho, R.; H. Bernhoff


    An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel...



    Sorrentino, Vincenzo


    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  12. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credit s ] BLAST Search Image Search Home About Archive Update History Contact us AcEST AcEST C ... Data acquisit ion method - Data analysis method - Number of data ... entries 4,298 entries Data it em Description Contig ID ID of contig sequence of A ... ris Number of clones The number of EST clones constit uting the contig sequence of Adiantum capillus-vene ... ris Definit ion Definit ion Link to clone list In the TogoDB edi ...

  13. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications


    Vuorsalo, Simo


    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  14. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;


    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  15. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;


    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is...

  16. Summary of the ACS symposium on Advances in Food Allergen Detection. (United States)

    Ross, Mark M; Jackson, Lauren


    A symposium titled "Advances in Food Allergen Detection" was held at the 243rd National Meeting of the American Chemical Society (ACS) in March 2012 in San Diego, CA, and was sponsored by the ACS Division of Agricultural and Food Chemistry. The purpose of the symposium was to convene the leaders in the food allergen analysis field for presentations on, and discussions of, the state of the art, new developments, and critical challenges in the detection and quantitation of allergenic proteins in foods. Twenty-five presentations were delivered by speakers representing academic, government, and industrial institutions in 10 countries. The presentations covered all aspects of food allergens, including a historical progress review, regulatory policies, clinical practices, food-processing effects, food production equipment cross-contamination and cleaning, and the performance of several food allergen analytical strategies and technologies. This paper is intended to provide a brief summary of the presentations as well as a record of the proceedings of the symposium, which was deemed a great success in advancing food allergen analysis. PMID:23167825

  17. 14 CFR 135.117 - Briefing of passengers before flight. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Briefing of passengers before flight. 135... Flight Operations § 135.117 Briefing of passengers before flight. (a) Before each takeoff each pilot in... briefing shall include a statement that the Federal Aviation Regulations require passenger compliance...

  18. 14 CFR 141.43 - Pilot briefing areas. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot briefing areas. 141.43 Section 141.43... Pilot briefing areas. (a) An applicant for a pilot school certificate or provisional pilot school certificate must show that the applicant has continuous use of a briefing area located at each airport...

  19. 14 CFR 125.327 - Briefing of passengers before flight. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Briefing of passengers before flight. 125... § 125.327 Briefing of passengers before flight. (a) Before each takeoff, each pilot in command of an... briefing shall include a statement that the Federal Aviation Regulations require passenger compliance...

  20. 14 CFR 121.573 - Briefing passengers: Extended overwater operations. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Briefing passengers: Extended overwater... OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Flight Operations § 121.573 Briefing passengers: Extended overwater operations. (a) In addition to the oral briefing required by §...

  1. On the Integration of Science and Practice in Brief Psychotherapy. (United States)

    May, Robert


    Responds to previous article by Steenbarger on science-practice integration in brief counseling and therapy. Focuses specifically on the integration of science and practice in brief psychotherapy. Elaborates on agreements and disagreements concerning Steenbarger's analysis of brief psychotherapy. Muses over what is lost as well as gained in brief…

  2. Solution-Focused Brief Therapy: Helpful Interventions for School Counselors. (United States)

    Bonnington, Stuart B.


    Notes that school counselors have routinely practiced brief forms of counseling. Contends that solution-focused brief therapy offers counselors numerous straight forward interventions that can help counselors focus on clients' strengths to find meaningful solutions to problems. Presents solution-focused brief therapy framework and identifies tasks…

  3. Disorders of Accommodative Convergation and Accommodation (AC/A) Relations at Traumatic Brain Injury


    Serdarevic, Raif


    Introduction: Accommodative Convergence/Accommodation (AC/A) ratio is constant at one and the same person in the course of life, i.e. the same ratio accommodative convergence monitor any change in accommodation measured in diopters. Such a perfect relationship is possible if there are no refractive anomalies in both eyes and oculomotor imbalance of eye muscles. Material and methods: We are examined 50 patients with close brain injury, and patients which had problems with near vision, accommod...

  4. SSNTD applications in science and technology - A brief review

    CERN Document Server

    Khan, H A


    The technique of Solid State Nuclear Track Detection (SSNTD) has matured since long as a viable method of charged particle detection. The usage of this method has been successfully extended to neutron detection and gamma dose measurements as well. The etch-track mechanism has been further exploited to generate a major application area of nuclear track filters. In spite of the remarkable diversity of SSNTD applications that have emerged over the years in different fields, its potential is by no means saturated. In this article, a brief review of SSNTD applications is presented with reference to contemporary interests in science and technology. For convenience, the coverage of topics is organized under broad categories of Nuclear Physics, Materials Research, Geology, Environmental Science and allied technologies. While identifying high interest areas, those with limited but innovative applications are also mentioned. In some cases, the important results are quoted for the purpose of illustrating the strength of...

  5. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  6. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  7. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica


    Ranz Guerra, Carlos; Cobo, Pedro


    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  8. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)



    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  9. Mapa acústico parcial de Benetusser




    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  10. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  11. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash


    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  12. Cosmology today-A brief review

    CERN Document Server

    Cervantes-Cota, Jorge L


    This is a brief review of the standard model of cosmology. We first introduce the FRW models and their flat solutions for energy fluids playing an important role in the dynamics at different epochs. We then introduce different cosmological lengths and some of their applications. The later part is dedicated to the physical processes and concepts necessary to understand the early and very early Universe and observations of it.

  13. A (Very) Brief History of Artificial Intelligence


    Buchanan, Bruce G.


    In this brief history, the beginnings of artificial intelligence are traced to philosophy, fiction, and imagination. Early inventions in electronics, engineering, and many other disciplines have influenced AI. Some early milestones include work in problems solving which included basic work in learning, knowledge representation, and inference as well as demonstration programs in language understanding, translation, theorem proving, associative memory, and knowledge-based systems. The article e...

  14. Interviewing: Methodological Briefs - Impact Evaluation No. 12


    Patricia Rogers; Bronwen McDonald


    Interviews are easy to do badly and hard to do well - good planning, adequate time and appropriate skills are required. The type of interview should be carefully chosen to suit the situation rather than choosing a type of interview (such as focus groups) simply because it is commonly used. Interviews with children raise particular ethical issues that need to be carefully considered and fully addressed. This brief outlines key issues to consider in planning interviews for impact evaluation, ta...

  15. Estudio acústico del Conservatorio de Piles




    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  16. AC Own Motion Percentage of Randomly Sampled Cases (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  17. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad


    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  18. Study of AC electrical conduction mechanisms in an epoxy polymer (United States)

    Jilani, Wissal; Mzabi, Nissaf; Gallot-Lavallée, Olivier; Fourati, Najla; Zerrouki, Chouki; Zerrouki, Rachida; Guermazi, Hajer


    The AC conductivity of an epoxy resin was investigated in the frequency range 10^{-1} - 106 Hz at temperatures ranging from -100 to 120 °C. The frequency dependence of σ_{ac} was described by the law: σ_{ac}=ω \\varepsilon0\\varepsilon^''_{HN}+Aωs. The study of temperature variation of the exponent (s) reveals two conduction models: the AC conduction dependence upon temperature is governed by the small polaron tunneling mechanism (SPTM) at low temperature (-100 -60 °C) and the correlated barrier hopping (CHB) model at high temperature (80-120 °C).

  19. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)


    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  20. An improved AC-amplifier for electrophysiology

    Directory of Open Access Journals (Sweden)

    Jorgovanović Nikola


    Full Text Available We present the design, simulation and test results of a new AC amplifier for electrophysiological measurements based on a three op-amp instrumentation amplifier (IA. The design target was to increase the common mode rejection ratio (CMRR, thereby improving the quality of the recorded physiological signals in a noisy environment. The new amplifier actively suppresses the DC component of the differential signal and actively reduces the common mode signal in the first stage of the IA. These functions increase the dynamic range of the amplifier's first stage of the differential signal. The next step was the realization of the amplifier in a single chip technology. The design and tests of the new AC amplifier with a differential gain of 79.2 dB, a CMRR of 130 dB at 50 Hz, a high-pass cutoff frequency at 0.01 Hz and common mode reduction in the first stage of the 49.8 dB are presented in this paper.

  1. Synchrotron radiation in material science

    International Nuclear Information System (INIS)

    A brief review on the several experimental techniques (XRD, SAXS, EXAFS, IRRS, etc...) which, utilizing of synchrotron radiation can be applied in glass structural studies, is presented. The major part of these techniques can be also used for studies of other materials such as polymers, metals, etc... (L.C.)

  2. AC Electric Field Activated Shape Memory Polymer Composite (United States)

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.


    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  3. Comparison between AC and MFDC resistance spot welding by using high speed filming

    Directory of Open Access Journals (Sweden)

    S.C.A. Alfaro


    Full Text Available Purpose: In this work it will be carried through the filming of the formation and growth of the nugget in resistance spot welding executed in AC and MF. A comparison for same times in both the processes will be carried through to verify which of the used processes offers better conditions, control and results as well as will help for one better understanding of the process aiming at the otimização.Design/methodology/approach: Two different spot welding machine (AC and MF-DC had been used, and a digital high-speed camera. The weld points had been carried through in 3 galvanized steel different plate configurations. The electrodes had been truncated to obtain one better visualization for the weld nugget formation. The comparison of the formation and development between the weld point of each process (AC and MF is shown in 7 pictures in the same values of time.Findings: For currents below 2 kA, no nugget was observed. and the formation of same after 10º cycle for bigger current of 3 kA. The MF-DC welding offers the possibility of obtaining nuggets more uniforms within shorter times (depending on the plate configuration.Research limitations/implications: In this work the AC machine is limited by the values of current of welding and pressure of the electrodes: (2 - 6 kA e (87 - 261 kgf respectively. Other materials: aluminum, stainless steel or material exactly dissimilar could be used following the line of this research. Bigger currents levels can also be used.Originality/value: The idea to compare resulted for the same process of welding under different conditions (equipment, materials and or parameters makes possible the choice of these better conditions used to the otimização of the process.

  4. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  5. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub


    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  6. Materials and nanotechnology

    International Nuclear Information System (INIS)

    The focus of the Materials and Nanotechnology Program is technology development related to processing, analysis, testing and characterization of materials in general. These are achieved through execution of R&D projects in engineering and materials science, cooperative projects with private and public sector companies, universities and other research institutes. Besides technology development, this Program also fosters training and human resource development in association with the University of São Paulo and many industrial sectors. This Program is divided into sub-programs in broad areas such as ceramic, composite and metallic materials as well as characterization of physical and chemical properties of materials. The sub-programs are further divided into general topics and within each topic, R&D projects. A brief description of progress in each topic during the last three years follows. (author)

  7. [Intestinal occlusion and abdominal compartment syndrome (ACS)]. (United States)

    Stagnitti, Franco


    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  8. An evaluation of the Panasonic model UD513AC-1 Thermoluminescence Dosimetry system

    International Nuclear Information System (INIS)

    An evaluation of the Panasonic UD513AC-1 Thermoluminescence Dosimetry system was performed to determine the system's capabilities as a general purpose thermoluminescence dosimeter measuring device. The tests that were performed included a critique of the user's manual, delimitation of the operating parameters, the quality of construction, and an evaluation of the features that were unique to this system. The UD513AC-1 was found to be an adequate measuring device for most dosimetric applications. It was not well suited for experimental work with thermoluminescence materials due to a low sensitivity displayed by the photomultiplier tube to commonly used materials. The system was well constructed and did not suffer hardware failure during this research. Major attributes of the UD513AC-1 were automatic data storage, highly reproducible heating ramps, an excellent infrared light filter and a unique feature to a single phosphor unit, a dose determination function. Negative aspects of the system included a limited data manipulation capability within the controlling program, a poorly written user's manual, inadequate sensitivity on the part of the photomultiplier tube, and insufficient capability to adjust the hot N2 gas flow to desired levels

  9. A brief review of atomic layer deposition: from fundamentals to applications


    Johnson, Richard W.; Adam Hultqvist; Bent, Stacey F.


    Atomic layer deposition (ALD) is a vapor phase technique capable of producing thin films of a variety of materials. Based on sequential, self-limiting reactions, ALD offers exceptional conformality on high-aspect ratio structures, thickness control at the Angstrom level, and tunable film composition. With these advantages, ALD has emerged as a powerful tool for many industrial and research applications. In this review, we provide a brief introduction to ALD and highlight select applications, ...

  10. A brief overview on the retrofitting possibilities of masonry infill walls


    Fangueiro, Raúl; Cunha, Fernando Eduardo Macedo; Vasconcelos, Graça; Abreu, S


    This work presents a brief review on the seismic behavior on non-loadbearing masonry walls used as masonry infills. O Some examples of inefficient performance are shown based on information available of recent earthquakes. Additionally, a literature overview on the techniques for retrofitting existing masonry infills is provided. Finally, alternative braided reinforced composite materials are briefly described and pointed out as an alternative solution for retrofitting masonry infill walls.

  11. Brief Cognitive-Behavioral Therapy for Anxious Youth: Feasibility and Initial Outcomes


    Crawley, Sarah A.; KENDALL, Philip C.; Benjamin, Courtney L.; Brodman, Douglas M.; Wei, Chiaying; Beidas, Rinad S; Podell, Jennifer L.; Mauro, Christian


    We developed and evaluated a brief (8-session) version of cognitive-behavioral therapy (BCBT) for anxiety disorders in youth ages 6 to 13. This report describes the design and development of the BCBT program and intervention materials (therapist treatment manual and child treatment workbook) and an initial evaluation of child treatment outcomes. Twenty-six children who met diagnostic criteria for a principal anxiety diagnosis of separation anxiety disorder, generalized anxiety disorder, and/o...

  12. Particle Suspension Mechanisms - Supplemental Material

    Energy Technology Data Exchange (ETDEWEB)

    Dillon, M B


    This supplemental material provides a brief introduction to particle suspension mechanisms that cause exfoliated skin cells to become and remain airborne. The material presented here provides additional context to the primary manuscript and serves as background for designing possible future studies to assess the impact of skin cells as a source of infectious aerosols. This introduction is not intended to be comprehensive and interested readers are encouraged to consult the references cited.

  13. A brief history of topographical anatomy. (United States)

    Standring, Susan


    This brief history of topographical anatomy begins with Egyptian medical papyri and the works known collectively as the Greco-Arabian canon, the time line then moves on to the excitement of discovery that characterised the Renaissance, the increasing regulatory and legislative frameworks introduced in the 18th and 19th centuries, and ends with a consideration of the impact of technology that epitomises the period from the late 19th century to the present day. This paper is based on a lecture I gave at the Winter Meeting of the Anatomical Society in Cambridge in December 2015, when I was awarded the Anatomical Society Medal. PMID:27278889

  14. 2. Der erkenntnistheoretische Grundentwurf im 7. Brief


    Liatsi, Maria


    Der Brief ist nach Dions Tod verfaßt und richtet sich an die Verwandten und Freunde Dions, gleichzeitig richtet er sich nach Form und Inhalt an die damalige kulturelle Öffentlichkeit. Dion war aus der ihm von Dionysios II. auferlegten Verbannung zurückgekehrt und hatte, ausgerüstet mit einigen Schiffen und einem kleinen Söldnerheer, Syrakus besetzt. Das Volk jubelte ihm wie einem Retter und Befreier zu. Das war im Herbst 357 gewesen. Der Tyrann leistete bis Ende 355 in Ortygia Widerstand und ...

  15. Brief history of electronic stereoscopic displays (United States)

    Lipton, Lenny


    A brief history of recent developments in electronic stereoscopic displays is given concentrating on products that have succeeded in the market place and hence have had a significant influence on future implementations. The concentration is on plano-stereoscopic (two-view) technology because it is now the dominant display modality in the marketplace. Stereoscopic displays were created for the motion picture industry a century ago, and this technology influenced the development of products for science and industry, which in turn influenced product development for entertainment.

  16. Editorial-A brief journal status update. (United States)

    Lynch, James F


    In this editorial, the Editor-in-Chief of the Journal of the Acoustical Society of America gives a brief overview of the present status of the Journal, emphasizing the events that have occurred over the past one and one half years. Topics addressed include: (1) The recent transition to the Editorial Manager peer review system, (2) new features that have been implemented in the Journal, (3) the incoming Managing Editor, (4) the publications component of the Acoustical Society's Strategic Plan, (5) new and revived article types, (6) open access, and (7) Journal metrics and statistics. PMID:27250160

  17. Brief historical background of Miamisburg Indian Mound

    Energy Technology Data Exchange (ETDEWEB)

    Russell, Lorraine M. [comp.


    The construction of Mound Laboratory was completed in 1948. The name Mound Laboratory was chosen for this installation because of the major Indian Mound which is immediately adjacent to the Plant site. Frequent inquiries of visitors to Mound Lab concerning the Indian Mounds in general and specifically Miamisburg's Indian Mound has indicated an area of "outside interest". We, therefore, thought it would be appropriate to furnish this brief historical background to all of the attendees at the Twentieth Meeting of the Mechanical Equipment Management Subgroup.

  18. Energy in Croatia 2008, Brief Report

    International Nuclear Information System (INIS)

    The sixth edition of concise energy review 'Energy in Croatia 2008' presents brief information on relations and developments in the Croatian energy sector to domestic and international audience. Apart od basic energy indicators, this report provides data on energy production and consumption, as well as energy commodities, balances for the past period. In addition, the report gives other interesting indicators, such as, basic facts on the Republic of Croatia, air pollutant emissions, energy prices, energy capacities and energy reserves. The report presents the croatian energy sector in practical and informative style

  19. A Brief Analysis on William Blake's London

    Institute of Scientific and Technical Information of China (English)

    张莉; 尚彦飞


    William Blake (1757-1827) is a renowned British poet in the 18th century. His lyric poems display the characteristics of romantic spirit, and he is regarded as the forefather of the British Romanticism. His London is a well-known lyric poetry, which is thought to be the best vesicle in the West. This paper will analyse this poem in terms of its form, theme, and im-age and then draw a brief conclusion for the characteristics of William Blake's poem.

  20. The Raychaudhuri equations: A brief review

    Indian Academy of Sciences (India)

    Sayan Kar; Soumitra Sengupta


    We present a brief review on the Raychaudhuri equations. Beginning with a summary of the essential features of the original article by Raychaudhuri and subsequent work of numerous authors, we move on to a discussion of the equations in the context of alternate non-Riemannian spacetimes as well as other theories of gravity, with a special mention on the equations in spacetimes with torsion (Einstein–Cartan–Sciama–Kibble theory). Finally, we give an overview of some recent applications of these equations in general relativity, quantum field theory, string theory and the theory of relativisitic membranes. We conclude with a summary and provide our own perspectives on directions of future research.

  1. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.; Nasirian, Vahidreza; Davoudi, Ali


    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... different control parameters. This paper introduces a cooperative algorithm that regulates the system frequency while maintaining the power sharing properties of droop control. Dynamic consensus protocol is used to estimate the average of normalized active powers in the entire MG. This estimation is then...... added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...

  2. Mapa Acústico del Gran Madrid


    Santiago Páez, José Salvador; Perera, P


    El desarrollo urbanístico de Madrid desde los años 1980 a finales de la década de los 90 hizo que su Ayuntamiento, que ya había promovido la realización entre 1985 y 1991 de un Mapa Acústico parcial de la ciudad, pensase en extender el ámbito de éste a todo el término municipal. Siguiendo el mismo criterio anterior, se superpuso una cuadrícula sobre el plano de Madrid, y se llevaron a cabo registros sonoros de 5 minutos en cada vértice de la misma, en los puntos de medición fuera del área ant...

  3. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  4. An ac bridge readout for bolometric detectors (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.


    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  5. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)


    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  6. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.


    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and The objective of the project is to investigate the accuracy of most up to date...... cable models, perform highly accurate field measurements for validating the model and identifying possible disadvantages of the cable model. Furthermore the project suggests and implements improvements and validates them against several field measurements. It is shown in this paper how a new method for...... calculating the frequency dependent cables impedance greatly improves the modeling procedure and gives a highly accurate result for high frequency simulations....

  7. Nonlinear ac conductivity of interacting 1d electron systems


    Rosenow, Bernd; Nattermann, Thomas


    We consider low energy charge transport in one-dimensional (1d) electron systems with short range interactions under the influence of a random potential. Combining RG and instanton methods, we calculate the nonlinear ac conductivity and discuss the crossover between the nonanalytic field dependence of the electric current at zero frequency and the linear ac conductivity at small electric fields and finite frequency.

  8. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division


    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  9. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application (United States)


    ... will transfer to AWN all remaining tangible and intangible assets owned, leased or held by ACS Wireless.... \\6\\ ACS Group will cause certain of its other subsidiaries to transfer wireless spectrum licenses and...'' as the power to exercise a controlling influence over the management or policies of a company,...

  10. Operation of AC Adapters Visualized Using Light-Emitting Diodes (United States)

    Regester, Jeffrey


    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  11. Search for β-delayed fission of 228Ac

    International Nuclear Information System (INIS)

    Radium was radiochemically separated from natural thorium. Thin 228Ra→β-228Ac sources were prepared and exposed to mica fission track detectors, and measured by an HPGe γ-ray detector. The β-delayed fission events of 228Ac were observed and its β-delayed fission probability was found to be (5±2)x10-12

  12. Development of an in-line filter to prevent intrusion of NO2 toxic vapors into A/C systems (United States)

    Meneghelli, Barry; Mcnulty, R. J.; Springer, Mike; Lueck, Dale E.


    The hypergolic propellant nitrogen tetroxide (N2O4 or NTO) is routinely used in spacecraft launched at Kennedy Space Center (KSC) and Cape Canaveral Air Station (CCAS). In the case of a catastrophic failure of the spacecraft, there would be a release of the unspent propellant in the form of a toxic cloud. Inhalation of this material at downwind concentrations which may be as high as 20 parts per million (ppm) for 30 minutes in duration, may produce irritation to the eyes, nose and respiratory tract. Studies at both KSC and CCAS have shown that the indoor concentrations of N2O4 during a toxic release may range from 1 to 15 ppm and depend on the air change rate (ACR) for a particular building and whether or not the air conditioning (A/C) system has been shut down or left in an operating mode. This project was initiated in order to assess how current A/C systems could be easily modified to prevent personnel from being exposed to toxic vapors. A sample system has been constructed to test the ability of several types of filter material to capture the N2O4 vapors prior to their infiltration into the A/C system. Test results will be presented which compare the efficiencies of standard A/C filters, water wash systems, and chemically impregnated filter material in taking toxic vapors out of the incoming air stream.

  13. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion...

  14. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. (United States)


    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  15. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝


    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  16. Development of YBCO HTS cable with low AC loss

    International Nuclear Information System (INIS)

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s

  17. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;


    performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...... bladder 18 ± 3% (15–21%). The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of...... the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction....

  18. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang


    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  19. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU


    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  20. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R


    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  1. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François


    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  2. The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets

    Energy Technology Data Exchange (ETDEWEB)

    Moore, Martina, E-mail: [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Roth, Stefan; Gebert, Annett [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Schultz, Ludwig [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); TU Dresden, Institute for Materials Science, 01062 Dresden (Germany); Gutfleisch, Oliver [TU Darmstadt, Department of Materials Science, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer Project Group for Materials Recycling and Resource Strategies IWKS, 63457 Hanau (Germany)


    Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated.

  3. Fast healthcare: brief communication, traps and opportunities. (United States)

    Crawford, Paul; Brown, Brian


    Resource considerations have meant that brevity in health care interventions is a high priority, and have led to a constant striving after ever more impressive time efficiency. The UK's National Health Service may be described as a kind of 'fast healthcare', where everyone is task busy, time is money, bed spaces are frenetically shuffled so as to accommodate the most needy and there appears to be 'no time to talk'. Indeed, a great many health care encounters are taking place in short 'blips' often of 5min or less across a range of sites and involving a vast number of practitioners. In this paper we explore how brief communication can both alienate and be therapeutic for patients. We theorise brief interactions by considering a number of traditions of work in anthropology, linguistics and sociology and conclude that health care providers need to invest much more in the skills and strategies for how best to communicate briefly if it to retain its core tradition of caring for others. PMID:20303228

  4. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.


    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not...

  5. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica


    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel


    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  6. Emerging Materials Technologies That Matter to Manufacturers (United States)

    Misra, Ajay K.


    A brief overview of emerging materials technologies. Exploring the weight reduction benefit of replacing Carbon Fiber with Carbon Nanotube (CNT) in Polymer Composites. Review of the benign purification method developed for CNT sheets. The future of manufacturing will include the integration of computational material design and big data analytics, along with Nanomaterials as building blocks.

  7. Amicus Curiae Brief for the United States Supreme Court on Mental Health Issues Associated with "Physician-Assisted Suicide" (United States)

    Werth, James L., Jr.; Gordon, Judith R.


    After providing background material related to the Supreme Court cases on "physician-assisted suicide" (Washington v. Glucksberg, 1997, and Vacco v. Quill, 1997), this article presents the amicus curiae brief that was submitted to the United States Supreme Court by 2 national mental health organizations, a state psychological association, and an…

  8. The Brief Norwegian Safety Climate Inventory (Brief NORSCI) – Psychometric properties and relationships with shift work, sleep, and health


    Nielsen, Morten Birkeland; Hystad, Sigurd William; Eid, Jarle


    The aim of this study was to establish the psychometric properties of the 11-item Brief Norwegian Safety Climate Inventory (Brief NORSCI) and to examine direct and indirect associations between shift work schedules, sleep problems, health complaints, and psychological safety climate. The study was based on a questionnaire survey in a randomly drawn cross-sectional sample of 8066 workers from the Norwegian offshore petroleum industry. The results showed that the Brief NORSCI has good psychomet...

  9. Numerical estimation of AC loss in superconductors with ripple current

    International Nuclear Information System (INIS)

    Highlights: •The loss energy density with ripple current is numerically calculated. •Irie–Yamafuji model is used for magnetic field dependence of critical current. •Calculated result of cylindrical superconductor agrees with theoretical result. •AC loss of strip superconductor becomes large at small ripple current amplitude. •Strip superconductor should be used as a form of hollow cylinder to reduce AC loss. -- Abstract: The loss energy density (AC loss) with ripple current is numerically calculated by finite element method for cylindrical and strip superconductors based on Irie–Yamafuji model in which the magnetic field dependence of the critical current density is taken into account for design of DC transmission cable system. It is confirmed that calculated result of the AC loss in the cylindrical superconductor with the ripple current agrees well with theoretical estimation which was reported in the previous work. On the contrary, the AC loss in the strip superconductor with the ripple current is obtained only by numerical calculation. It is found that the AC loss in the strip superconductor of the ripple current becomes larger than that without DC current at small ripple current amplitude, since the penetration depth of magnetic field becomes large. Therefore, it is recommended that strip superconductor is better to use as cylindrical hollow superconductor for DC transmission cable system to reduce the AC loss

  10. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali


    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  11. AC impedance electrochemical modeling of lithium-ion positive electrodes

    International Nuclear Information System (INIS)

    Under Department of Energy's Advanced Technology Development Program,various analytical diagnostic studies are being carried out to examine the lithium-ion battery technology for hybrid electric vehicle applications, and a series of electrochemical studies are being conducted to examine the performance of these batteries. An electrochemical model was developed to associate changes that were observed in the post-test analytical diagnostic studies with the electrochemical performance loss during testing of lithium ion batteries. While both electrodes in the lithium-ion cell have been studied using a similar electrochemical model, the discussion here is limited to modeling of the positive electrode. The positive electrode under study has a composite structure made of a layered nickel oxide (LiNi0.8Co0.15Al0.05O2) active material, a carbon black and graphite additive for distributing current, and a PVDF binder all on an aluminum current collector. The electrolyte is 1.2M LiPF6 dissolved in a mixture of EC and EMC and a Celgard micro-porous membrane is used as the separator. Planar test cells (positive/separator/negative) were constructed with a special fixture and two separator membranes that allowed the placement of a micro-reference electrode between the separator membranes (1). Electrochemical studies including AC impedance spectroscopy were then conducted on the individual electrodes to examine the performance and ageing effects in the cell. The model was developed by following the work of Professor Newman at Berkeley (2). The solid electrolyte interface (SEI) region, based on post-test analytical results, was assumed to be a film on the oxide and an oxide layer at the surface of the oxide. A double layer capacity was added in parallel with the Butler-Volmer kinetic expression. The pertinent reaction, thermodynamic, and transport equations were linearized for a small sinusoidal perturbation (3). The resulting system of differential equations was solved numerically

  12. Operation of AC Adapters Visualized Using Light-Emitting Diodes (United States)

    Regester, Jeffrey


    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current (AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For educational purposes, however, an LED-based rectifier is ideal because it allows students to literally see the rectifier operating. Here I'll discuss the practical aspects of building a full AC adapter incorporating an LED-based rectifier and ideas on how to use it in class.

  13. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin


    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  14. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono


    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  15. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen


    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  16. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  17. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  18. Stochastic Dynamics of DC and AC Driven Dislocation Kinks (United States)

    Vardanyan, A.; Kteyan, A.


    Dynamics of a pinned dislocation kink controlled by the acting DC and AC forces is studied analytically. The motion of the kink, described by sine-Gordon (sG) equation, is explored within the framework of McLaughlin-Scott perturbation theory. Assuming weakness of the acting AC force, the equation of motion of the dislocation kink in the pinning potential is linearized. Based on the equations derived, we study stochastic behavior of the kink, and determine the probability of its depinning. The dependencies of the depinning probability on DC and AC forces are analyzed in detail.

  19. Observation of β-delayed fission from 230Ac

    International Nuclear Information System (INIS)

    β-delayed fission for 230Ac was searched. 230Ra was produced via multinucleon transfer reaction by 60 MeV/u 18O ion irradiation of 232Th target. Thin 230Ra→230Ac sources of 108 atoms were acquired through radiochemical separations. The mica track detectors were used to record the fission events. The β-delayed fission nucleus 230Ac was identified via the observed two fission events and the measured γ-ray spectra. Its β-delayed fission probability was obtained to be (1.19 +- 0.85) x 10-8

  20. Affordances for robots: a brief survey

    Directory of Open Access Journals (Sweden)

    Thomas E. Horton


    Full Text Available In this paper, we consider the influence of Gibson's affordance theory on the design of robotic agents. Affordance theory (and the ecological approach to agent design in general has in many cases contributed to the development of successful robotic systems; we provide a brief survey of AI research in this area. However, there remain significant issues that complicate discussions on this topic, particularly in the exchange of ideas between researchers in artificial intelligence and ecological psychology. We identify some of these issues, specifically the lack of a generally accepted definition of "affordance" and fundamental differences in the current approaches taken in AI and ecological psychology. While we consider reconciliation between these fields to be possible and mutually beneficial, it will require some flexibility on the issue of direct perception.

  1. Negotiating Visualities in Briefing and Design

    DEFF Research Database (Denmark)

    Koch, Christian; Bendixen, Mads


    prescription, changing their roles and configurations, and intersecting and affecting the project process in characteristic ways. Visual representations play a temporary role, and ‘time’ and ‘phase’ set boundaries for them. For practice, the analysis suggests the implication that communitarian management......Building on an in-depth ethnographic study and the approaches of ‘practice-based studies’ and ‘science and technology studies’, the role of visual representations is explored in briefing and design processes. Three characteristic ways in which drawings contribute to ongoing negotiations are...... discussed. First, drawings are shown to be inscribed with particular interests, making them political instruments. Second, they have prescriptive effects as partially independent actors in the project. Third, they are shown to participate as conscriptions in a complementary process of inscription and...

  2. Negotiating Visualizations in Briefing and Design

    DEFF Research Database (Denmark)

    Bendixen, Mads; Koch, Christian


    prescription, changing their roles and configurations, and intersecting and affecting the project process in characteristic ways. Visual representations play a temporary role, and ‘time’ and ‘phase’ set boundaries for them. For practice, the analysis suggests the implication that communitarian management......Building on an in-depth ethnographic study and the approaches of ‘practice-based studies’ and ‘science and technology studies’, the role of visual representations is explored in briefing and design processes. Three characteristic ways in which drawings contribute to ongoing negotiations are...... discussed. First, drawings are shown to be inscribed with particular interests, making them political instruments. Second, they have prescriptive effects as partially independent actors in the project. Third, they are shown to participate as conscriptions in a complementary process of inscription and...

  3. The Financial Therapy Association: A Brief History

    Directory of Open Access Journals (Sweden)

    Sonya Britt


    Full Text Available The purpose of this brief review is to provide a historical context for the conceptualization, development, and launch of the Financial Therapy Association (FTA. The FTA membership base consists of practicing financial planners, financial counselors, psychologists, marriage and family therapists, social workers, financial coaches, psychotherapists, and researchers from these and other disciplines. From the outset, the Association’s purpose has encompassed five goals:To promote a vision of financial therapy, which is the study of cognitive, emotional, behavioral, relational, economic, and integrative aspects of financial health.To provide a forum for researchers, practitioners, the media, and policy makers to share research and practice methods and models of financial therapy.To promote methods of training for those involved in financial therapy.To inform policy and practice management standards as these relate to financial therapy.To stimulate and disseminate clinical, experimental, and survey research on financial therapy.

  4. Brief assessment of negative dysmorphic signs

    Directory of Open Access Journals (Sweden)

    Patrizia Fiori


    Full Text Available Patrizia Fiori1, Antonio Monaco1, Maria Giannetti Luigi21Central Operative Unit of Neurology, 2Infantile Neuropsychiatry and Social Service, ASL AV, Civil Hospital of Ariano Irpino, University of Naples, ItalyAbstract: Body dysmorphic disorder is a body image dysperception, characterized either by an excessive preoccupation with a presumed or minimal flaw in appearance, or by unrecognition, denial, or even neglect regarding an obvious defect. These features are evaluated by a novel questionnaire, the Brief Assessment of Negative Dysmorphic Signs (BANDS. Moreover, the temperament and character background is examined. The relationship with addictive mentality/behavior and schizoaffectivity is also highlighted. Lastly, the potential shift toward cognitive impairment and dementia is considered.Keywords: body dysmorphic disorder, schizoaffectivity, addiction, behavioral-cognitive impairment

  5. STS-114: Discovery Launch Postponement Press Briefing (United States)


    This press briefing addresses the problem that occurred prior to the launch of the STS-114. Dean Acosta, Deputy Assistant Administrator of Public Affairs, introduces the panel which consists of Dr. Michael Griffin, NASA Administrator, William Readdy, Associate Administrator for Space Operations, Wayne Hale, Space Shuttle Program Deputy Manager, Steve Poulas, Orbiter Project Manager, Mike Leinbach, NASA Launch Director, and Bill Parsons, Space Shuttle Program Manager. Wayne Hale expresses that a problem occurred with one of the low level sensors in the hydrogen tank and that the cause of the problem must be identified and rectified. Steve Poulos talks about establishing a troubleshooting plan as a part of the scrub effort and Mike Leinbach describes the process of draining the external tank. Wayne Hale answers questions about the sensors and if the Space Shuttle Discovery is safe to fly and Steve Poulos answers questions about the possible suspects for this problem.

  6. Bats and Viruses: a Brief Review

    Institute of Scientific and Technical Information of China (English)

    Lin-Fa Wang


    Bats, probably the most abundant, diverse and geographically dispersed vertebrates on earth, have recently been shown to be the reservoir hosts of a number of emerging viruses responsible for severe human and livestock disease outbreaks. Flying foxes have been demonstrated to be the natural reservoir for Hendra and Nipah viruses. Evidence supporting the possibility of bats as potential reservoirs for SARS coronavirus (SARS-CoV) and Ebola virus has also been reported. The recent discovery of these viruses and other viruses occurring naturally in the bat population provides a unique insight into a diverse pool of potentially emergent and pathogenic viruses. The factors which influence the ability of zoonotic viruses to effectively cross the species barrier from bats to other animal populations are poorly understood. A brief review is provided here on the recently emerged bat viruses and on current and future strategies for research in this area.

  7. Delusional disorders in dermatology: a brief review. (United States)

    Robles, David T; Romm, Sharon; Combs, Heidi; Olson, Jonathan; Kirby, Phil


    There are several unique psychiatric disorders that are likely to present to a dermatologist because of their accompanying skin complaints. Delusions of parasitosis (DP) is a fixed, false belief of parasitic infestation that may lead patients to compulsively self-mutilate while attempting to remove the non-existent parasites. Morgellons disease is a controversial condition characterized by a fixed belief that fibers that are imbedded or extruding from the skin; this condition is likely in the spectrum of DP. Body dysmorphic disorder (BDD) is a preoccupation with an imagined defect in appearance that causes significant distress and is associated with time consuming rituals, isolation, depression, and increased risk of suicide. Olfactory reference syndrome (ORS) is a preoccupation with body odor leading to the stigmata of shame, embarrassment, and social isolation. This brief review examines each of these conditions and their management because any one of them may present to a dermatologist. PMID:18713583

  8. Brief fasting, stress, and cognition in children. (United States)

    Pollitt, E; Leibel, R L; Greenfield, D


    Effects of skipping breakfast on speed and accuracy of response in a number of problem solving tasks were assessed in 9- to 11-yr-old, well-nourished children. The conceptual framework for this study was derived from an experimental model of the effects of mild environmental stress, e.g., noise, on human performance. Plasma glucose, beta-hydroxybutyrate, lactate, and free fatty acids were used as indicators of the induced metabolic stress, and the extent of their association with the behavioral measures was determined. Fasting had an adverse effect on the accuracy of responses in problem solving, but it had a beneficial effect on immediate recall in short-term memory. Both effects are explained by a heightened arousal level associated with the brief experimental fast. PMID:7270476

  9. Brief overview of geophysical probing technology

    International Nuclear Information System (INIS)

    An evaluation of high-resolution geophysical techniques which can be used to characterize a nulcear waste disposal site is being conducted by the Lawrence Livermore National Laboratory (LLNL) at the request of the US Nuclear Regulatory Commisson (NRC). LLNL is involved in research work aimed at evaluating the current capabilities and limitations of geophysical methods used for site selection. This report provides a brief overview of the capabilities and limitations associated with this technology and explains how our work addresses some of the present limitations. We are examining both seismic and electromagnetic techniques to obtain high-resolution information. We are also assessing the usefulness of geotomography in mapping fracture zones remotely. Finally, we are collecting core samples from a site in an effort to assess the capability of correlating such geophysical data with parameters of interest such as fracture continuity, orientation, and fracture density

  10. History of Hanford Site Defense Production (Brief)

    International Nuclear Information System (INIS)

    This paper acquaints the audience with the history of the Hanford Site, America's first full-scale defense plutonium production site. The paper includes the founding and basic operating history of the Hanford Site, including World War II construction and operations, three major postwar expansions (1947-55), the peak years of production (1956-63), production phase downs (1964-the present), a brief production spurt from 1984-86, the end of the Cold War, and the beginning of the waste cleanup mission. The paper also delineates historical waste practices and policies as they changed over the years at the Hanford Site, past efforts to chemically treat, ''fractionate,'' and/or immobilize Hanford's wastes, and resulting major waste legacies that remain today. This paper presents original, primary-source research into the waste history of the Hanford Site. Finally, the paper places the current Hanford Site waste remediation endeavors in the broad context of American and world history

  11. Brief description of the Wackersdorf Reprocessing Facility

    International Nuclear Information System (INIS)

    The DWK is now planning the construction and operation of a facility for the reprocessing of spent fuel elements and the fabrication of mixed-oxide fuel elements which will initially have an average daily throughput of 2 tons (t) of nuclear fuel. The application required by the Atomic Law was submitted to the Bavarian State Ministry for State Development and Environmental Matters on October 28, 1982. According to Par. 3, Section 1, No. 1 of the Atomic Law Procedural Ordinance such an application for permission in accordance with par. 7 AtL must explicitly be accompanied by a safety report which shall make it possible for third parties to make a judgment whether the impacts associated with the facility and its operation could damage their rights. The safety report is intended to present and explain the concept of the facility, the safety-technological design bases, and the operation of the plant, including its operation and safety systems and the impacts and proposed preventive measures. In addition to the detailed presentations in the safety report, Par. 3 of the Atomic Law Procedural Ordinance also requires a brief description of the plant designed for general public understanding, suitable for the design, which will also explain the expected impacts on the general environment and the surrounding area. Hence the brief description presents and explains the following matters: the site; the technology and state of the art for reprocessing of spent nuclear fuel; the structure and function of the proposed facility; safety provisions of the proposed facility and the management of perturbations in operation; the impacts of the facility and its operation on the environment; measures to be taken for dealing with the radioactive wastes; and provisions for ultimate shut-down of the facility

  12. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo


    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  13. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites

    Indian Academy of Sciences (India)

    Navin Chand; Deepak Jain


    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled and unfilled epoxy composites. It was observed that the dielectric constant, tan and a.c. conductivity increase with increasing temperature. Near the transition temperature the materials show anomalous behaviour for the observed properties. Peaks of dielectric constant, tan and a.c. conductivity were observed to shift towards lower temperature with increasing frequency. Clear relaxation (tan ) peaks around 169°C were observed in epoxy resin, which shifted to lower temperature side on increasing the frequency. Addition of 2.91 wt% graphite shifted the tan peaks towards higher temperature side by creating hindrances to the rotation of polymer dipoles. Addition of 2.91 wt% graphite leads to an increased relaxation time of dipoles in polysulphide epoxy from 1.44 × 10-5-3.92 × 10-5 (s) at 90°C by creating the hindrance to the rotation of dipoles.

  14. Nb46, 5wt% Ti Eb-melting for AC and DC superconducting applications

    International Nuclear Information System (INIS)

    This paper reports on the superconductor alloy Nb46, 5wt % Ti which presents the best superconducting and mechanical properties for the systems Nb-Ti. The greatest difficulty in obtaining this alloy is related to the difference between the raw materials melting temperatures, which is about 700 degrees C. As a result the alloy homogeneity as well as Ti desired content, turn to be hard to control. The authors choose an electrode sandwich type, where Nb and Ti sheets are interposed. The electrode dimensions calculation is based on the Ti evaporation rate, energy balance and superficial tension of liquid titanium between Nb sheets. The ingots were electron beam melted. Herein, we present the following ingot results: Ti, intersticial and trace contents compared to international manufactures as well as its mechanical workability. This alloy will be used in NbTi wire production for AC and DC applications. The AC and DC wires are produced by coswaging and codrawing of NbTi bars and CuNi-tubes for AC wires and Cu-tubes for DC wires. High area reductions of about 2 x 108 are reached without intermediate heat treatment, and they are essential since they are precursors of collective pinning centers, responsible for high critical current densities

  15. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  16. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  17. Geological Cartography of Inner Materials of an Impact Crater on Nepenthes Mensae, Mars (United States)

    Valenciano, A.; de Pablo, M. A.


    We present the geological map and a brief description of the materials, its geological history and an approach to their astrobiological and exopaleontological implications from sedimentary materials located into impact crater, in Nepenthes Mensae, Mars.

  18. Academic Spending versus Athletic Spending: Who Wins? Issue Brief (United States)

    Desrochers, Donna M.


    Athletics are big business on many college campuses, but does this come with a price tag? This issue brief looks at academic and athletic spending in NCAA Division I public universities between 2005 and 2010. Among a host of findings, this brief shows that the athletic departments of most public colleges and universities competing in NCAA Division…

  19. Extra-Curricular Inequality. Research Brief. Edition 1 (United States)

    Sutton Trust, 2014


    This Research Briefing analyses Office for National Statistics data and finds children from the most advantaged households benefit from significantly more spending on extra-curricular activities and private tutoring than their poorer peers. The brief also includes the Trust's annual polling on private tuition and new polling on parents and…

  20. 5 CFR 185.136 - Post-hearing briefs. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Post-hearing briefs. 185.136 Section 185.136 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.136 Post-hearing briefs. The ALJ may require the parties to file...

  1. Fetal Alcohol Exposure Reduces Adult Brain Plasticity. Science Briefs (United States)

    National Scientific Council on the Developing Child, 2007


    "Science Briefs" summarize the findings and implications of a recent study in basic science or clinical research. This Brief summarizes the findings and implications of "Moderate Fetal Alcohol Exposure Impairs the Neurogenic Response to an Enriched Environment in Adult Mice" (I. Y. Choi; A. M. Allan; and L. A. Cunningham). Observations of mice…

  2. Participation in VET in Schools. LSAY Briefing Number 15 (United States)

    Coates, Hamish; Rothman, Sheldon


    This "Briefing" looks at participation in VET in Schools programs by members of three groups of young people who have been part of Longitudinal Surveys of Australian Youth (LSAY) since 1995, when VET in Schools offerings experienced sustained growth. Highlights of this briefing include: (1) Student enrolments in VET in Schools have grown…

  3. Salt Lake 2002 world broadcaster briefing: December 1998



    This briefing contains activities of SLOC as of December 1998. SLOC has developed a comprehensive budget for the 2002 Olympic Winter Games that is presented in this briefing. SLOC’s goals are to minimize costs while maximizing the potential for success, to establish a baseline for action and control, and to allow for continued planning and definition of the scope of the Games.

  4. Briefing note. Severity of the December 2015 floods - preliminary analysis


    Barker, Lucy; Hannaford, Jamie; Parry, Simon


    The purpose of this briefing note is to collate some of the key points from the December 2015 Hydrological Summary, and to provide some additional context beyond the space and format constraints of the Summary. Neither the Hydrological Summary nor the briefing note provide a fully comprehensive review of the severity of the December 2015 floods.

  5. 14 CFR 121.571 - Briefing passengers before takeoff. (United States)


    ... citations affecting § 121.571, see the List of CFR Sections Affected, which appears in the Finding Aids... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Briefing passengers before takeoff. 121.571... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Flight Operations § 121.571 Briefing...

  6. Talent Wars: The International Market for Academic Staff. Policy Briefing (United States)

    Universities UK, 2007


    This policy briefing aims to raise awareness and understanding among policy-makers and UK higher institutions of the international dimensions of academic staff recruitment and the factors that may influence it. This briefing summarises recent research and considers its implications for institutions and for national policies. Annex A contains:…

  7. Case Book of Brief Psychotherapy with College Students. (United States)

    Cooper, Stewart E., Ed.; Archer, James Jr., Ed.; Whitaker, Leighton C., Ed.

    This book examines brief therapy in a developmental context with young adults whose clinical problems often relate to or are caused by significant developmental impasses. The purpose in presenting this book is to provide case studies to illustrate a variety of brief therapy approaches with young adults who are college students between the ages of…

  8. First-Session Competency: The Brief Strategic Therapy Scale-1 (United States)

    Amini, Rachelle L.; Woolley, Scott R.


    The first session in brief strategic therapy is the most critical phase of treatment. More than a mere "assessment phase," the first session in a true intervention sets the stage for all subsequent therapeutic maneuvers. This article presents a supervisory observation tool, the Brief Strategic Therapy Scale-1 (BSTS-1), a fidelity measure proposed…

  9. "Talking Pictures Therapy" as Brief Therapy in a School Setting (United States)

    Loewenthal, Del


    This article presents "talking pictures therapy" as an approach to brief therapy, in which photographs are used in brief psychotherapy and counseling with the purpose of enabling clients to express and explore through photographs aspects of their lives they would like to talk about. The author presents case examples using "talking pictures…

  10. Screening and Brief Interventions: Research Update. Prevention Update (United States)

    Higher Education Center for Alcohol, Drug Abuse, and Violence Prevention, 2012


    Developed in 1993 at the University of Washington, Brief Alcohol Screening and Intervention for College Students (BASICS) is a preventive intervention program to reduce drinking and enhance awareness about alcohol-related issues. BASICS targets college students who are considered at risk because of heavy drinking behaviors. The brief intervention…

  11. Use of Brief Intelligence Tests in the Identification of Giftedness (United States)

    Pierson, Eric E.; Kilmer, Lydia M.; Rothlisberg, Barbara A.; McIntosh, David E.


    Schools often administer brief intelligence tests as the first step in the identification of students who are cognitively gifted. However, brief measures are often used without consideration of underlying constructs or the psychometric properties of the measures and without regard to the links between screening decisions and educational…

  12. Drama in design: An open brief to design for wellbeing

    NARCIS (Netherlands)

    Liao, T.; Person, F.E.O.K.


    This paper presents a design module in which student teams were challenged in an open brief to design for wellbeing. To design for wellbeing is difficult. Wellbeing is ambiguous, hard to define and highly personal. In the process of defining their own briefs, a drama workshop was set up to help the

  13. Absorption and Attenuation Coefficients Using the WET Labs ac-s in the Mid-Atlantic Bight: Field Measurements and Data Analysis (United States)

    Ohi, Nobuaki; Makinen, Carla P.; Mitchell, Richard; Moisan, Tiffany A.


    Ocean color algorithms are based on the parameterization of apparent optical properties as a function of inherent optical properties. WET Labs underwater absorption and attenuation meters (ac-9 and ac-s) measure both the spectral beam attenuation [c (lambda)] and absorption coefficient [a (lambda)]. The ac-s reports in a continuous range of 390-750 nm with a band pass of 4 nm, totaling approximately 83 distinct wavelengths, while the ac-9 reports at 9 wavelengths. We performed the ac-s field measurements at nine stations in the Mid-Atlantic Bight from water calibrations to data analysis. Onboard the ship, the ac-s was calibrated daily using Milli Q-water. Corrections for the in situ temperature and salinity effects on optical properties of water were applied. Corrections for incomplete recovery of the scattered light in the ac-s absorption tube were performed. The fine scale of spectral and vertical distributions of c (lambda) and a (lambda) were described from the ac-s. The significant relationships between a (674) and that of spectrophotometric analysis and chlorophyll a concentration of discrete water samples were observed.

  14. Alcohol screening and brief intervention among drug users in primary care: a discussion paper.

    LENUS (Irish Health Repository)

    Field, C A


    BACKGROUND: Problem alcohol use is common among problem drug users (PDU) and associated with adverse health outcomes. Primary care has an important role in the overall stepped approach to alcohol treatment, especially screening and brief intervention (SBI). AIM: To discuss three themes that emerged from an exploration of the literature on SBI for problem alcohol use in drug users attending primary care. METHODS: Material for this discussion paper was gathered from three biomedical databases (PubMed, PsycINFO and Cochrane library), conference proceedings and online resources of professional organisations or national health agencies. RESULTS: Themes discussed in this paper are: (a) the potential of primary care for delivery of alcohol SBIs to PDUs, (b) screening methods and (c) application of brief interventions to PDUs. CONCLUSIONS: Although SBI improves health outcomes associated with problem alcohol use in the general population, further research is needed among high-risk patient groups, especially PDUs.

  15. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)


    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  16. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    Directory of Open Access Journals (Sweden)

    H. Salamati


    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  17. Performance of an x-ray microcalorimeter under ac biasing

    International Nuclear Information System (INIS)

    Frequency domain multiplexing (FDM) is an attractive option for the readout of imaging arrays of microcalorimeters. Implementation of FDM requires ac biasing of the individual microcalorimeters. In this letter we present a small signal model for the behavior of a microcalorimeter under ac bias. Moreover, we have measured the behavior of the same microcalorimeter under ac (at 46 kHz) and dc bias. These experiments show that the performance of the device is very similar in terms of energy resolution, pulse shapes, and current-voltage characteristics. The measured energy resolution at 5.89 keV is 6.9 eV for ac bias and 5.5 eV for dc bias. The effective time constant in both cases is 100 μs

  18. Dc to ac converter operates efficiently at low input voltages (United States)


    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  19. c-axis ac susceptibility in high-Tc superconductors

    International Nuclear Information System (INIS)

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi2Sr2CaCu2O8 and YBa2Cu3O7 single crystals at low external fields. The ac field was applied perpendicular to the CuO2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO2 planes passes a threshold field Hth. Hth is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  20. Fabrication of alumina films with laminated structures by ac anodization

    International Nuclear Information System (INIS)

    Anodization techniques by alternating current (ac) are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials. (paper)

  1. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  2. Muc5ac mucin expression during rat skin development


    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.


    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  3. Dynamics of a nanowire superlattice in an ac electric field


    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen


    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  4. Fractal AC circuits and propagating waves on fractals

    CERN Document Server

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander


    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  5. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;


    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  6. AC resistivity of d-wave ceramic superconductors


    Li, Mai Suan; Dominguez, Daniel


    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  7. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe


    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments....

  8. Examining the Efficacy of a Brief Mindfulness-Based Stress Reduction (Brief MBSR) Program on Psychological Health (United States)

    Bergen-Cico, Dessa; Possemato, Kyle; Cheon, Sanghyeon


    Objective: The purpose of the study was to examine potential psychological health benefits of participating in a brief (5-week) mindfulness-based stress reduction (brief MBSR) program integrated into an academic course. Participants: Participants were 119 undergraduate students (treatment: "n" = 72; control: "n" = 47) enrolled…

  9. ISTTOK upgrade towards AC and remote operation

    International Nuclear Information System (INIS)

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed.In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented.The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat

  10. ISTTOK upgrade towards AC and remote operation (United States)

    Fernandes, H.; Silva, C.; Carvalho, B.; Sousa, J.; Valcárcel, D.; Neto, A.; Fortunato, J.; Carvalho, I.; Varandas, C. A. F.


    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed. In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented. The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat.

  11. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar


    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  12. Brief guided imagery and body scanning interventions reduce food cravings. (United States)

    Hamilton, Jonathan; Fawson, Sophie; May, Jon; Andrade, Jackie; Kavanagh, David J


    Elaborated Intrusion (EI) Theory proposes that cravings occur when involuntary thoughts about food are elaborated; a key part of elaboration is affectively-charged imagery. Craving can be weakened by working memory tasks that block imagery. EI Theory predicts that cravings should also be reduced by preventing involuntary thoughts being elaborated in the first place. Research has found that imagery techniques such as body scanning and guided imagery can reduce the occurrence of food thoughts. This study tested the prediction that these techniques also reduce craving. We asked participants to abstain from food overnight, and then to carry out 10 min of body scanning, guided imagery, or a control mind wandering task. They rated their craving at 10 points during the task on a single item measure, and before and after the task using the Craving Experience Questionnaire. While craving rose during the task for the mind wandering group, neither the guided imagery nor body scanning group showed an increase. These effects were not detected by the CEQ, suggesting that they are only present during the competing task. As they require no devices or materials and are unobtrusive, brief guided imagery strategies might form useful components of weight loss programmes that attempt to address cravings. PMID:23962401

  13. NASA Tech Briefs, February 2001. Volume 25, No. 2 (United States)


    The topics include: 1) Application Briefs; 2) National Design Engineering Show Preview; 3) Marketing Inventions to Increase Income; 4) A Personal-Computer-Based Physiological Training System; 5) Reconfigurable Arrays of Transistors for Evolvable Hardware; 6) Active Tactile Display Device for Reading by a Blind Person; 7) Program Automates Management of IBM VM Computer Systems; 8) System for Monitoring the Environment of a Spacecraft Launch; 9) Measurement of Stresses and Strains in Muscles and Tendons; 10) Optical Measurement of Temperatures in Muscles and Tendons; 11) Small Low-Temperature Thermometer With Nanokelvin Resolution; 12) Heterodyne Interferometer With Phase-Modulated Carrier; 13) Rechargeable Batteries Based on Intercalation in Graphite; 14) Signal Processor for Doppler Measurements in Icing Research; 15) Model Optimizes Drying of Wet Sheets; 16) High-Performance POSS-Modified Polymeric Composites; 17) Model Simulates Semi-Solid Material Processing; 18) Modular Cryogenic Insulation; 19) Passive Venting for Alleviating Helicopter Tail-Boom Loads; 20) Computer Program Predicts Rocket Noise; 21) Process for Polishing Bare Aluminum to High Optical Quality; 22) External Adhesive Pressure-Wall Patch; 23) Java Implementation of Information-Sharing Protocol; 24) Electronic Bulletin Board Publishes Schedules in Real Time; 25) Apparatus Would Extract Water From the Martian Atmosphere; 26) Review of Research on Supercritical vs Subcritical Fluids; 27) Hybrid Regenerative Water-Recycling System; 28) Study of Fusion-Driven Plasma Thruster With Magnetic Nozzle; 29) Liquid/Vapor-Hydrazine Thruster Would Produce Small Impulses; and 30) Thruster Based on Sublimation of Solid Hydrazine

  14. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi; /Texas U.


    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f {approx} 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  15. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG


    Bulhosa, João Paulo Rodrigues


    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  16. In Brief: Assessing Afghanistan's mineral resources (United States)

    Showstack, Randy


    Afghanistan has significant amounts of undiscovered nonfuel mineral resources, with copper and iron ore having the most potential for extraction, according to a new U.S. Geological Survey (USGS) assessment. The assessment, done cooperatively with the Afghanistan Geological Survey of the Afghanistan Ministry of Mines, also found indications of significant deposits of colored stones and gemstones (including emeralds, rubies, and sapphires), gold, mercury, sulfur, chromite, and other resources. ``Mineral resource assessments provide government decision-makers and potential private investors with objective, unbiased information on where undiscovered mineral resources may be located, what kinds of resources are likely to occur, and how much of each mineral commodity may exist in them,'' said USGS director Mark Myers. The USGS, in cooperation with the Afghan government, released an oil and gas resources assessment in March 2006 and an earthquake hazards assessment in May 2007. For more information, visit the Web sites: and

  17. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.


    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  18. Confirmation of hydroxyl radicals ({sup •} OH) generated in the presence of TiO{sub 2} supported on AC under microwave irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhaohong, E-mail: [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Fengyang; Huang, Lirong; Jiatieli, Jianaerguli; Li, Yuanyuan; Song, Lijun [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Ning [Experiment Center of Environmental Monitoring of Liaoning Province, Shenyang 110161 (China); Dionysiou, Dionysios D., E-mail: [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)


    Graphical abstract: - Highlights: • Generation of {sup •} OH in MW integrated with loaded TiO{sub 2}/AC system was confirmed. • Confirmation of {sup •} OH was conducted using radical scavenger such as BHT, MT and VC. • More {sup •} OH was formed using anatase TiO{sub 2}/AC than rutile TiO{sub 2}/AC under MW irradiation. • Effect of mass ratio, irradiation time, catalyst dose and DPCI on {sup •} OH was studied. - Abstract: In order to study the degradation mechanism of technology of microwave (MW) combined with TiO{sub 2} supported on activated carbon (TiO{sub 2}/AC), the reactive oxygen species (ROS) was explored through oxidation of 1,5-diphenyl carbazide (DPCI) to 1,5-diphenyl carbazone (DPCO). Furthermore, 2,6-di-tert-butyl-4-methylphenol (BHT), Mannitol (MT) and Vitamin C (VC) were used as radical scavengers to confirm the generation of the hydroxyl radicals ({sup •} OH). In addition, the influence of some parameters such as TiO{sub 2} mass ratio content, irradiation time, material dose, DPCI concentration and MW power on the determination of {sup •} OH were examined. The results showed that the {sup •} OH could be generated under MW combined with loaded TiO{sub 2}/AC. Also, anatase TiO{sub 2}/AC can generate more {sup •} OH radicals than rutile TiO{sub 2}/AC under MW irradiation. This work would provide new mechanistic insights on the enhanced degradation effect of organic pollutants in water using the supported TiO{sub 2}/AC coupled with MW technology.

  19. Developing 226Ra and 227Ac age-dating techniques for nuclear forensics to gain insight from concordant and non-concordant radiochronometers

    International Nuclear Information System (INIS)

    The model age or 'date of purification' of a nuclear material is an important nuclear forensic signature. In this study, chemical separation and MC-ICP-MS measurement techniques were developed for 226 Ra and 227Ac: grand-daughter nuclides in the 238U and 235U decay chains respectively. The 230Th-234U, 226Ra-238U, 231Pa-235U, and 227Ac-235U radiochronometers were used to calculate model ages for CRM-U100 standard reference material and two highly-enriched pieces of uranium metal from the International Technical Working Group Round Robin 3 Exercise. In conclusion, the results demonstrate the accuracy of the 226Ra-238U and 227Ac-235U chronometers and provide information about nuclide migration during uranium processing

  20. Developing 226Ra and 227Ac age-dating techniques for nuclear forensics to gain insight from concordant and non-concordant radiochronometers

    International Nuclear Information System (INIS)

    The model age or 'date of purification' of a nuclear material is an important nuclear forensic signature. In this study, chemical separation and MC-ICP-MS measurement techniques were developed for 226Ra and 227Ac: grand-daughter nuclides in the 238U and 235U decay chains, respectively. The 230Th-234U, 226Ra-238U, 231Pa-235U, and 227Ac-235U radiochronometers were used to calculate model ages for CRM-U100 standard reference material and two highly-enriched pieces of uranium metal from the International Technical Working Group Round Robin 3 Exercise. Results demonstrate the accuracy of the 226Ra-238U and 227Ac-235U chronometers and provide information about nuclide migration during uranium processing. (author)