WorldWideScience

Sample records for ac briefing material

  1. The nuclear materials control technology briefing book

    Hartwell, J.K.; Fernandez, S.J.

    1992-03-01

    As national and international interests in nuclear arms control and non-proliferation of nuclear weapons, intensify, it becomes ever more important that contributors be aware of the technologies available for the measurement and control of the nuclear materials important to nuclear weapons development. This briefing book presents concise, nontechnical summaries of various special nuclear material (SNM) and tritium production monitoring technologies applicable to the control of nuclear materials and their production. Since the International Atomic Energy Agency (IAEA) operates a multinational, on-site-inspector-based safeguards program in support of the Treaty on the Non-Proliferation of Nuclear Weapons (NPT), many (but not all) of the technologies reported in this document are in routine use or under development for IAEA safeguards.

  2. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  3. Brief Discussion on Green Building Materials

    Cai, Jia-wei; Sun, Jian

    2014-08-01

    With more and more emphasizes on the environment and resources, the concept of green buildings has been widely accepted. Building materials are vectors of architectures, only if green building materials and related technical means are used, can we construct green buildings to achieve the purpose of energy conservation and environmental protection. This paper introduces the relationship between green building materials and green buildings, the current situation of green building materials in China, as well as the measures to accelerate the development of green building materials.

  4. Materials for Powder-Based AC-Electroluminescence

    Hubert Schulze Dieckhoff

    2010-02-01

    Full Text Available At present, thick film (powder based alternating current electroluminescence (AC-EL is the only technology available for the fabrication of large area, laterally structured and coloured light sources by simple printing techniques. Substrates for printing may be based on flexible polymers or glass, so the final devices can take up a huge variety of shapes. After an introduction of the underlying physics and chemistry, the review highlights the technical progress behind this development, concentrating on luminescent and dielectric materials used. Limitations of the available materials as well as room for further improvement are also discussed.

  5. Materials, matter and particles a brief history

    Woolfson, Michael M

    2010-01-01

    This book traces the history of ideas about the nature of matter and also the way that mankind has used material resources that the world offers. Starting with the ideas of ancient civilizations that air, earth, fire and water were the basic ingredients of all matter, it traces the development of the science of chemistry beginning within the ranks of the alchemists. First, the idea of elements grew and then the atomic nature of matter was verified. Physicists had entered the scene, showing the nature of atoms in terms of fundamental particles and then introducing the concept of wave-particle d

  6. Measurement of AC losses in different former materials

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa

    1998-01-01

    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...... candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...

  7. 2003 research briefs : Materials and Process Sciences Center.

    Cieslak, Michael J.

    2003-08-01

    This report is the latest in a continuing series that highlights the recent technical accomplishments associated with the work being performed within the Materials and Process Sciences Center. Our research and development activities primarily address the materials-engineering needs of Sandia's Nuclear-Weapons (NW) program. In addition, we have significant efforts that support programs managed by the other laboratory business units. Our wide range of activities occurs within six thematic areas: Materials Aging and Reliability, Scientifically Engineered Materials, Materials Processing, Materials Characterization, Materials for Microsystems and Materials Modeling and Computational Simulation. We believe these highlights collectively demonstrate the importance that a strong materials-science base has on the ultimate success of the NW program and the overall DOE technology portfolio.

  8. 2004 research briefs :Materials and Process Sciences Center.

    Cieslak, Michael J.

    2004-01-01

    This report is the latest in a continuing series that highlights the recent technical accomplishments associated with the work being performed within the Materials and Process Sciences Center. Our research and development activities primarily address the materials-engineering needs of Sandia's Nuclear-Weapons (NW) program. In addition, we have significant efforts that support programs managed by the other laboratory business units. Our wide range of activities occurs within six thematic areas: Materials Aging and Reliability, Scientifically Engineered Materials, Materials Processing, Materials Characterization, Materials for Microsystems, and Materials Modeling and Simulation. We believe these highlights collectively demonstrate the importance that a strong materials-science base has on the ultimate success of the NW program and the overall DOE technology portfolio.

  9. 2005 Research Briefs : Materials and Process Sciences Center.

    Cieslak, Michael J.

    2005-05-01

    This report is the latest in a continuing series that highlights the recent technical accomplishments associated with the work being performed within the Materials and Process Sciences Center. Our research and development activities primarily address the materials-engineering needs of Sandia's Nuclear-Weapons (NW) program. In addition, we have significant efforts that support programs managed by the other laboratory business units. Our wide range of activities occurs within six thematic areas: Materials Aging and Reliability, Scientifically Engineered Materials, Materials Processing, Materials Characterization, Materials for Microsystems, and Materials Modeling and Simulation. We believe these highlights collectively demonstrate the importance that a strong materials-science base has on the ultimate success of the NW program and the overall DOE technology portfolio.

  10. Briefing material for congressional hearing : Laguna Atascosa Wilderness study area

    US Fish and Wildlife Service, Department of the Interior — This document is a memorandum alerting the director of the Bureau of Sport Fisheries and Wildlife that materials to assist in preparation for a congressional hearing...

  11. CAD/CAM (Computer Aided Design/Computer Aided Manufacture). A Brief Guide to Materials in the Library of Congress.

    Havas, George D.

    This brief guide to materials in the Library of Congress (LC) on computer aided design and/or computer aided manufacturing lists reference materials and other information sources under 13 headings: (1) brief introductions; (2) LC subject headings used for such materials; (3) textbooks; (4) additional titles; (5) glossaries and handbooks; (6)…

  12. AC Conductivity and Dielectric Relaxation Behavior of Sb2S3 Bulk Material

    Abd El-Rahman, K. F.; Darwish, A. A. A.; Qashou, Saleem I.; Hanafy, T. A.

    2016-07-01

    The Sb2S3 bulk material was used for next-generation anode for lithium-ion batteries. Alternative current (AC) conductivity, dielectric properties and electric modulus of Sb2S3 have been investigated. The measurements were carried out in the frequency range from 40 Hz to 5 MHz and temperature range from 293 K to 453 K. The direct current (DC) conductivity, σ DC, shows an activated behavior and the calculated activation energy is 0.50 eV. The AC conductivity, σ AC, was found to increase with the increase of temperature and frequency. The conduction mechanism of σ AC was controlled by the correlated barrier hopping model. The behavior of the dielectric constant, ɛ', and dielectric loss index, ɛ'', reveal that the polarization process of Sb2S3 is dipolar in nature. The behavior of both ɛ' and ɛ'' reveals that bulk Sb2S3 has no ferroelectric or piezoelectric phase transition. The dielectric modulus, M, gives a simple method for evaluating the activation energy of the dielectric relaxation. The calculated activation energy from M is 0.045 eV.

  13. Failure characteristics of Ag-SnO2 contact material in AC level

    MENG Fanbin; LU Jianguo; ZHU Yongqing; LU Ningyi; CHEN Zhichao; HUANG Qiutao

    2008-01-01

    The failure characteristics of the contact material Ag-SnO2 were investigated by X-ray diffraction (XRD),scanning electron microscopy (SEM),and X-ray energy dispersive spectroscopy (EDS).Phase analysis showed that there were Ag,SnO2,and Sn on the contact surfaces at the time of failure under the load condition of 30 A and 220 V (AC),which means that SnO2 decomposed in service.When the contacts were tested under airproof ambient condition,half-spherical bulges came into heing on the contact surfaces,which resulted in early failure and dispersive characteristics.But half-spherical bulges were not found when the contacts were tested under open ambient condition.The temperature change of the contacts during the life testing under airproof ambient condition was different from that under open ambient condition.

  14. Numerical simulation of ac conduction in three-dimensional heterogeneous materials

    Pazhoohesh, Elaheh; Hamzehpour, Hossein; Sahimi, Muhammad

    2006-05-01

    Three-dimensional wavelet transformations and a finite-volume method are combined to develop an efficient method for computing the effective frequency-dependent conductivity of three-dimensional (3D) disordered materials at low temperatures. Such computations have, in the past, been beset by numerical difficulties arising from the local conductivities g(r) varying over many orders of magnitude. A disordered matrerial is modeled by a 3D lattice, and it is assumed that conduction is thermally activated, so that g(r) is related to the activation energies which are distributed according to a probability distribution function (PDF). Five distinct PDF’s are used and, depending on the form of the PDF, the corresponding g(r) varies over 3-17 orders of magnitude. The ac conduction is simulated over 10 orders of magnitude variations in the frequency. The speedup in the computations is up to four orders of magnitude.

  15. δ-FeOOH: a superparamagnetic material for controlled heat release under AC magnetic field

    Chagas, Poliane; da Silva, Adilson Cândido; Passamani, Edson Caetano; Ardisson, José Domingos; de Oliveira, Luiz Carlos Alves; Fabris, José Domingos; Paniago, Roberto M.; Monteiro, Douglas Santos; Pereira, Márcio César

    2013-04-01

    Experimental evidences on its in vitro use reveal that δ-FeOOH is a material that release-controlled amount of heat if placed under an AC magnetic field. δ-FeOOH nanoparticles were prepared by precipitating Fe(OH)2 in alkaline solution followed by fast oxidation with H2O2. XRD and 57Fe Mössbauer spectroscopy data confirmed that δ-FeOOH is indeed the only iron-bearing compound in the produced sample. TEM images evidence that the averaged particle sizes for this δ-FeOOH sample is 23 nm. Magnetization measurements indicate that these δ-FeOOH particles behave superparamagnetically at 300 K; its saturation magnetization was found to be 13.2 emu g-1; the coercivity and the remnant magnetization were zero at 300 K. The specific absorption rate values at 225 kHz were 2.1, 6.2, and 34.2 W g-1, under 38, 64, and 112 mT, respectively. The release rate of heat can be directly controlled by changing the mass of δ-FeOOH nanoparticles. In view of these findings, the so-prepared δ-FeOOH is a real alternative to be further tested as a material for medical practices in therapies involving magnetic hyperthermia as in clinical oncology.

  16. {delta}-FeOOH: a superparamagnetic material for controlled heat release under AC magnetic field

    Chagas, Poliane; Candido da Silva, Adilson [ICEx, Universidade Federal de Minas Gerais, Departamento de Quimica (Brazil); Caetano Passamani, Edson [Universidade Federal do Espirito Santo, Departamento de Fisica (Brazil); Ardisson, Jose Domingos [Centro de Desenvolvimento da Tecnologia Nuclear (Brazil); Alves de Oliveira, Luiz Carlos [ICEx, Universidade Federal de Minas Gerais, Departamento de Quimica (Brazil); Domingos Fabris, Jose [Universidade Federal dos Vales do Jequitinhonha e Mucuri (UFVJM) (Brazil); Paniago, Roberto M. [ICEx, Universidade Federal de Minas Gerais, Departamento de Fisica (Brazil); Monteiro, Douglas Santos; Pereira, Marcio Cesar, E-mail: mcpqui@gmail.com [Instituto de Ciencia, Engenharia e Tecnologia, UFVJM (Brazil)

    2013-04-15

    Experimental evidences on its in vitro use reveal that {delta}-FeOOH is a material that release-controlled amount of heat if placed under an AC magnetic field. {delta}-FeOOH nanoparticles were prepared by precipitating Fe(OH){sub 2} in alkaline solution followed by fast oxidation with H{sub 2}O{sub 2}. XRD and {sup 57}Fe Moessbauer spectroscopy data confirmed that {delta}-FeOOH is indeed the only iron-bearing compound in the produced sample. TEM images evidence that the averaged particle sizes for this {delta}-FeOOH sample is 23 nm. Magnetization measurements indicate that these {delta}-FeOOH particles behave superparamagnetically at 300 K; its saturation magnetization was found to be 13.2 emu g{sup -1}; the coercivity and the remnant magnetization were zero at 300 K. The specific absorption rate values at 225 kHz were 2.1, 6.2, and 34.2 W g{sup -1}, under 38, 64, and 112 mT, respectively. The release rate of heat can be directly controlled by changing the mass of {delta}-FeOOH nanoparticles. In view of these findings, the so-prepared {delta}-FeOOH is a real alternative to be further tested as a material for medical practices in therapies involving magnetic hyperthermia as in clinical oncology.

  17. Organic Material Based Fluorescent Sensor for Hg(2+): a Brief Review on Recent Development.

    Saleem, Muhammad; Rafiq, Muhammad; Hanif, Muhammad

    2017-01-01

    Due to the deleterious effects of mercury on human health and natural ecosystems, high reactivity, non-degradability, extreme volatility and relative water and tissue solubility, it would consider as one of the most toxic environmental pollutants among the transition metals. In the present investigation, we have tried to summarized the several organic material based fluorescent sensor including rhodamine, boron-dipyrromethene (BODIPYs), thiourea, crown-ether, coumarine, squaraines, pyrene, imidazole, triazole, anthracene, dansyl, naphthalenedimide/ naphthalene/ naphthalimide, naphthyridine, iridium (III) complexes, polymeric materials, cyclodextrin, phthalic anhydride, indole, calix [4]arene, chromenone, 1,8-naphthalimides, lysine, styrylindolium, phenothiazine, thiocarbonyl quinacridone, oxadiazole, triphenylamine-triazines, tetraphenylethene, peptidyl and semicarbazone for the trace mercury detection in the aqueous, aqueous-organic and cellular media. The present review provides a brief look over the previous development in the organic material based fluorescent sensor for mercuric ion detection. Furthermore, the ligand-metal binding stoichiometry, binding/association/dissociation constants and the detection limit by the receptors have been particularly highlighted which might be useful for the future design and development of more sensitive and robust fluorescent chemosensor/chemodosimeter for the mercuric ion detection. Graphical Abstract Dummy.

  18. AC-13混合料矿料级配及特性试验研究%Research on AC-13 mixture mineral materials gradation and feature experiments

    何亦伟

    2016-01-01

    The paper adopts the Marshall method and Superpave method,undertakes the mixture design for AC-13Ⅰand AC-13,compares and analyzes the optimal asphalt volume and compaction features of the two,and points out the designed asphalt volumes has the same optimal asphalt and aggregate ratio,and the latter is superior to the former one in the aspect of compaction.%应用马歇尔法和Superpave法对AC-13Ⅰ和AC-13进行了混合料设计,对比分析了两者的最佳沥青用量及压实特性,指出两者的设计沥青用量在最佳油石比时基本相同,AC-13的压实特性优于AC-13Ⅰ.

  19. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  20. AC Humidity Sensing Properties of Mesoporous K2CO3-SiO2 Composite Materials

    Liang Guo

    2016-01-01

    Full Text Available The mesoporous silica SBA-15 and mesoporous K2CO3-SiO2 composite material were synthesized. Characterization of microstructure and morphology of materials indicated that the composite material had saved the porous framework of mesoporous silica SBA-15. Humidity sensing properties of different inverse proportion K2CO3-SiO2 composite material were studied and we found that the sample with 0.16 g/g K2CO3 exhibited excellent linearity in the wide humidity range. The complex impedance changed five orders of magnitude from 11% RH to 95% RH. The rapid response and recovery time were 10 s and 38 s, respectively. Finally a feasible ion transfer mechanism was brought forward to explain the sensing mechanism.

  1. The DOE Center of Excellence for the Synthesis and Processing of Advanced Materials: Research briefs

    NONE

    1996-01-01

    This publication is designed to inform present and potential customers and partners of the DOE Center of Excellence for the Synthesis and Processing of Advanced Materials about significant advances resulting from Center-coordinated research. The format is an easy-to-read, not highly technical, concise presentation of the accomplishments. Selected accomplishments from each of the Center`s seven initial focused projects are presented. The seven projects are: (1) conventional and superplastic forming; (2) materials joining; (3) nanoscale materials for energy applications; (4) microstructural engineering with polymers; (5) tailored microstructures in hard magnets; (6) processing for surface hardness; and (7) mechanically reliable surface oxides for high-temperature corrosion resistance.

  2. A Brief Assessment of Structural Composite Materials Research in Universities in the United States.

    1985-12-01

    composites. ’ 2. Improved techniques are strongly needed in nondestructive evaluation ( NDE ). 3. Combination of NDE , pattern recognition, artificial...Santa Barbara. California 93106 Dean, College of Engineering (905) 961-3141 August 20, 1985 9_. Dr. Ben Wilcox Assistant Director Materials Science

  3. Galvanic coupling between D6AC steel, 6061-T6 aluminum, Inconel 718 and graphite-epoxy composite material: Corrosion occurrence and prevention

    Danford, M. D.; Higgins, R. H.

    1983-01-01

    The effects of galvanic coupling between D6AC steel, 6061-T6 aluminum, Inconel 718, and graphite-epoxy composite material (G/E) in 3.5% NaCl were studied. Measurements of corrosion potentials, galvanic currents and corrosion rates of the bare metals using weight-loss methods served to establish the need for corrosion protection in cases where D6AC steel and 6061-T6 aluminum are galvanically coupled to G/E in salt water while Inconel 718 was shown to be compatible with G/E. Six tests were made to study corrosion protective methods for eliminating galvanic corrosion in the cases of D6AC steel and 6061-T6 aluminum coupled to G/E. These results indicate that, when the G/E is completely coated with paint or a paint/polyurethane resin combination, satisfactory protection of the D6AC steel is achieved with either a coat of zinc-rich primer or a primer/topcoat combination. Likewise, satisfactory corrosion protection of the aluminum is achieved by coating it with an epoxy coating system.

  4. A brief review on graphene/inorganic nanostructure composites: materials for the future

    Mitra, S.; Banerjee, S.; Datta, A.; Chakravorty, D.

    2016-09-01

    The exotic physical properties of graphene have led to intense research activities on the synthesis and characterization of graphene composites during the last decade. The methods developed for preparation of such materials and the different application areas are reviewed. Mainly the inorganic nanostructure/graphene composites have been discussed. The techniques of ex-situ and in-situ hybridization respectively, have been pointed out. Some of the application areas such as batteries, ultracapacitors for energy storage, fuel cells and solar cells for energy generation are discussed. The possible future directions of research are highlighted.

  5. Processing of Bulk YBa2Cu3O(7-x) High Temperature Superconductor Materials for Gravity Modification Experiments and Performance Under AC Levitation

    Koczor, Ronald; Noever, David; Hiser, Robert

    1999-01-01

    We have previously reported results using a high precision gravimeter to probe local gravity changes in the neighborhood of bulk-processed high temperature superconductor disks. Others have indicated that large annular disks (on the order of 25cm diameter) and AC levitation fields play an essential role in their observed experiments. We report experiments in processing such large bulk superconductors. Successful results depend on material mechanical characteristics, and pressure and heat treat protocols. Annular disks having rough dimensions of 30cm O.D., 7cm I.D. and 1 cm thickness have been routinely fabricated and tested under AC levitation fields ranging from 45 to 300OHz. Implications for space transportation initiatives and power storage flywheel technology will be discussed.

  6. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  7. Hydrogen storage studies on palladium-doped carbon materials (AC, CB, CNMs) @ metal-organic framework-5.

    Viditha, V; Srilatha, K; Himabindu, V

    2016-05-01

    Metal organic frameworks (MOFs) are a rapidly growing class of porous materials and are considered as best adsorbents for their high surface area and extraordinary porosity. The MOFs are synthesized by using various chemicals like triethylamine, terepthalic acid, zinc acetate dihydrate, chloroform, and dimethylformamide (DMF). Synthesized MOFs are intercalated with palladium/activated carbon, carbon black, and carbon nanomaterials by chemical reduction method for the purpose of enhancing the hydrogen adsorption capacities. We have observed that the palladium doped activated carbon on MOF-5 showed high hydrogen storage capacity. This may be due to the affinity of the palladium toward hydrogen molecule. The samples are characterized by X-ray diffraction, scanning electron microscopy (SEM), and Brunauer-Emmett-Teller (BET) surface area analysis. We have observed a clear decrease in the BET surface area and pore volume. The obtained results show a better performance for the synthesized sample. To our best knowledge, no one has reported the work on palladium-doped carbon materials (activated carbon, carbon black, carbon nanomaterials) impregnated to the metal-organic framework-5. We have attempted to synthesize carbon nanomaterials using indigenously fabricated chemical vapor deposition (CVD) unit as a support. We have observed an increase in the hydrogen storage capacities.

  8. Modelling of 0.5HP Induction Motor using AC Analysis Solver for Rotor Copper Bar material

    Ismail Daut

    2011-01-01

    Full Text Available In this paper a FEM model of a three phase 0.5HP squirrel-cage induction motor is modelled by using FEM software. The model is then used to analyze and investigate the performance of the induction machine using copper rotor bar compared to the conventional aluminium rotor bar material. Calculation using analytical tools could not calculate precisely the required parameters in order to obtain an optimal model to build a prototype model. That is why FEM software has been used to obtain the required data such as the torque vs. speed, torque vs. slip, power loss vs. speed and power loss vs. slip. This work gives some reviews of the advantages by substituting copper for aluminum in the rotor bar of squirrel cage induction motor as a main strategy toward reaching substantially higher efficiency.

  9. Brief analysis of conveying equipment for metallurgical raw materials%冶金企业物料输送设备浅析

    刘俊明

    2013-01-01

    物料输送设备是冶金生产企业中极其重要的机械设备,在企业的机械设备中占有很大的比例,在企业生产中起着十分关键的作用。文章对冶金企业中物料输送设备中的带式输送机、螺旋输送机、斗式提升机、大倾角皮带输送机、链式输送机的特点和使用情况进行分析,以利于冶金企业物料输送机械的选型和日常维护保养。%Raw material conveying equipment is of vital importance to metallurgical enterprises. In these enterprises, raw material conveying equipment makes up quite a large proportion of their mechanical equipment, and plays a critical role in their production process. This article provides a brief analysis of the characteristics and use of such metallurgical raw material conveying equipment as belt conveyors, screw conveyors, bucket elevators, large angle belt conveyors, chain conveyors so as to facilitate your selection and maintenance of metallurgical raw material conveying equipment.

  10. Brief Discussion on China's Green Building Materials%浅谈我国绿色建筑材料

    齐锋

    2014-01-01

    Starting from the deifnition of"green building material"and combining green materials in China, this paper elaborates what materials are "green materials"with whole lifecycle evaluation of building material as entry point, and finally it combines status quo of China's green building materials to proposes suggestion on development of China's green building. It hopes this paper would be beneficial for development of China's green building material market.%文章从“绿色建材”的定义出发,结合国内绿色建筑,以建筑材料的全寿命周期评价为切入点,详细阐述什么样的建筑材料是“绿色建材”,最后结合国内绿色建材的现状,对我国绿色建材的发展提出一点小小的建议,希望能对我国绿色建材市场的发展有所裨益。

  11. ENVIRONMENTAL RESEARCH BRIEF: USE OF CATIONIC SURFACTANTS TO MODIFY AQUIFER MATERIALS TO REDUCE THE MOBILITY OF HYDROPHOBIC ORGANIC COMPOUNDS

    Cationic surfactants can be used to modify surfaces of soils and subsurface materials to promote sorption of hydrophobic organic compounds (HOC) and retard their migration. For example, cationic surfactants could be injected into an aquifer downgradient from a source of HOC conta...

  12. Review—Multifunctional Materials for Enhanced Li-Ion Batteries Durability: A Brief Review of Practical Options

    Banerjee, Anjan; Shilina, Yuliya; Ziv, Baruch; Ziegelbauer, Joseph M.; Luski, Shalom; Aurbach, Doron; Halalay, Ion C.

    2017-01-01

    Transition metal (TM) ions dissolution from positive electrodes, migration to and deposition on negative electrodes, followed by Mn-catalyzed reactions of solvents and anions, with loss of Li+ ions, is a major degradation (DMDCR) mechanism in Li-ion batteries (LIBs) with spinel positive electrode materials. While the details of the DMDCR mechanism are still under debate, it is clear that HF and other acid species’ attack is the main cause in solutions with LiPF6 electrolyte. We first review the work on various mitigation measures for the DMDCR mechanism, now spanning more than two decades. We then discuss recent progress on our understanding of Mn species in electrolyte solutions and the extension of a mitigation measure first proposed by Tarascon and coworkers in 1999, namely chelation of TM cations, to Mn cation trapping, HF scavenging, and alkali metal ions dispensing multi-functional materials. We focus on practicable, drop-in technical solutions, based on placing such materials in the inter-electrode space, with significant benefits for LIBs performance: increased capacity retention during operation at room and above-ambient temperatures as well as robust (both maximally ionically conducting and electronically insulating) solid-electrolyte interfaces, having reduced charge transfer and film resistances at both negative and positive electrodes. We illustrate the multifunctional materials approach with both new and previously published data. We also discuss and offer our evaluation regarding the merits and drawbacks of the various mitigation measures, with an eye for practically relevant technical solutions capable to meet both the performance requirements and cost constraints for commercial LIBs, and end with recommendations for future work.

  13. A Brief Description of High Temperature Solid Oxide Fuel Cell’s Operation, Materials, Design, Fabrication Technologies and Performance

    Muneeb Irshad

    2016-03-01

    Full Text Available Today’s world needs highly efficient systems that can fulfill the growing demand for energy. One of the promising solutions is the fuel cell. Solid oxide fuel cell (SOFC is considered by many developed countries as an alternative solution of energy in near future. A lot of efforts have been made during last decade to make it commercial by reducing its cost and increasing its durability. Different materials, designs and fabrication technologies have been developed and tested to make it more cost effective and stable. This article is focused on the advancements made in the field of high temperature SOFC. High temperature SOFC does not need any precious catalyst for its operation, unlike in other types of fuel cell. Different conventional and innovative materials have been discussed along with properties and effects on the performance of SOFC’s components (electrolyte anode, cathode, interconnect and sealing materials. Advancements made in the field of cell and stack design are also explored along with hurdles coming in their fabrication and performance. This article also gives an overview of methods required for the fabrication of different components of SOFC. The flexibility of SOFC in terms fuel has also been discussed. Performance of the SOFC with varying combination of electrolyte, anode, cathode and fuel is also described in this article.

  14. AC 410 AC410 AC410 Unit 7 Homework Assignment

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  15. Brief communication: a pilot study: smooth surface early caries (caries incipiens) detection with KaVo DIAGNODent in historical material.

    Tomczyk, Jacek; Komarnitki, Iulian; Olczak-Kowalczyk, Dorota

    2013-03-01

    In many odontological studies concerning archeological material, there is no analysis of early caries lesions (caries incipiens) that manifest as a carious spot. At this stage of caries, the enamel is still hard, and thus, it is impossible to diagnose caries by visual methods. We assessed the usefulness of the DIAGNODent pen (DD laser) in analyzing noncavity lesions on the smooth surface sites of crowns from historical populations. Twenty-seven individuals were examined: 18 from Radom (Poland), and nine from Tell Masaikh and Terqa (Syria). A total of 562 teeth were characterized. The series represented different climatic zones, but were dated from the similar period, 18th to 19th century AD. We used four diagnostic techniques: visual, DD laser, radiographic, and histological as the gold standard. DD laser showed that the mean values of healthy enamel in both series did not exceed 15 units. The mean values of smooth and rough spots in the Syrian population were significantly higher than those from Poland. This study showed that all the noncarious spots from the Radom series did not exceed 30 units. In the Syrian samples, this limit was higher at 44 units. These results were confirmed by histology and radiography. The DD laser provided good results in detecting dentine carious lesions in historical material, but its efficiency in diagnosing early caries (caries incipiens) remains uncertain based on the presented series.

  16. Cobalt based layered perovskites as cathode material for intermediate temperature Solid Oxide Fuel Cells: A brief review

    Pelosato, Renato; Cordaro, Giulio; Stucchi, Davide; Cristiani, Cinzia; Dotelli, Giovanni

    2015-12-01

    Nowadays, the cathode is the most studied component in Intermediate Temperature-Solid Oxide Fuel Cells (IT-SOFCs). Decreasing SOFCs operating temperature implies slow oxygen reduction kinetics and large polarization losses. Double perovskites with general formula REBaCo2O5+δ are promising mixed ionic-electronic conductors, offering a remarkable enhancement of the oxygen diffusivity and surface exchange respect to disordered perovskites. In this review, more than 250 compositions investigated in the literature were analyzed. The evaluation was performed in terms of electrical conductivity, Area Specific Resistance (ASR), chemical compatibility with electrolytes and Thermal Expansion Coefficient (TEC). The most promising materials have been identified as those bearing the mid-sized rare earths (Pr, Nd, Sm, Gd). Doping strategies have been analyzed: Sr doping on A site promotes higher electrical conductivity, but worsen ASR and TECs; B-site doping (Fe, Ni, Mn) helps lowering TECs, but is detrimental for the electrochemical properties. A promising boost of the electrochemical activity is obtained by simply introducing a slight Ba under-stoichiometry. Still, the high sensitivity of the electrochemical properties against slight changes in the stoichiometry hamper a conclusive comparison of all the investigated compounds. Opportunities for an improvement of double perovskite cathodes performance is tentatively foreseen in combining together the diverse effective doping strategies.

  17. 一种空调交流接触器用AgNi触点材料的研究%AgNi Contact Material for AC Contactor of Air Conditioner

    2013-01-01

    AgNi contact materials used in AC contactors of air conditioners were introduced. Proper-ties of AgNi contact materials with different Ni contents and different types of additives were com-pared, including the physical properties, material losses, arc energy and welding force. Results show that, because of the requirements of high rated current and long service life, the optimum Ni content in AgNi contact materials for AC contactors of air conditioners is 15%. Meanwhile the addition of trace amounts of brittle substance will improve the electrical properties of AgNi materi-als.%  介绍了空调交流接触器用AgNi触点材料,比较了不同Ni含量和不同类型添加物的AgNi触点材料的力学物理性能、烧损量、燃弧能量以及熔焊力等。结果表明,对于额定电流大、电寿命要求高的空调接触器用AgNi触点材料,其最佳Ni含量为15%左右;添加微量脆性物质能改善AgNi触点材料的电性能。

  18. Buccal mucosa is a promising graft in Peyronie’s disease surgery. Our experience and a brief literature review on autologous grafting materials

    Andrea Fabiani

    2016-07-01

    Full Text Available Aim: Peyronie’s Disease (PD is an under reported acquired benign condition that, at the moment, is not curable with medical therapy. Surgery represent the gold standard of treatment. Surgical approaches are several and they consist in “plication techniques” or plaque incision/excision with grafting of resulting albuginea defect. Among grafting procedures, albuginea defect substitution with autologous materials demonstrated over the years not inferior results respect to heterologous grafts. Buccal mucosa graft (BMG is not usually emphasized in many review articles and clinical series are yet limited. Methods: We present our experience with seventeen plaque incision procedures and BMG in surgical correction of complex penile curvatures due to PD performed in a period of 30 months. Our analyses was focused on buccal mucosa graft characteristics as major determinant of the surgical success. We also conducted a brief literature review on autologous grafting materials used in reconstructive penile surgery for PD. Results: Our cosmetics and functional results consists in a 100% of functional penile straightening with no relapses and 5,8% of de novo erectile dysfunction. Mean age was 56.4 years, mean follow-up of 22.5 (6-36 months. No complications graft related were observed. Operative time was 115.3 minutes in mean. Over 94% of patients referred they were “really much better” and “much better” satisfied based on PGI-I questionnaire administrated at the last follow- up visit. Conclusion: BMG is revealing as an optimal choice for reconstructive surgery in PD. Anatomical characteristics consisting in the great elasticity, the quick integration time and the easy harvesting technique lead to high cosmetics and functional success rate, without omitting economical and invasiveness aspects.

  19. Memory effect in ac plasma displays

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  20. Peltier ac calorimeter

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  1. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  2. ACS: ALMA Common Software

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  3. Brief News

    2005-01-01

    Huamei RE High-tech Intending to Raise the Price of Mixed RE Carbonate Recently announced by Baotou Huamei Rare Earth High-tech Co., Ltd, since 12 May 2005, price of mixed rare earth carbonate was RMB$420 raised per ton. Thus factory price of RE carbonate per ton (REO 45%) approached RMB$4,900. By 2005, Chinese RE industry has experienced 4 years' downturn. Prices of various RE products continuously falling, contrast to endlessly price rising of raw materials, coal,

  4. Brief News

    2005-01-01

    Move of Baotou Research Institute of Rare EarthBaotou Research Institute of Rare Earth (abbreviated asBRIRE) was established in 1963. Over the past 40 years, it hasdeveloped into the largest science and technology researchinstitute on rare earth in China. BRIRE takes comprehensiveexploitation and utilization of rare earth resources as tenet,focusing on of RE metallurgy, environmental protectionand advanced RE performance materials, and application ofRE in traditional fields. BRIRE has made many significanta...

  5. Aislamiento acústico

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  6. The Problem with Briefs, in Brief

    Conaway, Carrie L.

    2013-01-01

    Policy briefs written by academics--the kind typically published in "Education Finance and Policy"--should be a crucial source of information for policy makers. Yet too frequently these briefs fail to garner the consideration they deserve. Their authors are too focused on the potential objections of their fellow academics, who are…

  7. AcEST: DK950971 [AcEST

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  8. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  9. AC-3 audio coder

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  10. AMAS Robotics Seminar Brief

    2011-07-19

    Unclassified Unclassified 19 July 2011 AMAS ROBOTICS SEMINAR BRIEF Aaron Hart, Product Integrator, RS JPO DISTRIBUTION STATEMENT A. Approved for...19-07-2011 to 19-07-2011 4. TITLE AND SUBTITLE robotics seminar brief 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6...12. DISTRIBUTION/AVAILABILITY STATEMENT Approved for public release; distribution unlimited 13. SUPPLEMENTARY NOTES AMAS ROBOTICS SEMINAR BRIEF 14

  11. Cyclotron and linac production of Ac-225.

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  12. Mississippi: State Policy Brief

    Corbett, Julie

    2014-01-01

    This brief is one in a series highlighting state policies, regulations, practices, laws, or other tools intended to create the necessary conditions for school and/or district turnaround. Each brief includes an overview of the relevant turnaround tool, its development process, its impact, and lessons learned that could assist other education…

  13. Strength of materials and theory of elasticity in 19th century Italy a brief account of the history of mechanics of solids and structures

    Capecchi, Danilo

    2015-01-01

    This book examines the theoretical foundations underpinning the field of strength of materials/theory of elasticity, beginning from the origins of the modern theory of elasticity. While the focus is on the advances made within Italy during the nineteenth century, these achievements are framed within the overall European context. The vital contributions of Italian mathematicians, mathematical physicists, and engineers in respect of the theory of elasticity, continuum mechanics, structural mechanics, the principle of least work, and graphical methods in engineering are carefully explained and discussed. The book represents a work of historical research that primarily comprises original contributions and summaries of work published in journals. It is directed at those graduates in engineering, but also in architecture, who wish to achieve a more global and critical view of the discipline and will also be invaluable for all scholars of the history of mechanics.

  14. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  15. Space charge and charge trapping characteristics of cross-linked polyethylene subjected to ac electric stresses

    Chong, Y. L.; Chen, G.; Miyake, H.; Matsui, K.; Tanaka, Y.; Takada, T.

    2006-04-01

    This paper reports on the result of space charge evolution in cross-linked polyethylene (XLPE) planar samples approximately 220 µm thick. The space charge measurement technique used in this study is the pulsed electroacoustic method. There are two phases to this experiment. In the first phase, the samples were subjected to dc 30 kVdc mm-1 and ac (sinusoidal) electric stress levels of 30 kVpk mm-1 at frequencies of 1, 10 and 50 Hz ac. In addition, ac space charge under 30 kVrms mm-1 and 60 kVpk mm-1 electric stress at 50 Hz was also investigated. The volts-off results showed that the amount of charge trapped in XLPE sample under dc electric stress is significantly bigger than samples under ac stress even when the applied ac stresses are substantially higher. The second phase of the experiment involves studying the dc space charge evolution in samples that were tested under ac stress during the first phase of the experiment. Ac ageing causes positive charge to become more dominant over negative charge. It was also discovered that ac ageing creates deeper traps, particularly for negative charge. This paper also gives a brief overview of the data processing methods used to analyse space charge under ac electric stress.

  16. 37 CFR 41.37 - Appeal brief.

    2010-07-01

    ... and the structure, material, or acts described in the specification as corresponding to each claimed... periods set forth in this section are extendable under the provisions of § 1.136 of this title for patent... time for filing an appeal brief is extendable under the provisions of § 1.136(a) of this title...

  17. Lecture notes on Elasto-plastic materials

    Hededal, Ole

    2007-01-01

    Brief introduction to material modelling within the framework of rate independent elasto-plastic constitutive modelling......Brief introduction to material modelling within the framework of rate independent elasto-plastic constitutive modelling...

  18. AC Optimal Power Flow

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  19. Single-Phase Direct AC-AC Boost Converter

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  20. Cybernetics of Brief Family Therapy.

    Keeney, Bradford P.; Ross, Jeffrey M.

    1983-01-01

    Presents a cybernetic view of brief family therapy. Includes a historical discussion of the key ideas underlying brief family therapy, a cybernetic model of therapeutic change, and a clinical case for exemplification. (Author/JAC)

  1. Alternating current(AC) corrosion analyzed by electrochemical impedance spectroscopy

    Ha, Tae Hyun; Kim, Dae Kyeong; Bae, Jeong Hyo; Lee, Hyun Goo; Lee, Sung Jin [Korea Electrotechnology Research Institute, Changwon (Korea, Republic of)

    2002-12-15

    So far, many research results on AC corrosion have been reported but each one is not consistent with another. In order to understand the characteristics and factors affecting on AC corrosion, Electrochemical impedance spectroscopy (E.I.S) was used and changes in kinetics and surface properties was analyzed. Generally, E.I.S. test has been used mainly for the diagnosis of the concrete corrosion and coating material. However, considering the outstanding functions of E.I.S. test, it can be adopted as a good method to study AC corrosion. Electrolyte resistance (R{sub sol}), double layer capacitance (C{sub dl}) and polarization resistance (R{sub p}) are the basic circuit elements. Using the model which is consist of these basic elements, various results of E.I.S. test can be interpreted. And through this method the mechanism and characteristics of AC corrosion can be explained

  2. New Composites LnBDC@AC and CB[6]@AC: From Design toward Selective Adsorption of Methylene Blue or Methyl Orange

    Santos, Guilherme de C.; Barros, Amanda L.; de Oliveira, Carlos A. F.; da Luz, Leonis L.; da Silva, Fausthon F.; Demets, Grégoire J.-F.; Alves Júnior, Severino

    2017-01-01

    New porous composites LnBDC@AC (AC = Activated carbon, Ln = Eu and Gd and BDC = 1,4-benzenedicaboxylate) and CB[6]@AC (CB[6] = Cucurbit[6]uril) were obtained using hydrothermal route. The LnBDC and CB[B] are located inside the pore of the carbon materials as was observed in SEM-EDS, XRPD and FT-IR analysis. Porosimetry analysis showed values typically between AC and LnBDC material, with pore size and surface area, respectively, 29,56 Å and 353.98 m2g-1 for LnBDC@AC and 35,53 Å and 353.98 m2g-1 for CB[6]@AC. Both materials showed good absorptive capacity of metil orange (MO) and methylene blue (MB) with selectivity as a function of pH. For acid pH, both materials present selectivity by MB and alkaline pH for MO, with notable performance for CB[6]@AC. Additionally, europium luminescence was used as structural probe to investigate the coordination environment of Eu3+ ions in the EuBDC@AC composite after adsorption experiment. PMID:28107440

  3. Brief therapy: focused solution development.

    De Shazer, S; Berg, I K; Lipchik, E; Nunnally, E; Molnar, A; Gingerich, W; Weiner-Davis, M

    1986-06-01

    This article describes the form of brief therapy developed at the Brief Family Therapy Center. We have chosen a title similar to Weakland, Fisch, Watzlawick, and Bodin's classic paper, "Brief Therapy: Focused Problem Resolution" (20) to emphasize our view that there is a conceptual relationship and a developmental connection between the points of view expressed in the two papers.

  4. ACS CCD Stability Monitor

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  5. Using AC Motors in Robotics

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  6. Anthropic Rock: a brief history

    R. B. Cathcart

    2011-03-01

    Full Text Available Stone tool-making is a reductive process. Synthetic rock manufacturing, preeminently an additive process, will not for-ever be confined to only the Earth-biosphere. This brief focuses on humanity's ancient past, hodiernal and possible future even more massive than present-day creation of artificial rocks within our exploitable Solar System. It is mostly Earth-centric account that expands the factual generalities underlying the unique non-copyrighted systemic technogenic rock classification first publicly presented (to the American Geological Society during 2001, by its sole intellectual innovator, James Ross Underwood, Jr. His pioneering, unique exposition of an organization of this ever-increasingly important aspect of the Anthropic Rock story, spatially expansive material lithification, here is given an amplified discussion for the broader geo and space science social group-purpose of encouragement of a completer 21st Century treatment of Underwood's explicative subject-chart (Fig. 2.

  7. Desorden Deficitario de la Atencion. Segunda Edicion. NICHCY Briefing Paper [and] El Desorden Deficitario de la Atencion: Una Bibliografia de Materiales en Ingles y Espanol (Attention Deficit Disorder. Second Edition. NICHCY Briefing Paper [and] Attention Deficit Disorder: A Bibliography of Materials in English and Spanish).

    Fowler, Mary

    This briefing paper uses a question-and-answer format to provide basic information about children with attention deficit disorder (ADD). Questions address the following concerns: nature and incidence of ADD; causes of ADD; signs of ADD (impulsivity, hyperactivity, disorganization, social skill deficits); the diagnostic ADD assessment; how to…

  8. ACS Updates Environmental Report.

    Chemical and Engineering News, 1978

    1978-01-01

    Describes a new publication of a report prepared by the American Chemical Society's Committee on Environmental Improvement. This is a new version that updates a 1969 report and contains additional material and expanded recommendations. (GA)

  9. My brief history

    Hawking, Stephen

    2013-01-01

    My Brief History recounts Stephen Hawking’s improbable journey, from his postwar London boyhood to his years of international acclaim and celebrity. Lavishly illustrated with rarely seen photographs, this concise, witty, and candid account introduces readers to a Hawking rarely glimpsed in previous books: the inquisitive schoolboy whose classmates nicknamed him Einstein; the jokester who once placed a bet with a colleague over the existence of a particular black hole; and the young husband and father struggling to gain a foothold in the world of physics and cosmology. Writing with characteristic humility and humor, Hawking opens up about the challenges that confronted him following his diagnosis of ALS at age twenty-one. Tracing his development as a thinker, he explains how the prospect of an early death urged him onward through numerous intellectual breakthroughs, and talks about the genesis of his masterpiece A Brief History of Time—one of the iconic books of the twentieth century.

  10. Partial AC-coupling minigrids

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  11. A Brief Report

    Ali, Ather; Vitulano, Lawrence A.

    2010-01-01

    The 2010 Yale Research Symposium on Complementary and Integrative Medicine highlighted original research in related areas by Yale faculty and provided a forum to discuss and debate issues of evidence and plausibility. In this brief report, we describe selected presentations on such diverse foci as nutritional influences on cancer, acupuncture for low back pain, protein intake’s effects on bone consumption, Chinese herb-derived adjuvant chemotherapy, and the relationship between anger and card...

  12. Electricity Storage. Technology Brief

    Simbolotti, G. [Italian National Agency for New Technologies, Energy and Sustainable Economic Development ENEA, Rome (Italy); Kempener, R. [International Renewable Energy Agency IRENA, Bonn (Germany)

    2012-04-15

    Electricity storage is a key technology for electricity systems with a high share of renewables as it allows electricity to be generated when renewable sources (i.e. wind, sunlight) are available and to be consumed on demand. It is expected that the increasing price of fossil fuels and peak-load electricity and the growing share of renewables will result in electricity storage to grow rapidly and become more cost effective. However, electricity storage is technically challenging because electricity can only be stored after conversion into other forms of energy, and this involves expensive equipment and energy losses. At present, the only commercial storage option is pumped hydro power where surplus electricity (e.g. electricity produced overnight by base-load coal or nuclear power) is used to pump water from a lower to an upper reservoir. The stored energy is then used to produce hydropower during daily high-demand periods. Pumped hydro plants are large-scale storage systems with a typical efficiency between 70% and 80%, which means that a quarter of the energy is lost in the process. Other storage technologies with different characteristics (i.e. storage process and capacity, conversion back to electricity and response to power demand, energy losses and costs) are currently in demonstration or pre-commercial stages and discussed in this brief report: Compressed air energy storage (CAES) systems, Flywheels; Electrical batteries; Supercapacitors; Superconducting magnetic storage; and Thermal energy storage. No single electricity storage technology scores high in all dimensions. The technology of choice often depends on the size of the system, the specific service, the electricity sources and the marginal cost of peak electricity. Pumped hydro currently accounts for 95% of the global storage capacity and still offers a considerable expansion potential but does not suit residential or small-size applications. CAES expansion is limited due to the lack of suitable

  13. Composite Based EHV AC Overhead Transmission Lines

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  14. Materials

    Glaessgen, Edward H.; Schoeppner, Gregory A.

    2006-01-01

    NASA Langley Research Center has successfully developed an electron beam freeform fabrication (EBF3) process, a rapid metal deposition process that works efficiently with a variety of weldable alloys. The EBF3 process can be used to build a complex, unitized part in a layer-additive fashion, although the more immediate payoff is for use as a manufacturing process for adding details to components fabricated from simplified castings and forgings or plate products. The EBF3 process produces structural metallic parts with strengths comparable to that of wrought product forms and has been demonstrated on aluminum, titanium, and nickel-based alloys to date. The EBF3 process introduces metal wire feedstock into a molten pool that is created and sustained using a focused electron beam in a vacuum environment. Operation in a vacuum ensures a clean process environment and eliminates the need for a consumable shield gas. Advanced metal manufacturing methods such as EBF3 are being explored for fabrication and repair of aerospace structures, offering potential for improvements in cost, weight, and performance to enhance mission success for aircraft, launch vehicles, and spacecraft. Near-term applications of the EBF3 process are most likely to be implemented for cost reduction and lead time reduction through addition of details onto simplified preforms (casting or forging). This is particularly attractive for components with protruding details that would require a significantly large volume of material to be machined away from an oversized forging, offering significant reductions to the buy-to-fly ratio. Future far-term applications promise improved structural efficiency through reduced weight and improved performance by exploiting the layer-additive nature of the EBF3 process to fabricate tailored unitized structures with functionally graded microstructures and compositions.

  15. AC electrophoretic deposition of organic-inorganic composite coatings.

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials.

  16. Power-supply-operations group-training programs, ac/dc power systems and micellaneous information

    Harris, C A

    1978-06-30

    This program introduces the technician to three phase a-c power and its relationship to rectifier power conversion systems. A brief introduction is given as to the engineering significance of various parameters such as, phase rotation, ac power relationships, harmonics, transformer voltage vectors, rectifier parameters, filters, water cooling, phase delayed triggers to SCR's, dielectric stress vs life and other related subjects. The significance of the details as they apply to various diagnostic problems that a technician may be called upon to solve is emphasized. Reference CAPE-2747.

  17. A Brief Report

    Ali, Ather; Vitulano, Lawrence A.

    2010-01-01

    The 2010 Yale Research Symposium on Complementary and Integrative Medicine highlighted original research in related areas by Yale faculty and provided a forum to discuss and debate issues of evidence and plausibility. In this brief report, we describe selected presentations on such diverse foci as nutritional influences on cancer, acupuncture for low back pain, protein intake’s effects on bone consumption, Chinese herb-derived adjuvant chemotherapy, and the relationship between anger and cardiac arrhythmia. This symposium demonstrated that rigorous research methods are being used to study unconventional therapies and that an integrative medicine approach requires a solid scientific foundation. PMID:20885898

  18. Brief resolved unexplained event

    Arane, Karen; Claudius, Ilene; Goldman, Ran D.

    2017-01-01

    Abstract Question For many years, the term apparent life-threatening event (ALTE) was associated with sudden infant death syndrome, and parents who described an acute event in their infants were sent to the hospital for admission. I understand that for infants new terminology is recommended. What is the current approach to a near-death experience of an infant? Answer A recent clinical practice guideline revised the name and definition of an ALTE to a brief resolved unexplained event (BRUE). The diagnosis of BRUE in infants younger than 1 year of age is made when infants experience 1 of the following BRUE symptoms: a brief episode (ie, less than 1 minute and usually less than 20 to 30 seconds) that is entirely resolved (infant is at baseline), which remains unexplained after the history and physical examination are completed, and includes an event characterized by cyanosis or pallor; absent, decreased, or irregular breathing; hypertonia or hypotonia; or altered responsiveness. Low-risk infants should not be admitted to the hospital and overtesting is discouraged. PMID:28115439

  19. Hopping models and ac universality

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  20. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  1. AC410 Unit 9 Assignment

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  2. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  3. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  4. AcEST: BP917259 [AcEST

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  5. AcEST: BP921446 [AcEST

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  6. AcEST: DK943932 [AcEST

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  7. AcEST: DK963222 [AcEST

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  8. AcEST: DK953266 [AcEST

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  9. 17 CFR 9.23 - Answering brief.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Answering brief. 9.23 Section... Appeals § 9.23 Answering brief. (a) Time for filing answering brief. Within thirty days after service of the appeal brief, the exchange must file with the Commission an answering brief. (b) Contents...

  10. 24 CFR 1720.615 - Reply brief.

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Reply brief. 1720.615 Section 1720... Proceedings Appeals § 1720.615 Reply brief. A brief in reply to an answering brief, limited to rebuttal of matters in the answering brief, may be filed and served by a party within 7 days after receipt of...

  11. Brief encounter networks

    Kostakos, Vassilis; Penn, Alan

    2007-01-01

    Many complex human and natural phenomena can usefully be represented as networks describing the relationships between individuals. While these relationships are typically intermittent, previous research has used network representations that aggregate the relationships at discrete intervals. However, such an aggregation discards important temporal information, thus inhibiting our understanding of the networks dynamic behaviour and evolution. We have recorded patterns of human urban encounter using Bluetooth technology thus retaining the temporal properties of this network. Here we show how this temporal information influences the structural properties of the network. We show that the temporal properties of human urban encounter are scale-free, leading to an overwhelming proportion of brief encounters between individuals. While previous research has shown preferential attachment to result in scale-free connectivity in aggregated network data, we found that scale-free connectivity results from the temporal prope...

  12. SOHO Mission Science Briefing

    1995-01-01

    Footage shows the SOHO Mission Pre-Launch Science Briefing. The moderator of the conference is Fred Brown, NASA/GSFC Public Affairs, introduces the panel members. Included are Professor Roger Bonnet, Director ESA Science Program, Dr. Wesley Huntress, Jr., NASA Associate Administrator for Space Science and Dr. Vicente Domingo, ESA SOHO Project Scientist. Also present are several members from the SOHO Team: Dr. Richard Harrison, Art Poland, and Phillip Scherrer. The discussions include understanding the phenomena of the sun, eruption of gas clouds into the atmosphere, the polishing of the mirrors for the SOHO satellite, artificial intelligence in the telescopes, and the launch and operating costs. The panel members are also seen answering questions from various NASA Centers and Paris.

  13. ACS from development to operations

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  14. Galileo Mission Science Briefing

    1989-07-01

    The first of two tapes of the Galileo Mission Science press briefing is presented. The panel is moderated by George Diller from the Kennedy Space Center (KSC) Public Affairs Office. The participants are John Conway, the director of Payload and operations at Kennedy; Donald E. Williams, Commander of STS-43, the shuttle mission which will launch the Galileo mission; John Casani, the Deputy Assistant Director of Flight Projects at the Jet Propulsion Lab (JPL); Dick Spehalski, Galileo Project Manager at JPL; and Terrence Johnson, Galileo Project Scientist at JPL. The briefing begins with an announcement of the arrival of the Galileo Orbiter at KSC. The required steps prior to the launch are discussed. The mission trajectory and gravity assists from planetary and solar flybys are reviewed. Detailed designs of the orbiter are shown. The distance that Galileo will travel from the sun precludes the use of solar energy for heat. Therefore Radioisotope heater units are used to keep the equipment at operational temperature. A video of the arrival of the spacecraft at KSC and final tests and preparations is shown. Some of the many science goals of the mission are reviewed. Another video showing an overview of the Galileo mission is presented. During the question and answer period, the issue of the use of plutonium on the mission is broached, which engenders a review of the testing methods used to ensure the safety of the capsules containing the hazardous substance. This video has actual shots of the orbiter, as it is undergoing the final preparations and tests for the mission.

  15. Inclusive Briefing and User Involvement

    Jensen, Per Anker

    2011-01-01

    Briefing is not just about specifying needs as requirements but also about evaluating how well design proposals fulfil needs and aspirations. Furthermore, briefing is not only about building design. Briefing starts at the preproject stage to create a basis for the project decision and can include...... a number of different processes with varying purposes before and during the design and construction activities. Thus, briefing can be regarded as a continuous process but it should also be an inclusive and interactive process with the involvement of all stakeholders, including end users. This article...... includes a literature study on briefing and user involvement in building projects, and presents a case study of a major building project of a new headquarters and media centre for the Danish Broadcasting Corporation in Copenhagen. The building project was actively used as part of a corporate change process...

  16. NASA Tech Briefs, February 2009

    2009-01-01

    Tech Briefs are short announcements of innovations originating from research and development activities of the National Aeronautics and Space Administration. They emphasize information considered likely to be transferable across industrial, regional, or disciplinary lines and are issued to encourage commercial application. Topics covered include: Measuring Low Concentrations of Liquid Water in Soil; The Mars Science Laboratory Touchdown Test Facility; Non-Contact Measurement of Density and Thickness Variation in Dielectric Materials; Compact Microwave Fourier Spectrum Analyzer; InP Heterojunction Bipolar Transistor Amplifiers to 255 GHz; Combinatorial Generation of Test Suites; In-Phase Power-Combined Frequency Tripler at 300 GHz; Electronic System for Preventing Airport Runway Incursions; Smaller but Fully Functional Backshell for Cable Connector; Glove-Box or Desktop Virtual-Reality System; Composite Layer Manufacturing with Fewer Interruptions; Improved Photoresist Coating for Making CNT Field Emitters; A Simplified Diagnostic Method for Elastomer Bond Durability; Complex Multifunctional Polymer/Carbon-Nanotube Composites; Very High Output Thermoelectric Devices Based on ITO Nanocomposites; Reducing Unsteady Loads on a Piggyback Miniature Submarine; Ultrasonic/Sonic Anchor; Grooved Fuel Rings for Nuclear Thermal Rocket Engines; Pulsed Operation of an Ion Accelerator; Autonomous Instrument Placement for Mars Exploration Rovers; Mission and Assets Database; TCP/IP Interface for the Satellite Orbit Analysis Program (SOAP); Trajectory Calculator for Finite-Radius Cutter on a Lathe; Integrated System Health Management Development Toolkit.

  17. Multifunctional Metallosupramolecular Materials

    2011-02-28

    University, Dallas, Texas Invited Lecture: Supramolecular Chemistry in Polymeric Systems: From Nanoassemblies to Dynamic Materials Aug 2009 ACS Fall...Supramolecular Chemistry in Polymeric Systems: From Nanoassemblies to Dynamic Materials April 2009 University of Michigan, Ann Arbour, Michigan Invited... Nanoassemblies to Dynamic Materials Sept 2008 College of Wooster, Department of Chemistry Invited Lecture: Supramolecular Polymer Chemistry: A Route to

  18. AcEST: DK954361 [AcEST

    Full Text Available nin T, cardiac muscle OS=Homo sapiens... 35 0.27 sp|P98193|DMP1_RAT Dentin matrix...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac...EEDAEAEAETEETRAEEDEEEEEAKEAEDG 68 Query: 329 PADQETP 349 P ++ P Sbjct: 69 PMEESKP 75 >sp|P98193|DMP1_RAT Dentin

  19. AcEST: DK956827 [AcEST

    Full Text Available n, cytoplasmic 1 OS=Salmo salar GN=AC... 389 e-107 tr|B3TH90|B3TH90_POERE Beta-actin OS=Poecilia reticulata ...PE=2 SV=1 389 e-107 tr|B3TH89|B3TH89_POERE Beta-actin OS=Poecilia reticulata PE=4 SV=1 389 e-107 tr|B3GLI4|B

  20. AcEST: DK943965 [AcEST

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  1. The AC and DC Conductivity of Nanocomposites

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  2. AC dynamometer; Koryu dinamo meter

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  3. Blades and discs in gas turbines. Behaviour of material and components. Project department A-C. Final report; Schaufeln und Scheiben in Gasturbinen. Werkstoff- und Bauteilverhalten. Projektbereiche A bis C. Abschlussbericht

    NONE

    1997-04-01

    The special research area 339 `Blades and discs in gas turbines, behaviour of material and components` was carried on from 1988 to the end of 1196. This final report deals with the work in the years 1994, 1995 and 1996. In the project area A `Development of material` manufacturing processes both for metallic and ceramic high temperature materials were developed, tested and optimised. In the area of optimising casting structure, it was shown that the making grains finer up to the medium temperature range can be a suitable means for significantly raising the resistance to LCF loading with nearly unchanged heat and creep strength properties. Another main point was the characterisation and optimisation of sprayed ceramic layers on metallic substrates (heat insulating layers) and compound ceramic materials. In project area B `Material behaviour` the mechanisms were studied, which, particularly in metallic high temperature materials such as nickel-based superalloys, lead to failure of the material under thermo-mechanical stresses. In project area C `Component design`, on the one hand models for estimating service life for metallic high temperature materials under different thermo-mechanical stresses were developed. [Deutsch] Der Sonderforschungsbereich 339, `Schaufeln und Scheiben in Gasturbinen - Werkstoff- und Bauteilverhalten` wurde von 1988 bis Ende 1996 gefoerdert. Dieser Abschlussbericht behandelt die Arbeiten der Jahre 1994, 1995 und 1996. Im Projektbereich A `Werkstoffentwicklung` wurden Herstellungsverfahren sowohl fuer metallische als auch fuer keramische Hochtemperaturwerkstoffe entwickelt, erprobt und optimiert. Auf dem Gebiet der Gussgefuegeoptimierung konnte gezeigt werden, dass die Kornfeinung bis in den mittleren Temperaturbereich ein geeignetes Mittel sein kann, um den Widerstand gegen LCF-Belastung bei annaehernd unveraenderten Warm- und Kriechfestigkeitseigenschaften signifikant zu erhoehen. Einen weiteren Schwerpunkt bildete die Charakterisierung und

  4. A brief image-based prevention intervention for adolescents.

    Werch, Chudley E Chad; Bian, Hui; Diclemente, Carlo C; Moore, Michelle J; Thombs, Dennis; Ames, Steven C; Huang, I-Chan; Pokorny, Steven

    2010-03-01

    The authors evaluated the efficacy of a brief image-based prevention intervention and assessed current drug use as a moderator of intervention effects. In a clinical trial, 416 high school-age adolescents were randomized to either the brief intervention or usual care control, with data collected at baseline and 3-month follow-up. The brief intervention consisted of a tailored in-person communication and a series of parent/guardian print materials based on the behavior-image model. Health behavior goal setting increased for participants receiving the brief intervention, with an effect size in the small range (d = 0.33). Overall effect sizes for cigarette smoking frequency and quantity and alcohol use frequency and quantity were small (ds = 0.16-0.21) and in favor of the brief intervention. However, adolescents reporting current substance use who received the brief intervention reduced their frequency and heavy use of alcohol, frequency and quantity of cigarette smoking, and reported fewer alcohol/drug problems, with larger effects ranging from small to approaching medium in size (ds = 0.32-0.43, ps goal setting and reduce substance use, particularly among drug-using older adolescents.

  5. Neuroophthalmology A brief Vademecum

    Schwarz, Urs E-mail: us@neurol.unizh.ch

    2004-01-01

    The stunning, intricate interaction between the visual, vestibular and optomotor systems--each a miracle on its own--ensures maintenance of orientation in space as well as visual recognition and target selection despite a host of sensory conflicts and adversary disturbances. Their main goals are to keep a target of interest on the fovea by either maintaining or shifting the direction of gaze in order to produce an accurate internal representation of the visual surroundings, in particular the selected target, and to continuously mirror the spatial relationship between these various visual elements and the self. Not surprising, the implementation of this host of elaborate neural networks encompasses almost every part of the brain, including the brainstem, cerebellum, extrapyramidal system and many areas of the cerebral cortex. Thus far, these systems are among the best investigated in brain research; and enormous knowledge was amassed over the last century employing a variety of techniques, including single cell recordings, eye movement studies, functional imaging and neuropsychological observations. In addition, this prolific line of research has enlightened many fundamental principles of neural and neuronal processing, which have subsequently enriched other fields of brain research as well as computational neuroscience, e.g. the discovery of receptive fields, which have now become a ubiquitous concept in many other areas of neurophysiology. This (improperly) brief, fractional and undoubtedly biased Vademecum is meant to accompany the reader into this marvellous field of neurophysiology and neurology. In particular, it stresses the clinical application of its functional neuroanatomy at the bedside, which, in many respects, is superior to other means of investigating a patient.

  6. Neuroophthalmology: a brief Vademecum.

    Schwarz, Urs

    2004-01-01

    The stunning, intricate interaction between the visual, vestibular and optomotor systems--each a miracle on its own--ensures maintenance of orientation in space as well as visual recognition and target selection despite a host of sensory conflicts and adversary disturbances. Their main goals are to keep a target of interest on the fovea by either maintaining or shifting the direction of gaze in order to produce an accurate internal representation of the visual surroundings, in particular the selected target, and to continuously mirror the spatial relationship between these various visual elements and the self. Not surprising, the implementation of this host of elaborate neural networks encompasses almost every part of the brain, including the brainstem, cerebellum, extrapyramidal system and many areas of the cerebral cortex. Thus far, these systems are among the best investigated in brain research; and enormous knowledge was amassed over the last century employing a variety of techniques, including single cell recordings, eye movement studies, functional imaging and neuropsychological observations. In addition, this prolific line of research has enlightened many fundamental principles of neural and neuronal processing, which have subsequently enriched other fields of brain research as well as computational neuroscience, e.g. the discovery of receptive fields, which have now become a ubiquitous concept in many other areas of neurophysiology. This (improperly) brief, fractional and undoubtedly biased Vademecum is meant to accompany the reader into this marvellous field of neurophysiology and neurology. In particular, it stresses the clinical application of its functional neuroanatomy at the bedside, which, in many respects, is superior to other means of investigating a patient.

  7. 24 CFR 1720.610 - Answering brief.

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Answering brief. 1720.610 Section... Proceedings Appeals § 1720.610 Answering brief. Within 20 days after service of an appeal brief upon a party, such party may file an answering brief conforming to the requirements of § 1720.620....

  8. 17 CFR 171.26 - Answering brief.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Answering brief. 171.26... Denial and Registration Actions § 171.26 Answering brief. (a) Time for filing answering brief. Within thirty days after service of the apeal brief, the National Futures Association shall file with...

  9. 37 CFR 41.71 - Rebuttal brief.

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Rebuttal brief. 41.71 Section... Rebuttal brief. (a) Within one month of the examiner's answer, any appellant may once file a rebuttal brief. (b)(1) The rebuttal brief of the owner may be directed to the examiner's answer and/or any...

  10. Brief Articles for Latino Parents, 1999 Edition.

    ERIC Clearinghouse on Rural Education and Small Schools, Charleston, WV.

    This packet contains six briefs developed specifically for Spanish-speaking Latino parents, and English translations of the briefs. These briefs state what researchers and practitioners have learned about various ways parents can help their children do well in school. Earlier editions of brief articles for parents have been used in various ways by…

  11. AcEST: DK943968 [AcEST

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  12. AcEST: DK954735 [AcEST

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  13. NASA Tech Briefs, February 2012

    2012-01-01

    This issue contains the following briefs: (1) Optical Comb from a Whispering Gallery Mode Resonator for Spectroscopy and Astronomy Instruments Calibration (2) Real-Time Flight Envelope Monitoring System (3) Nemesis Autonomous Test System (4) Mirror Metrology Using Nano-Probe Supports (5) Automated Lab-on-a-Chip Electrophoresis System (6) Techniques for Down-Sampling a Measured Surface Height Map for Model Validation (7) Multi-Component, Multi-Point Interferometric Rayleigh/Mie Doppler Velocimeter (8) Frequency to Voltage Converter Analog Front-End Prototype (9) Dust-Tolerant Intelligent Electrical Connection System (10) Gigabit Ethernet Asynchronous Clock Compensation FIFO (11) High-Speed, Multi-Channel Serial ADC LVDS Interface for Xilinx Virtex-5 FPGA (12) Glovebox for GeoLab Subsystem in HDU1-PEM (13) Modified Process Reduces Porosity when Soldering in Reduced Gravity Environments (14) Use of Functionalized Carbon Nanotubes for Covalent Attachment of Nanotubes to Silicon (15) Flexible Plug Repair for Shuttle Wing Leading Edge (16) Three Dimensionally Interlinked, Dense, Solid Form of Single-Walled CNT Ropes (17) Axel Robotic Platform for Crater and Extreme Terrain Exploration (18) Site Tamper and Material Plow Tool - STAMP (19) Magnetic Interface for Segmented Mirror Assembly (20) Transpiration-Cooled Spacecraft-Insulation-Repair Fasteners (21) Fluorescence-Based Sensor for Monitoring Activation of Lunar Dust (22) Aperture Ion Source (23) Virtual Ultrasound Guidance for Inexperienced Operators (24) Model-Based Fault Diagnosis: Performing Root Cause and Impact Analyses in Real Time (25) Interactive Schematic Integration Within the Propellant System Modeling Environment (26) Magnetic and Electric Field Polarizations of Oblique Magnetospheric Chorus Waves (27) Variable Sampling Mapping.

  14. Assessment of a Brief Oral Presentation Assignment in Biopsychology

    Sleigh, Merry J.

    2013-01-01

    This study examined the suitability of a brief oral presentation exercise as an assessment method in biopsychology. Undergraduate students researched and presented a five-minute, self-selected fact related to course material, allowing them to practice oral communication skills, such as clearly explaining and carefully listening. Biopsychology…

  15. Towards the european strategy for particle physics : The briefing book

    Akesson, T.; Aleksan, R.; Allanach, B.; Bertolucci, S.; Blondel, A.; Butterworth, J.; Cavalli-Sforza, M.; Cervera, A.; de Naurois, M.; Desch, K.; Egede, U.; Heuer, R.; Hoecker, A.; Huber, P.; Jungmann, K.; Linde, F.; Lombardi, A.; Mangano, M.; Mezzetto, M.; Onderwater, G.; Palanque-Delabrouille, N.; Peach, K.; Polosa, A.; Rondio, E.; Webber, B.; Weiglein, G.; Womersley, J.

    2007-01-01

    This document was prepared as part of the briefing material for the Workshop of the CERN Council Strategy Group, held in DESY Zeuthen from 2nd to 6th May 2006. It gives an overview of the physics issues and of the technological challenges that will shape the future of the field, and incorporates mat

  16. Digital Textbooks. Research Brief

    Johnston, Howard

    2011-01-01

    Despite their growing popularity, digital alternatives to conventional textbooks are stirring up controversy. With the introduction of tablet computers, and the growing trend toward "cloud computing" and "open source" software, the trend is accelerating because costs are coming down and free or inexpensive materials are becoming more available.…

  17. Leonurenones A-C: Labdane diterpenes from Leonotis leonurus.

    He, Fang; Lindqvist, Charlotte; Harding, Wayne W

    2012-11-01

    Labdanes, leonurenones A-C, two known labdanes, luteolin 7-O-β-glucoside and luteolin were isolated and characterized from a commercial source of Leonotis leonurus. Genetic methods allowed for identification of the plant material. The leonurenones contain an uncommon α,β-unsaturated enone moiety in ring B, and leonurenones A and B were evaluated in a competitive inhibition assay at the GABA A neuroreceptor site.

  18. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...

  19. Usability Briefing for hospital design

    Fronczek-Munter, Aneta

    This PhD thesis is a contribution to an ongoing debate in Denmark about improving the building design processes of complex buildings, especially in relation to the current hospital developments. It provides knowledge about capturing user needs and defines the process model for usability briefing ...... of complex buildings, such as hospitals. The research results have relevance to researchers, architects, facility managers and client organizations planning new complex facilities, and especially for professionals working with briefing and design of hospitals.......This PhD thesis is a contribution to an ongoing debate in Denmark about improving the building design processes of complex buildings, especially in relation to the current hospital developments. It provides knowledge about capturing user needs and defines the process model for usability briefing...... and evaluations, can be fed into briefing and design processes. This PhD thesis proposes methods for usability briefing.Usability is a concept similar to functionality, but usability depends on: subjective view of users, context, culture, situation and experience. Understanding usability is achieved by involving...

  20. Effect of phase change material (PCM) in a heat storage connected to solar thermal facility; Efecto de la inclusion de materiales de cambion de fase (PCMs) en un deposito de ACS conectado a una instalacion solar termica

    Cabeza, L. F.; Sole, C.; Roca, J.; Nogues, M.

    2004-07-01

    Most domestic water heat stores (DWH) are based, as common technology for heat storage, on the water temperature variation and its stratification. When PCM module (Phase Change Material) is added on top of the tank, the storage capacity of the whole system is significantly increased without deteriorate the stratification. In this way, the outlet temperature of the tank is much more stable, the thermal losses can be compensated and it is feasible to reheat the colder water coming from bottom part of the tank during the hot water demand. In the present paper, the behaviour of a PCM module inserted at the top of a tank water of a solar system pilot plant for domestic use is studied. (Author)

  1. RHIC spin flipper AC dipole controller

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  2. AcEST: DK956298 [AcEST

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  3. AcEST: DK959751 [AcEST

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  4. AcEST: BP920842 [AcEST

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  5. Critical conducting networks in disordered solids: ac universality from topological arguments

    Milovanov, A.V.; Juul Rasmussen, Jens

    2001-01-01

    This paper advocates an unconventional description of charge transport processes in disordered solids, which brings together the ideas of fractal geometry, percolation theory, and topology of manifolds. We demonstrate that the basic features of ac conductivity in disordered materials as seen in v...... prediction of the present model is the "hyperuniversal" scaling sigma(omega)proportional to omega (1/3) for ac conduction in two dimensions....

  6. Effective AC needleless and collectorless electrospinning for yarn production.

    Pokorny, P; Kostakova, E; Sanetrnik, F; Mikes, P; Chvojka, J; Kalous, T; Bilek, M; Pejchar, K; Valtera, J; Lukas, D

    2014-12-28

    Nanofibrous materials are essential components for a wide range of applications, particularly in the fields of medicine and material engineering. These include protective materials, sensors, cosmetics, hygiene, filtration and energy storage. The most widely used and researched technology in these fields is electrospinning. This method for producing fibers yields highly promising results thanks to its versatility and simplicity. Electrospinning is employed in multiple forms, among which needle and needleless direct current (DC) variants are the most distinctive. The former is based on the generation of just one single jet from a nozzle; hence this fabrication process is not very productive. The latter uses the destabilization of free liquid surfaces by means of an electric field, which enhances the throughput since it produces numerous jets, emitted from the surfaces of rollers, spheres, strings and spirals. However, although some progress in total producibility has been achieved, the efficiency of the DC method still remains relatively low. A further drawback of DC electrospinning is that both variants need a collector, which makes it difficult to combine DC electrospinning easily with other technologies due to the presence of the high field strength within the entire spinning zone. This paper describes our experiments with AC electrospinning. We show that alternating current (AC) electrospinning based on a needleless spinning-electrode provides a highly productive smoke-like aerogel composed of nanofibers. This aerogel rises rapidly from the electrode like a thin plume of smoke, without any need for a collector. Our work shows that AC needleless electrospinning gains its efficiency and collector-less feature thanks to the creation of a perpetually charge-changing virtual counter-electrode composed of the nanofibers emitted. High-speed camera recordings demonstrate the formation mechanism of the nanofibrous plume, which is wafted by an electric wind. This wind

  7. Physical and Chemical Sciences Center - research briefs. Volume 1-96

    Mattern, P.L.

    1994-12-31

    This report provides brief summaries of research performed in chemical and physical sciences at Sandia National Laboratories. Programs are described in the areas of advanced materials and technology, applied physics and chemistry, lasers, optics, and vision, and resources and capabilities.

  8. 22 CFR 1423.28 - Briefs in support of exceptions; oppositions to exceptions; cross-exceptions.

    2010-04-01

    ... FEDERAL LABOR RELATIONS AUTHORITY UNFAIR LABOR PRACTICE PROCEEDINGS § 1423.28 Briefs in support of... following: (1) A concise statement of the case containing all that is material to the consideration of...

  9. Beacons In Brief. P/PV In Brief. Issue 2

    Blank, Susan; Farley, Chelsea

    2004-01-01

    This second issue in P/PV's "In Brief" series focuses on the San Francisco Beacon Initiative and P/PV's recently released evaluation results. The Beacon Initiative established after-school programs in eight public schools in low-income San Francisco neighborhoods. P/PV's 36-month evaluation examined key developmental and academic outcomes.…

  10. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  11. Mind a brief introduction

    Searle, John R

    2004-01-01

    "The philosophy of mind is unique among contemporary philosophical subjects," writes John Searle, "in that all of the most famous and influential theories are false." One of the world's most eminent thinkers, Searle dismantles these theories as he presents a vividly written, comprehensive introduction to the mind. He begins with a look at the twelve problems of philosophy of mind--which he calls "Descartes and Other Disasters"--problems which he returns to throughout the volume, as he illuminates such topics as materialism, consciousness, the mind-body problem, intentionality, mental causation, free will, and the self. The book offers a refreshingly direct and engaging introduction to one of the most intriguing areas of philosophy.

  12. A brief history of error.

    Murray, Andrew W

    2011-10-03

    The spindle checkpoint monitors chromosome alignment on the mitotic and meiotic spindle. When the checkpoint detects errors, it arrests progress of the cell cycle while it attempts to correct the mistakes. This perspective will present a brief history summarizing what we know about the checkpoint, and a list of questions we must answer before we understand it.

  13. Childhood Obesity. Special Reference Briefs.

    Winick, Myron

    This reference brief deals with the problem of childhood obesity and how it can lead to obesity in the adult. Eighty-four abstracts are presented of studies on the identification, prevention, and treatment of obesity in children, focusing on diet and psychological attitudes. Subjects of the studies were children ranging in age from infancy through…

  14. Humans and Robots. Educational Brief.

    National Aeronautics and Space Administration, Washington, DC.

    This brief discusses human movement and robotic human movement simulators. The activity for students in grades 5-12 provides a history of robotic movement and includes making an End Effector for the robotic arms used on the Space Shuttle and the International Space Station (ISS). (MVL)

  15. AC-tabsmodeller for superledende kabelledere

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  16. Total loss of AC power analysis for EPR reactor

    Darnowski, Piotr, E-mail: piotr.darnowski@itc.pw.edu.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Skrzypek, Eleonora, E-mail: eleonora.skrzypek@ncbj.gov.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); National Centre for Nuclear Research (NCBJ), A. Sołtana 7, 05-400 Otwock-Świerk (Poland); Mazgaj, Piotr, E-mail: piotr.mazgaj@itc.pw.edu.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Świrski, Konrad [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Gandrille, Pascal [AREVA NP SAS, Tour AREVA, 1 place Jean Millier, 92084 Paris La Défense (France)

    2015-08-15

    Highlights: • Total loss of AC power (Station Blackout) was simulated for the EPR reactor model. • In-vessel phase of the accident is under consideration. • Comparison of MELCOR and MAAP results is presented. • MELCOR and MAAP results are comparable. - Abstract: In this paper the results of severe accident simulations for the EPR reactor in the case of loss of offsite power combined with total failure of all diesel generators (total loss of AC power) are presented. Calculations were performed with MELCOR 2.1 computer code for in-vessel phase of the accident. In this scenario, the unavailability of all offsite and onsite power sources and the lack of cooling leads directly to core degradation, material relocation to the lower plenum and rupture of the reactor pressure vessel. MELCOR results were compared qualitatively and quantitatively with MAAP4 code results and show a good agreement.

  17. 17 CFR 171.25 - Appeal brief.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Appeal brief. 171.25 Section... Denial and Registration Actions § 171.25 Appeal brief. (a) Time to file. Any person who has filed a... appeal brief with the Proceedings Clerk within thirty days after service of the record by the...

  18. 17 CFR 9.22 - Appeal brief.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Appeal brief. 9.22 Section 9... Appeals § 9.22 Appeal brief. (a) Time to file. Any person who has filed a notice of appeal in accordance with the provisions of § 9.20 must perfect the appeal by filing an appeal brief with the...

  19. 37 CFR 41.41 - Reply brief.

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Reply brief. 41.41 Section 41... COMMERCE PRACTICE BEFORE THE BOARD OF PATENT APPEALS AND INTERFERENCES Ex Parte Appeals § 41.41 Reply brief... file a reply brief to an examiner's answer within two months from the date of the examiner's answer....

  20. 37 CFR 41.68 - Respondent's brief.

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Respondent's brief. 41.68... Respondent's brief. (a)(1) Respondent(s) in an appeal may once, within the time limit for filing set forth in... title. (2) The brief must be signed by the party, or the party's duly authorized attorney or agent,...

  1. AC Impedance Behaviour of Black Diamond Films

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  2. Numeric description of space charge in polyethylene under ac electric fields

    Zhao, J.; Xu, Z.; Chen, G.; Lewin, P. L.

    2010-12-01

    Space charge in polyethylene-based insulation materials and its effect on the local electric field under a dc environment have been extensively examined over the last few decades while the behavior of space charge under ac stress has received less attention. Space charge phenomenon under ac electric fields becomes an important issue with increased operating field strength in many applications, such as next generation high voltage cables. In this paper, a bipolar charge transport model has been developed to simulate space charge in polymers under ac electric fields. Obtained simulation results show that there is a small quantity of phase-dependent bipolar charge accumulation in the vicinity of the electrodes that does not move into the bulk under ac stress. This causes a slight distortion of the local field in the bulk. However, at lower frequencies less than 1 Hz, there is increased charge accumulation and penetration. Comparison with available experimental data suggests that the model is capable of describing the underlying physics of charge behavior when a dielectric material is subjected to ac electric fields. Due to the weak charge movement in the bulk, the conduction current density is small and hence the displacement component dominates the total current density and this increases linearly with ac frequency.

  3. Structural and AC loss study for pure and doped MgB{sub 2} superconductor

    Hansdah, J. S.; Sarun, P. M., E-mail: sarun.res@gmail.com [Functional Ceramics Lab, Department of Applied Physics, Indian School of Mines (ISM), Dhanbad – 826004 (India)

    2015-06-24

    Superconducting polycrystalline bulk MgB{sub 2} samples doped with n-C, n-Y{sub 2}O{sub 3} and n-Ho{sub 2}O{sub 3} were prepared by powder-in-sealed (PIST) method. XRD measurement shows the influence of dopants on phase and lattice parameters of samples. The ac susceptibility measurement reveals ac loss and activation energy of the samples. Nano-C doped sample shows less ac loss in all frequency (208 Hz – 999 Hz) among the doped samples; whereas n-Ho{sub 2}O{sub 3} doped sample shows highest ac loss. The activation energy is high for rare earth (n-Y{sub 2}O{sub 3} and n-Ho{sub 2}O{sub 3}) doped samples as compare to n-C doped samples which reveals the enhancement in flux-pinning properties of these materials.

  4. 高职高专计算机公共课教材建设浅谈%A Brief Discussion on the Construction of Teaching Mate-rials for Higher Vocational Public Computer Course

    安静

    2013-01-01

      目前,高职高专的教育改革正在不断深化,相关教材也应随之改革修订,要突出高职高专教育特色,突出职业性、应用性,加强理论联系实际。教材内容重点放在理论、原理的应用思路、应用方法、操作技能以及案例分析等方面。明确市场定位,注重市场需求,加强作者队伍建设,策划出一系列符合市场需求的计算机公共课教材。%At present, higher vocational education reform is deep-ening ceaselessly, so related materials should also be reformed subsequently revised, so as to highlight the features of higher professional education. It should stress professional and applica-tion, and strengthen the connection between theory and practice. Teaching contents should focus on the theory, principle, applica-tion method, application thinking skills and case analysis, etc. I should also make clear market positioning, focus on market de-mand, strengthen the construction of author team, and plan a se-ries of teaching materials of public computer course in line with market demand.

  5. AC electrokinetic manipulation of selenium nanoparticles for potential nanosensor applications

    Mahmoodi, Seyed Reza [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Bayati, Marzieh, E-mail: m-bayati@tums.ac.ir [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Hosseinirad, Somayeh [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Foroumadi, Alireza [Department of Medicinal Chemistry, Faculty of Pharmacy and Pharmaceutical Sciences Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Gilani, Kambiz [Department of Pharmaceutics, School of Pharmacy, Tehran University of Medical Science, Tehran (Iran, Islamic Republic of); Rezayat, Seyed Mahdi [School of Advanced Technologies in Medicine, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of)

    2013-03-15

    Highlights: ► Se nanoparticles were synthesized using a reverse-microemulsion process. ► AC osmotic fluid flow repulses the particles from electrode edges. ► Dielectrophoretic force attracts the particles to electrode edges. ► Dielectrophoresis electrode showed non-ohmic behavior. ► The device can potentially be used as a nanosensor. - Abstract: We report the AC electrokinetic behavior of selenium (Se) nanoparticles for electrical characterization and possible application as micro/nano devices. selenium Se nanoparticles were successfully synthesized using a reverse-microemulsion process and investigated structurally using X-ray diffraction and transmission electron microscope. Interdigitated castellated ITO and non-castellated platinum electrodes were employed for manipulation of suspended materials in the fluid. Using ITO electrodes at low frequency limits resulted in deposition of Se particles on electrode surface. When Se particles exposed to platinum electrodes in the 10 Hz–1 kHz range and V {sub p−p}> 8, AC osmotic fluid flow repulses the particles from electrode edges. However, in 10 kHz–10 MHz range and V {sub p−p}> 5, dielectrophoretic force attracts the particles to electrode edges. As the Se particle concentration increased, the trapped Se particles were aligned along the electric field line and bridged the electrode gap. The device was characterized and can potentially be useful in making micro/nano electronic devices.

  6. Brief cognitive behavior therapy in patients with social anxiety disorder: A preliminary investigation

    Ravikant G Pinjarkar

    2015-01-01

    Full Text Available Context: Cognitive behavior therapy (CBT is the treatment of choice in anxiety disorders. However, there is little evidence for the effectiveness brief CBT in social anxiety. Aims: We examined the effectiveness of a brief CBT of six sessions in patients with social anxiety disorder. Settings and Design: A single case design study baseline; post and 1 month follow-up was adopted. Materials and Methods: Seven patients with a DSM IV diagnosis of social anxiety underwent 6 weekly sessions of brief CBT. Their diagnosis was confirmed using structured diagnostic interviews. They were assessed at baseline, post and 1-month follow-up on CGI- Severity, Leibowitz Social Anxiety Scale (LSAS, Social Phobia Rating Scale, Brief Fear of Negative Evaluation, and Beck′s Depression Inventory. Statistical Analysis: Data were analyzed using the method of clinical significance. Results: Results indicated that brief CBT was effective in reducing social anxiety in all patients. Brief CBT was also effective in reducing social avoidance and self consciousness. However, brief CBT was not effective in reducing fear of negative evaluation in all patients, suggesting the need for longer duration for cognitive changes in some dysfunctional beliefs. Conclusions: This preliminary case series indicates that brief CBT may be a promising and a cost and time effective approach to managing for social anxiety.

  7. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  8. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  9. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  10. 马士基将重组AC-2和AC-3航线

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  11. Cooperative Frequency Control for Autonomous AC Microgrids

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  12. Total synthesis and allelopathic activity of cytosporones A-C

    Zamberlam, Charles E.M.; Meza, Alisson; Lima, Denis P. de; Beatriz, Adilson [Centro de Ciencias Exatas e Tecnologia, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil); Leite, Carla Braga; Marques, Maria Rita [Centro de Ciencias Biologicas e da Saude, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil)

    2012-07-01

    The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)

  13. imulation Results of Single Stage AC- AC Converter for Induction Heating

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  14. Briefs

    2011-01-01

    Economic trend Asian Development Bank (ADB) said China’s economy is expected to grow 9.6 percent in 2011, even as inflation remains a threat for Asia’s growth engine as well as other economies in the region. China’s GDP growth is forecasted to be moderate this year, compared with a growth of 10.3 percent

  15. Briefs

    2011-01-01

    Auto sales slows J.D.Power and Associates,a global marketing information services provider based in the United States,predicts that auto sales growth in the Chinese market which is expected to reach 30 percent in 2010,may slow to 10 percent in 2011, since the government has recognized troubles brought about by the rapid increase of automobiles on the street including traffic congestion,pollution and unrestrained expansion of production capacities.

  16. Briefs

    2011-01-01

    Benefits for Africa China’s investments in Africa have brought multiple benefits to the continent, providing better livelihood,more development opportunities and more choices for local people,said Liu Guijin, China’s special envoy on African affairs,at the end of the three-day World Economic Forum on Africa.He said China’s investments cater to Africa’s needs for a

  17. Briefs

    2011-01-01

    RMB trade The Bank of China has opened trading in the yuan currency to U.S.customers. The bank’s New York Branch now lets companies and individuals buy and sell the yuan through accounts with its U.S. branches,although U.S.businesses and individuals can also trade the currency through Western banks.The bank said it offers yuan savings,demand deposit and time deposit accounts to business customers in New York and Los Angeles. A savings account requires a minimum balance of the equivalent of $5,000.

  18. Briefs

    2001-01-01

    @@“The 4th national-& 11th South Central China young scientific researcher symposium on nuclear agricultural sciencee” was held in Zhangjiajie, Hunan on October 22,20O0. 53 representatives from home and abroad attended this symposium sponsored by Hunan Institute of Atomic Energy Application in Agriculture(HIAEAA). At the opening ceremony,HAAS and Zhongshan University, Guangdong, addressed congratuations on the symposium.

  19. Briefs

    2011-01-01

    New plant in Africa Chery Automobile Corp.Ltd.,China’s largest indigenous automaker,will build an assembly plant in Kenya next year, becoming the second Chinese company after truck manufacturer,Beiqi Foton Motors Corp.Ltd.This move is expected to tap the automobile market in East Africa and will further strengthen China’s links with the continent.The company ventured into Kenya through a franchise

  20. Briefs

    2011-01-01

    Corn-processing limit According to Chinese Agriculture Minister Han Changfu,China will curb the amount of corn used in producing industrial chemicals to reduce the increasing pressure on grain supplies. The minister said the government aims to contain further processing of corn in non-food and non-livestock industrial usage.

  1. Briefs

    2011-01-01

    3 More competitive According to the Global Competitiveness Report 2011-12,China’s competitiveness ranking rose from 27th to 26th among 142 economies in the world this year, continuing to lead the way among large developing economies.The report said China is one of the world’s least indebted countries,boasts a savings rate of some 53 percent of GDP,and runs only moder ate budget deficits.However,China’s fairly poor results in the financial market development and technological readiness pillars pull down its overall competitiveness performance,said the report.

  2. Briefs

    2005-01-01

    Baotou Will Be the Largest RE Metals Production Base in ChinaFrom "Baotou Special Electroanalysis Forum of Fluoride-salt System Rare Earth Oxide", which was held by Baotou Rare Earth Leading Group Office, the production of Nd metal in Baotou in 2003 was 2,800 tons, with market shares 28%, and that in 2004 was estimated at 4,000 tons,

  3. Microwave-induced crystallization of AC/TiO{sub 2} for improving the performance of rhodamine B dye degradation

    Tian, Fei [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Wu, Zhansheng, E-mail: wuzhans@126.com [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Chen, Qiuyu; Yan, Yujun [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Cravotto, Giancarlo; Wu, Zhilin [Dipartimento di Scienza e Tecnologia del Farmaco, University of Turin, Torino 10125 (Italy)

    2015-10-01

    Graphical abstract: - Highlights: • Mixed phase titania coated with AC was obtained by microwave irradiation method. • The TiO{sub 2} nanoparticles were spherical and well distributed on the surface of AC. • The light absorption edges of AC/TiO{sub 2} showed red-shift compared to the pure TiO{sub 2}. • Higher surface and TiO{sub 2} content of AC/TiO{sub 2} could improve photocatalytic efficiency. - Abstract: Titanium dioxide (TiO{sub 2}) deposition on activated carbon (AC) is widely used for pollutant photodegradation. In this study, a simple and efficient method for preparing AC/TiO{sub 2} composites under microwave irradiation was developed for photocatalytic degradation of rhodamine B (RhB) under UV light. Results of X-ray diffraction, scanning electron microscopy, and transmission electron microscopy revealed that TiO{sub 2} nanoparticles are anatase and rutile, with a spherical shape and a particle size of 20–50 nm and are well distributed on the AC surface. The UV–vis spectrum of TiO{sub 2} coated on AC showed an evident red-shift and exhibited stronger optical absorption capacity than pure TiO{sub 2}. The AC/TiO{sub 2} nanoparticles prepared at a microwave power of 700 W for 15 min exhibited 98% efficiency in removing RhB dye under UV irradiation for 30 min. The high photocatalytic activity of AC/TiO{sub 2}-700 W could be mainly attributed to the high sorption capacity of the mesoporous carbon material and high TiO{sub 2} content, which could produce higher quantity of ·OH. This study provides a rapid synthesis technique to prepare AC/TiO{sub 2} and a novel method to improve photocatalytic efficiency via synergistic effect for other catalytic systems.

  4. Calorimetric method of ac loss measurement in a rotating magnetic field.

    Ghoshal, P K; Coombs, T A; Campbell, A M

    2010-07-01

    A method is described for calorimetric ac-loss measurements of high-T(c) superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  5. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  6. 21 CFR 886.4440 - AC-powered magnet.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  7. 21 CFR 888.1240 - AC-powered dynamometer.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  8. 21 CFR 886.1630 - AC-powered photostimulator.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  9. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  10. Effects of AC Coils Parameters on Transduction Efficiency of EMAT for Steel Plate Inspection

    Xiaochun Song

    2014-01-01

    Full Text Available In order to improve the transduction efficiency of electromagnetic acoustic transducer (EMAT for steel plates inspection, the constitutive equation of magnetostrictive material was theoretically derived and simplified while the magnetostrictive force is parallel to the material surface. Based on the multiphysics field FEM, the effects of such excitation parameters as current, frequency, and pulse number in AC coils on magnetostrictive strain were mainly simulated, and the influence of the coil with different winding shapes on magnetostrictive strain was also analyzed. The simulation and experimental results indicate that magnetostrictive strain increases with a continuously increasing excitation current density, but it decreases with the increase of the frequency and pulse number of AC currents. Moreover, on condition that loop length and AC currents are held constant, spiral type coils have higher transduction efficiency than homocentric squares and figure-of-eight coils.

  11. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  12. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

    2014-10-01

    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  13. Enhancing the crisis management briefing.

    Clark, Daniel W; Volkmann, Peter

    2005-01-01

    The Crisis Management Briefing (CMB) is a powerful and versatile crisis intervention tool, effective within a wide variety of populations, settings, and critical incidents. Initially proposed by Everly (2000), the CMB uniquely fills the factual information void following a critical incident. Additionally, a CMB provides essential information on effective coping strategies and available helping resources, tailored to the specific incident(s). The authors expand on the original CMB construct using their combined field experience, offering recommendations on team composition, strategic planning factors, using CISDs vs. CMBs, and specific enhancements for the four phases. They conclude with examples of specific interventions across a variety of events to illustrate their recommendations.

  14. Brief interventions for alcohol problems: a review.

    Bien, T H; Miller, W R; Tonigan, J S

    1993-03-01

    Relatively brief interventions have consistently been found to be effective in reducing alcohol consumption or achieving treatment referral of problem drinkers. To date, the literature includes at least a dozen randomized trials of brief referral or retention procedures, and 32 controlled studies of brief interventions targeting drinking behavior, enrolling over 6000 problem drinkers in both health care and treatment settings across 14 nations. These studies indicate that brief interventions are more effective than no counseling, and often as effective as more extensive treatment. The outcome literature is reviewed, and common motivational elements of effective brief interventions are described. There is encouraging evidence that the course of harmful alcohol use can be effectively altered by well-designed intervention strategies which are feasible within relatively brief-contact contexts such as primary health care settings and employee assistance programs. Implications for future research and practice are considered.

  15. Sustainable Markets Investment Briefings: Investment Treaties

    Cotula, Lorenzo

    2007-08-15

    This is the second of a series of briefings which discuss the sustainable development issues raised by legal arrangements for the protection of foreign investment. The briefings are based on legal research by IIED and its partners. The goal is to provide accessible but accurate information for human rights, development and environmental organisations working on issues raised by foreign investment in low- and middle-income countries. Briefing 2 explains how investment treaties between states work to protect and promote foreign investment.

  16. Advances in electronic materials

    Kasper, Erich; Grimmeiss, Hermann G

    2008-01-01

    This special-topic volume, Advances in Electronic Materials, covers various fields of materials research such as silicon, silicon-germanium hetero-structures, high-k materials, III-V semiconductor alloys and organic materials, as well as nano-structures for spintronics and photovoltaics. It begins with a brief summary of the formative years of microelectronics; now the keystone of information technology. The latter remains one of the most important global technologies, and is an extremely complex subject-area. Although electronic materials are primarily associated with computers, the internet

  17. Amharic. Materials Status Report.

    Center for Applied Linguistics, Washington, DC. Language/Area Reference Center.

    The materials status report for Amharic, the dominant language of Ethiopia, is one of a series intended to provide the nonspecialist with a picture of the availability and quality of texts for teaching various languages to English speakers. The report consists of: (1) a brief narrative description of Amharic, the areas where it is spoken, its…

  18. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  19. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  20. An Automated Ac Susceptibility Set up Fabricated Using a Closed-Cycle Helium Refrigerator

    Kundu, S

    2011-01-01

    We have described here the design and operation of an automated ac susceptibility set up using a closed cycle helium refrigerator. This set up is useful for measuring linear and nonlinear magnetic susceptibilities of various magnetic materials. The working temperature range is 2 K to 300 K. The overall sensitivity of the set up is found to be 10-3 emu.

  1. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  2. The application of prepared porous carbon materials: Effect of different components on the heavy metal adsorption.

    Song, Min; Wei, Yuexing; Yu, Lei; Tang, Xinhong

    2016-06-01

    In this study, five typical municipal solid waste (MSW) components (tyres, cardboard, polyvinyl chloride (PVC), acrylic textile, toilet paper) were used as raw materials to prepare four kinds of MSW-based carbon materials (paperboard-based carbon materials (AC1); the tyres and paperboard-based carbon materials (AC2); the tyres, paperboard and PVC-based carbon materials (AC3); the tyres, paperboard, toilet paper, PVC and acrylic textile-based carbon materials (AC4)) by the KOH activation method. The characteristic results illustrate that the prepared carbon adsorbents exhibited a large pore volume, high surface area and sufficient oxygen functional groups. Furthermore, the application of AC1, AC2, AC3, AC4 on different heavy metal (Cu(2+), Zn(2+), Pb(2+), Cr(3+)) removals was explored to investigate their adsorption properties. The effects of reaction time, pH, temperature and adsorbent dosage on the adsorption capability of heavy metals were investigated. Comparisons of heavy metal adsorption on carbon of different components were carried out. Among the four samples, AC1 exhibits the highest adsorption capacity for Cu(2+); the highest adsorption capacities of Pb(2+) and Zn(2+) are obtained for AC2; that of Cr(3+) are obtained for AC4. In addition, the carbon materials exhibit better adsorption capability of Cu(2+) and Pb(2+) than the other two kind of metal ions (Zn(2+) and Cr(3+)).

  3. Investigations of surface characterization of silicone rubber due to tracking phenomena under a.c. and d.c. voltages

    Uma Maheswar Rao; S S M S Abdul Majeed; C Venkataseshaiah; R Sarathi

    2002-11-01

    In the present work, tracking phenomena has been studied with silicone rubber material under the a.c. and d.c. voltages following IEC-587 standards. The surface condition of the tracked zone was analysed using wide angle X-ray diffraction (WAXD) and thermogravimetric differential thermal analysis (TG–DTA) studies. The tracking time was different for a.c. and d.c. voltages.

  4. A brief examination of optical tagging technologies.

    Ackermann, Mark R.; Cahill, Paul A. (Aspecular Optics, Dayton, OH); Drummond, Timothy J.; Wilcoxon, Jess Patrick

    2003-07-01

    Presented within this report are the results of a brief examination of optical tagging technologies funded by the Laboratory Directed Research and Development (LDRD) program at Sandia National Laboratories. The work was performed during the summer months of 2002 with total funding of $65k. The intent of the project was to briefly examine a broad range of approaches to optical tagging concentrating on the wavelength range between ultraviolet (UV) and the short wavelength infrared (SWIR, {lambda} < 2{micro}m). Tagging approaches considered include such things as simple combinations of reflective and absorptive materials closely spaced in wavelength to give a high contrast over a short range of wavelengths, rare-earth oxides in transparent binders to produce a narrow absorption line hyperspectral tag, and fluorescing materials such as phosphors, dies and chemically precipitated particles. One technical approach examined in slightly greater detail was the use of fluorescing nano particles of metals and semiconductor materials. The idea was to embed such nano particles in an oily film or transparent paint binder. When pumped with a SWIR laser such as that produced by laser diodes at {lambda}=1.54{micro}m, the particles would fluoresce at slightly longer wavelengths, thereby giving a unique signal. While it is believed that optical tags are important for military, intelligence and even law enforcement applications, as a business area, tags do not appear to represent a high on return investment. Other government agencies frequently shop for existing or mature tag technologies but rarely are interested enough to pay for development of an untried technical approach. It was hoped that through a relatively small investment of laboratory R&D funds, enough technologies could be identified that a potential customers requirements could be met with a minimum of additional development work. Only time will tell if this proves to be correct.

  5. AC susceptibilities of grain-textured superconductors

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  6. Propiedades acústicas de los paneles de carrizo

    Díaz, César

    2012-03-01

    Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems. This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.

    El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos. En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.

  7. Surface properties of activated carbon from different raw materials

    Zhang XiangLan; Zhang Yan; Liu Qiong; Zhou Wei

    2012-01-01

    Activated carbons (ACs) with different surface properties were prepared from different raw materials.N2 adsorption,pH value,Boehm titration,Temperature-programmed reduction (TPR) and FTIR were employed to characterize the pore structure and surface chemical properties of the ACs.The results show that AC from bituminous coal (AC-B) has more meso-pores,higher pH value,more carboxylic groups and basic site than ACs from coconut shell and hawthorn(AC-C,AC-H).Oxygen in the mixture gas has great effect on SO2 catalytic oxidation/oxidation ability of AC-B.In the absence of oxygen,the adsorbed SO2 on AC-B is 0.16 mmol/g and the conversion ratio of adsorbed SO2 to SO3 is 22,07%; while in the presence of oxygen,the adsorbed amount of SO2 is 0.42 mmol/g,and all of the adsorbed SO2 was totally converted to SO3.This feature of AC-B is consistent with its higher pH value,basic site and the reaction ability with H2 from TPR.The conversion ratios of SO2 absorbed on both AC-C and AC-H were 100%,respectively.

  8. The Effective AC Response of Nonlinear Composites

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  9. Control of Power Converters in AC Microgrids

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  10. The ACS Nearby Galaxy Survey Treasury

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  11. AC410 Unit 2 Homework Assignment

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  12. 19 CFR 207.23 - Prehearing brief.

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Prehearing brief. 207.23 Section 207.23 Customs... EXPORTS TO THE UNITED STATES Final Determinations, Short Life Cycle Products § 207.23 Prehearing brief... days prior to the date of the hearing specified in the notice of scheduling, a prehearing...

  13. The GO4KIDDS Brief Adaptive Scale

    Perry, Adrienne; Taheri, Azin; Ting, Victoria; Weiss, Jonathan

    2015-01-01

    Background: Accurate measurement of adaptive behaviour is important in both clinical and research contexts. While several good clinical measures exist, as well as brief research measures for adults with intellectual disability, there is need for a brief and efficient measure for research with children and youth. We present preliminary psychometric…

  14. Legal briefing: Healthcare ethics committees.

    Pope, Thaddeus Mason

    2011-01-01

    This issue's "Legal Briefing" column covers recent legal developments involving institutional healthcare ethics committees. This topic has been the subject of recent articles in JCE. Healthcare ethics committees have also recently been the subject of significant public policy attention. Disturbingly, Bobby Schindler and others have described ethics committees as "death panels." But most of the recent attention has been positive. Over the past several months, legislatures and courts have expanded the use of ethics committees and clarified their roles concerning both end-of-life treatment and other issues. These developments are usefully grouped into the following eight categories: 1. Existence and availability. 2. Membership and composition. 3. Operating procedures. 4. Advisory roles. 5. Decision-making and gate-keeping roles. 6. Confidentiality. 7. Immunity. 8. Litigation and court cases.

  15. A brief history of videogames

    Simone Belli

    2008-11-01

    Full Text Available The following text contains a brief journey through a short and yet intense adventure, the history of videogames. Since its beginnings in the 1950's decade to the present time, videogames have progressively changed from a hobby for ingeneering studens to the most powerfull leisure industry. In order to gain a better understanding of this phenomenon it is necessary to look over the path of its transformation from a retrospecive point of view. Such a look has necessarily to focus on those devices and games that had made a landmark in the history of videogames, taking them to their current position. Besides, it is crucial to address their implications in contemporary visual culture, along with current prejudices against them. This is a short account about a great history.

  16. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  17. Dielectric relaxation analysis and Ac conductivity of polyvinyl alcohol/polyacrylonitrile film

    Abdel-Baset, T. A.; Hassen, A.

    2016-10-01

    A film of 0.98 polyvinyl alcohol (PVA)/0.02 Polyacrylonitrile (PAN) has been prepared using casting method. The dielectric properties were measured as function of temperature and frequency. The dielectric permittivity of PVA is considerably enhanced by doping with PAN. Different relaxation processes have been recognized within the studied ranges of temperature and frequency. The frequency temperature superposition (FTS) is well verified. Frequency and temperature dependence of Ac conductivity, σac, were studied. The conduction mechanism of pure PVA and PVA doped with PAN are discussed. The activation energy either for relaxation or conduction was calculated. Comparison with similar polymeric materials is discussed.

  18. Spin Backflow and ac Voltage Generation by Spin Pumping and the Inverse Spin Hall Effect

    Jiao, HuJun; Bauer, Gerrit E. W.

    2013-05-01

    The spin current pumped by a precessing ferromagnet into an adjacent normal metal has a constant polarization component parallel to the precession axis and a rotating one normal to the magnetization. The former is now routinely detected as a dc voltage induced by the inverse spin Hall effect (ISHE). Here we compute ac ISHE voltages much larger than the dc signals for various material combinations and discuss optimal conditions to observe the effect. The backflow of spin is shown to be essential to distill parameters from measured ISHE voltages for both dc and ac configurations.

  19. Maine State Briefing Book on low-level radioactive waste management

    1981-08-01

    The Maine State Briefing Book is one of a series of state briefing books on low-level radioactive waste management practices. It has been prepared to assist state and Federal agency officials in planning for safe low-level radioactive waste disposal. The report contains a profile of low-level radioactive waste generators in Maine. The profile is the result of a survey of radioactive material licensees in Maine. The briefing book also contains a comprehensive assessment of low-level radioactive waste management issues and concerns as defined by all major interested partices including industry, government, the media, and interest groups. The assessment was developed through personal communications with representatives of interested parties, and through a review of media sources. Lastly, the briefing book provides demographic and socioeconomic data and a discussion of relevant goverment agencies and activities, all of which may impact management practices in Maine.

  20. Rhode Island State Briefing Book on low-level radioactive-waste management

    1981-07-01

    The Rhode Island State Briefing Book is one of a series of state briefing books on low-level radioactive waste management practices. It has been prepared to assist state and federal agency officials in planning for safe low-level radioactive waste disposal. The report contains a profile of low-level radioactive waste generators in Rhode Island. The profile is the result of a survey of radioactive material licensees in Rhode Island. The briefing book also contains a comprehensive assessment of low-level radioactive waste management issues and concerns as defined by all major interested parties including industry, government, the media, and interest groups. The assessment was developed through personal communications with representatives of interested parties, and through a review of media sources. Lastly, the briefing book provides demographic and socioeconomic data and a discussion of relevant government agencies and activities, all of which may affect waste management practices in Rhode Island.

  1. Advanced Hybrid Materials for Aerospace Propulsion Applications (Briefing Charts)

    2013-02-01

    Motivation • Many hydrophobic surfaces exist in nature but there is no naturally occurring oleophobic surface • Plenty of academic and commercial...interest in the development of oleophobic surfaces • Focus on commercially available textiles www.tressugar.com www.thedailygreen.com www.gfn.com

  2. YBCO thin films in ac and dc films

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  3. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  4. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  5. 76 FR 65633 - RIN 1904-AC43

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  6. AC Losses of Prototype HTS Transmission Cables

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  7. AC power generation from microbial fuel cells

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  8. Thermal Simulation of AC Electromagnetic Contactor

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  9. A dry-cooled AC quantum voltmeter

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  10. Protection of AC and DC Microgrids

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  11. Modeling of long High Voltage AC Underground

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  12. From Beamline to Scanner with 225Ac

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  13. Aging, Counterfeiting Configuration Control (AC3)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  14. Experimental and theoretical study of AC electrical conduction mechanisms of Bis (4-acetylanilinium) tetrachloridozincate

    Amine Fersi, M., E-mail: fersi_amine@yahoo.fr; Chaabane, I.; Gargouri, M.

    2014-07-01

    The Bis (4-acetylanilinium) tetrachloridozincate [C{sub 8}H{sub 10}NO]{sub 2}[ZnCl{sub 4}] compound was obtained by slow evaporation at room temperature and characterized by XRD. It is crystallized in an orthorhombic system (Cmca space group). The material was characterized by impedance spectroscopy technique measured in the 209 Hz–5 MHz frequency range from 423 to 498 K. Besides, the Cole–Cole (Z″ versus Z′) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experimental results indicated that AC conductivity (σ{sub ac}) was proportional to Aω{sup S1}+Bω{sup S2}(0AC conductivity behavior of [C{sub 8}H{sub 10}NO]{sub 2}[ZnCl{sub 4}] can be explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.

  15. Digital model for harmonic interactions in AC/DC/AC systems

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  16. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  17. Fuel Reforming Technologies (BRIEFING SLIDES)

    2009-09-01

    Surface Analysis, Reactions Thermodynamics Modeling, Novel Catalyst Materials Formulation, and Catalyst Coating On Substrate; Catalytic Reactor system...catalyst materials formulation  Catalytic reactor system testing and analysis  Catalyst Coating On Metal Substrate  Reactions Thermodynamics Modeling...Technology & Core Competency  Microchannel and Matrix Technologies  Transport Phenomena Theory, Formulation, And Modeling  Computational And

  18. Power Electronic Transformer based Three-Phase PWM AC Drives

    Basu, Kaushik

    A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

  19. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  20. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  1. Sustainable Markets Investment Briefings: Foreign investment contracts

    Cotula, Lorenzo

    2007-08-15

    This is the fourth of a series of briefings which discuss the sustainable development issues raised by legal arrangements for the protection of foreign investment. The briefings are based on legal research by IIED and its partners. The goal is to provide accessible but accurate information for human rights, development and environmental organisations working on issues raised by foreign investment in low- and middle-income countries. Briefing 4 sets out some of the ways in which foreign investment contracts can impact on sustainable development.

  2. Sustainable Markets Investment Briefings: International arbitration

    Cotula, Lorenzo

    2007-08-15

    This is the fifth of a series of briefings which discuss the sustainable development issues raised by legal arrangements for the protection of foreign investment. The briefings are based on legal research by IIED and its partners. The goal is to provide accessible but accurate information for human rights, development and environmental organisations working on issues raised by foreign investment in low- and middle-income countries. Briefing 5 explains how international arbitration works to resolve disputes between foreign investors and host states, and outlines some of the problems associated with its use, from a sustainable development perspective.

  3. Cancer Vaccines: A Brief Overview.

    Thomas, Sunil; Prendergast, George C

    2016-01-01

    Vaccine approaches for cancer differ from traditional vaccine approaches for infectious disease in tending to focus on clearing active disease rather than preventing disease. In this review, we provide a brief overview of different types of vaccines and adjuvants that have been investigated for the purpose of controlling cancer burdens in patients, some of which are approved for clinical use or in late-stage clinical trials, such as the personalized dendritic cell vaccine sipuleucel-T (Provenge) and the recombinant viral prostate cancer vaccine PSA-TRICOM (Prostvac-VF). Vaccines against human viruses implicated in the development and progression of certain cancers, such as human papillomavirus in cervical cancer, are not considered here. Cancers express "altered self" antigens that tend to induce weaker responses than the "foreign" antigens expressed by infectious agents. Thus, immune stimulants and adjuvant approaches have been explored widely. Vaccine types considered include autologous patient-derived immune cell vaccines, tumor antigen-expressing recombinant virus vaccines, peptide vaccines, DNA vaccines, and heterologous whole-cell vaccines derived from established human tumor cell lines. Opportunities to develop effective cancer vaccines may benefit from seminal recent advances in understanding how immunosuppressive barricades are erected by tumors to mediate immune escape. In particular, targeted ablation of these barricades with novel agents, such as the immune checkpoint drug ipilimumab (anti-CTLA-4) approved recently for clinical use, may offer significant leverage to vaccinologists seeking to control and prevent malignancy.

  4. Engineering Technical Review Planning Briefing

    Gardner, Terrie

    2012-01-01

    The general topics covered in the engineering technical planning briefing are 1) overviews of NASA, Marshall Space Flight Center (MSFC), and Engineering, 2) the NASA Systems Engineering(SE) Engine and its implementation , 3) the NASA Project Life Cycle, 4) MSFC Technical Management Branch Services in relation to the SE Engine and the Project Life Cycle , 5) Technical Reviews, 6) NASA Human Factor Design Guidance , and 7) the MSFC Human Factors Team. The engineering technical review portion of the presentation is the primary focus of the overall presentation and will address the definition of a design review, execution guidance, the essential stages of a technical review, and the overall review planning life cycle. Examples of a technical review plan content, review approaches, review schedules, and the review process will be provided and discussed. The human factors portion of the presentation will focus on the NASA guidance for human factors. Human factors definition, categories, design guidance, and human factor specialist roles will be addressed. In addition, the NASA Systems Engineering Engine description, definition, and application will be reviewed as background leading into the NASA Project Life Cycle Overview and technical review planning discussion.

  5. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  6. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  7. Methods for Addressing Missing Data with Applications from ACS Exams

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  8. 21 CFR 880.5500 - AC-powered patient lift.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  9. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  10. AC LED的研究现状与发展%Current research and development of AC LED

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  11. Systemic Therapy: A New Brief Intervention Model.

    Searight, H. Russell; Openlander, Patrick

    1984-01-01

    Describes a newly developing mode of problem-oriented brief therapy. The systemic therapy model emphasizes the interactional context of clients' problems and represents an efficient intervention paradigm. (Author/JAC)

  12. 14 CFR 136.7 - Passenger briefings.

    2010-01-01

    ... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS COMMERCIAL AIR TOURS AND NATIONAL PARKS AIR TOUR MANAGEMENT National Air Tour Safety Standards § 136.7 Passenger briefings. (a)...

  13. Brief Review on the Relevance Theory

    龚腾龙; 阿勒腾

    2015-01-01

    Relevance theory has had an impact on the study in various disciplines including linguistics,literature and so on. This paper gives a brief review of the relevance theory and two principles of relevance.

  14. Lacreek NWR pelican disease outbreak briefing

    US Fish and Wildlife Service, Department of the Interior — Briefing for the Region 6 Regional Biologist on a disease outbreak at Lacreek National Wildlife Refuge. Pelican were the most affected species by the outbreak. It is...

  15. Brief Intervention Helps Adolescents Curb Substance Use

    ... Helps Adolescents Curb Substance Use Brief Intervention Helps Adolescents Curb Substance Use Email Facebook Twitter Two hour- ... School, in Minneapolis, conducted the trial with 315 adolescent and parent/caregiver pairs. Their findings strengthen evidence, ...

  16. The AC multi-harmonic magnetic susceptibility measurement setup at the LNF-INFN

    Wang, Shenghao; Di Gioacchino, Daniele; Wu, Ziyu

    2014-01-01

    The AC magnetic susceptibility is a fundamental method in materials science, which allows to probe the dynamic magnetic response of magnetic materials and superconductors. The LAMPS laboratory at the Laboratori Nazionali di Frascati of the INFN hosts an AC multi-harmonic magnetometer that allows performing experiments with an AC magnetic field ranging from 0.1 to 20 Gauss and in the frequency range from 17 to 2070 Hz. A DC magnetic field from 0 to 8 T produced by a superconducting magnet can be applied, while data may be collected in the temperature range 4.2-300 K using a liquid He cryostat under different temperature cycles setups. The first seven AC magnetic multi-harmonic susceptibility components can be measured with a magnetic sensitivity of 1x10-6 emu and a temperature precision of 0.01 K. Here we will describe in detail about schematic of the magnetometer, special attention will be dedicated to the instruments control, data acquisition framework and the user-friendly LabVIEW-based software platform.

  17. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  18. Lazy AC-Pattern Matching for Rewriting

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  19. AC plasma anemometer—characteristics and design

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  20. Lazy AC-Pattern Matching for Rewriting

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  1. The Hubble Legacy Archive ACS Grism Data

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  2. AC susceptibilities of grain-textured superconductors

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  3. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  4. 22 CFR 1423.25 - Filing of brief.

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Filing of brief. 1423.25 Section 1423.25 Foreign... PROCEEDINGS § 1423.25 Filing of brief. Any party desiring to submit a brief to the Administrative Law Judge... Judge, but not in excess of thirty (30) days from the close of the hearing. Copies of any brief shall...

  5. 29 CFR 458.86 - Filing of brief.

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Filing of brief. 458.86 Section 458.86 Labor Regulations... OF CONDUCT Hearing and Related Matters § 458.86 Filing of brief. Any party desiring to submit a brief... Law Judge may grant a reasonable extension of time. Copies of such brief shall be served on all of...

  6. 37 CFR 2.128 - Briefs at final hearing.

    2010-07-01

    ..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Procedure in Inter Partes Proceedings § 2.128 Briefs at final hearing. (a)(1) The brief of the party in the position of plaintiff shall be due not... first brief. A reply brief by the party in the position of plaintiff, if filed, shall be due not...

  7. Molecular biology of maize Ac/Ds elements: an overview.

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  8. Development of a hardware-based AC microgrid for AC stability assessment

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  9. Brief Cognitive-Behavioral Therapy for Anxious Youth: Feasibility and Initial Outcomes

    Crawley, Sarah A.; Kendall, Philip C.; Benjamin, Courtney L.; Brodman, Douglas M.; Wei, Chiaying; Beidas, Rinad S.; Podell, Jennifer L.; Mauro, Christian

    2013-01-01

    We developed and evaluated a brief (8-session) version of cognitive-behavioral therapy (BCBT) for anxiety disorders in youth ages 6 to 13. This report describes the design and development of the BCBT program and intervention materials (therapist treatment manual and child treatment workbook) and an initial evaluation of child treatment outcomes.…

  10. AC Electrochemical Deposition of CdS Nanowire Arrays

    QIN; DongHuan

    2001-01-01

    Since the successful growth of carbon nanotubes, one-dimensional materials have been a focused research field both because of their fundamental importance and the wide-ranging potential applications in nano devices. Many approaches are used to fabricate nanowires, such as crystal growth. In order to obtain nanowires whose growth is more easily controlled, electrochemical synthesis in a template is taken as one of the most efficient methods. To date, Co, Fe, Ni, CuCo1-3 and other nanowire arrays have been fabricated successfully by electrodepositing corresponding metal ion into the porous aluminum oxide (PAO) membrane or other non-magnetic materials. Cadmium sulfide(CdS), as one of the most important semiconductor material, is a n-type semiconductor. The ability to fine tune their fundamental electronic and optical properties by simply varying the cruster size, rather than composition, makes them highly attractive for a variety of possible application. In this paper, we report our work of fabricating CdS nanowire arrays based on AC electrolysis into the pores of an anodic aluminum oxide(AAO), the structure and morphology were characterized by XRD and TEM.  ……

  11. Semiconductor technology program: Progress briefs

    Galloway, K. F.; Scace, R. I.; Walters, E. J.

    1981-01-01

    Measurement technology for semiconductor materials, process control, and devices, is discussed. Silicon and silicon based devices are emphasized. Highlighted activities include semiinsulating GaAs characterization, an automatic scanning spectroscopic ellipsometer, linewidth measurement and coherence, bandgap narrowing effects in silicon, the evaluation of electrical linewidth uniformity, and arsenicomplanted profiles in silicon.

  12. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  13. Granular Responses of GdBa2Cu3O7-δ Using ac Magnetic Susceptibility Measurement under ac and dc Magnetic Fields

    Namuco, S. B.; Lao, M. L.; Sarmago, R. V.

    Granularity of bulk materials has a great impact on the characterization of superconductors as well as its path towards room temperature applications. Bulk GdBCO that has crystal formation and Tc close to YBCO were fabricated using the conventional solid state route method. AC magnetic susceptibility measurement is done on the sample to observe the granular responses brought about by small magnetic field values that is superimposed with DC magnetic field. Results show that compared to YBCO, GdBCO show more sensitive behaviour with the addition of DC magnetic field. It is shown in the results that abrupt response in the AC loss peaks observed in χ" is more prominent in GdBCO even at lower applied magnetic fields.

  14. Condiciones acústicas de las aulas universitarias en una Universidad pública en Bogotá

    Lady Catherine Cantor Cutiva

    Full Text Available Introducción: En el sector de la docencia una situación frecuente son las precarias condiciones acústicas de las aulas. Objetivo: Caracterizar las condiciones acústicas de algunas aulas de una universidad pública en Bogotá. Material y Métodos: Durante el I semestre del 2009 se realizó un estudio descriptivo transversal, se evaluaron 25 salones de una universidad pública de Bogotá, los cuales fueron seleccionados de forma aleatoria según los reportes de docentes previamente entrevistados. Resultados: De los 25 salones medidos en la facultad 1 el 63,63% de los salones medidos presentó muy mala acústica según el índice de Acústica Total, mientras que en la Facultad 2 el 40% de los salones tuvo mala acústica, y en la Facultad 3 el 33,3% presentó acústica mala. Conclusiones: La ausencia de estudios en los que se reporten mediciones objetivas de tiempo de reverberación (TR e inteligibilidad evidencia la necesidad de realizar disertaciones de este tipo buscando generar herramientas que permitan mejorar las condiciones de salud, trabajo y vida de este grupo ocupacional.

  15. Assessment of the E-Selectin rs5361 (561A>C Polymorphism and Soluble Protein Concentration in Acute Coronary Syndrome: Association with Circulating Levels

    Elena Sandoval-Pinto

    2014-01-01

    Full Text Available Introduction. The acute coronary syndrome (ACS is a complex disease where genetic and environmental factors are involved. E-selectin gene is a candidate for ACS progression due to its contribution in the inflammatory process and endothelial function. The rs5361 (561A>C polymorphism in the E-selectin gene has been linked to changes in gene expression, affinity for its receptor, and plasmatic levels; therefore it is associated with an increased risk of cardiovascular disease. The aim of this study was to determine the association of the rs5361 polymorphism with ACS and to measure serum levels of soluble E-selectin (sE-selectin. Materials and Methods. 283 ACS patients and 205 healthy subjects (HS from Western Mexico were included. The polymerase chain reaction-restriction fragment length polymorphism was used to determine the rs5361 polymorphism. The sE-selectin levels were measured by enzyme-linked immunosorbent assay. Results. Neither genotype nor allele frequencies of the rs5361 polymorphism showed statistical differences between groups. The sE-selectin levels were significantly higher in ACS patients compared to HS (54.58 versus 40.41 ng/ml, P=0.02. The C allele had no effect on sE-selectin levels. Conclusions. The rs5361 E-selectin gene polymorphism is not a susceptibility marker for ACS in Western Mexico population. However, sE-selectin may be a biological marker of ACS.

  16. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  17. Kawasaki disease: A brief history.

    Burns, J C; Kushner, H I; Bastian, J F; Shike, H; Shimizu, C; Matsubara, T; Turner, C L

    2000-08-01

    Tomisaku Kawasaki published the first English-language report of 50 patients with Kawasaki disease (KD) in 1974. Since that time, KD has become the leading cause of acquired heart disease among children in North America and Japan. Although an infectious agent is suspected, the cause remains unknown. However, significant progress has been made toward understanding the natural history of the disease and therapeutic interventions have been developed that halt the immune-mediated destruction of the arterial wall. We present a brief history of KD, review progress in research on the disease, and suggest avenues for future study. Kawasaki saw his first case of KD in January 1961 and published his first report in Japanese in 1967. Whether cases existed in Japan before that time is currently under study. The most significant controversy in the 1960s in Japan was whether the rash and fever sign/symptom complex described by Kawasaki was connected to subsequent cardiac complications in a number of cases. Pathologist Noboru Tanaka and pediatrician Takajiro Yamamoto disputed the early assertion of Kawasaki that KD was a self-limited illness with no sequelae. This controversy was resolved in 1970 when the first Japanese nationwide survey of KD documented 10 autopsy cases of sudden cardiac death after KD. By the time of the first English-language publication by Kawasaki in 1974, the link between KD and coronary artery vasculitis was well-established. KD was independently recognized as a new and distinct condition in the early 1970s by pediatricians Marian Melish and Raquel Hicks at the University of Hawaii. In 1973, at the same Hawaiian hospital, pathologist Eunice Larson, in consultation with Benjamin Landing at Los Angeles Children's Hospital, retrospectively diagnosed a 1971 autopsy case as KD. The similarity between KD and infantile periarteritis nodosa (IPN) was apparent to these pathologists, as it had been to Tanaka earlier. What remains unknown is the reason for the

  18. DC injection into low voltage AC networks

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  19. Flexible AC transmission systems modelling and control

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  20. Transport AC loss characteristics of a nine strand YBCO Roebel cable

    Jiang, Zhenan; Badcock, R. A.; Long, N. J.; Staines, Mike; Thakur, K. P.; Lakshmi, L. S.; Wright, A.; Hamilton, K.; Sidorov, G. N.; Buckley, R. G.; Amemiya, Naoyuki; Caplin, A. D.

    2010-02-01

    Transport AC loss in a short length of 9/2 YBCO Roebel cable (nine 2 mm wide strands) is measured. The AC loss data are compared with those in a 5/2 YBCO Roebel cable (five 2 mm wide strands) as well as that in a single strand. All the strands composing the cables and the single strand are insulated and cut from the same stock material. The validity of the measurement method was reconfirmed by results at a range of frequencies. At a wide range of It/Ic, the normalized AC losses in the Roebel cable were around 6.2-6.7 times of those in the single strand. This is less than the nine times predicted for a tight bundle of nine conductors. The normalized transport AC losses in the 5/2 Roebel cable are much smaller than those in the 9/2 Roebel. This should be due to larger superposition of magnetic field in the 9/2 Roebel. The Ic of the 9/2 and 5/2 Roebel cables is determined by serial connection of the strands. This eliminates the effect where differing resistances in the current terminations cause uneven current sharing between strands when the strands are connected in parallel.

  1. Continuous Briefing and User Participation in Building Projects

    Jensen, Per Anker

    2006-01-01

    Briefing is not just about specifying needs as requirements but also about evaluating how well design pro-posals fulfill the needs and aspirations. Furthermore, briefing is not only about building design. Briefing starts at the pre-project stage to create a basis for the project decision....... It includes an initial strategic brief-ing to define the overall vision and objectives. Parallel to the design briefing it is necessary to carry out a briefing process related to interior design and building operation and before the building is commissioned a briefing process related to moving...... into the building is required. A building project is often part of a change process of the organisation that is going to occupy the building, and this change process should be management carefully to reach a successful result. An important aspect of briefing is to manage the par-ticipation of the coming users...

  2. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  3. Measurement control workshop instructional materials

    Gibbs, Philip [Brookhaven National Lab. (BNL), Upton, NY (United States); Harvel, Charles [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Clark, John [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gregg Protection Services, Lynchburg, VA (United States)

    2011-12-01

    An essential element in an effective nuclear materials control and accountability (MC&A) program is the measurement of the nuclear material as it is received, moved, processed and shipped. Quality measurement systems and methodologies determine the accuracy of the accountability values. Implementation of a measurement control program is essential to ensure that the measurement systems and methodologies perform as expected. A measurement control program also allows for a determination of the level of confidence in the ac counting values.

  4. Case Briefs in Legal English Classes

    Bilová Stĕpánka

    2016-06-01

    Full Text Available A case brief can be described as a succinct summary of a case which specifies the facts, procedural history, legal issue(s, court decision and legal reasoning supporting the judgment, even though exact formats may vary. Case briefing is a demanding activity which is required from students during their law studies. The goal is to teach students to focus on the essential parts of the case and to obtain a thorough understanding of the case and the reasoning, which means the students need to employ their analytical and critical thinking skills.

  5. NASA Tech Briefs, June 2009

    2009-01-01

    Topics covered include: Device for Measuring Low Flow Speed in a Duct, Measuring Thermal Conductivity of a Small Insulation Sample, Alignment Jig for the Precise Measurement of THz Radiation, Autoignition Chamber for Remote Testing of Pyrotechnic Devices, Microwave Power Combiners for Signals of Arbitrary Amplitude, Synthetic Foveal Imaging Technology, Airborne Antenna System for Minimum-Cycle-Slip GPS Reception, Improved Starting Materials for Back-Illuminated Imagers, Multi-Modulator for Bandwidth-Efficient Communication, Some Improvements in Utilization of Flash Memory Devices, GPS/MEMS IMU/Microprocessor Board for Navigation, T/R Multi-Chip MMIC Modules for 150 GHz, Pneumatic Haptic Interfaces, Device Acquires and Retains Rock or Ice Samples, Cryogenic Feedthrough Test Rig, Improved Assembly for Gas Shielding During Welding or Brazing, Two-Step Plasma Process for Cleaning Indium Bonding Bumps, Tool for Crimping Flexible Circuit Leads, Yb14MnSb11 as a High-Efficiency Thermoelectric Material, Polyimide-Foam/Aerogel Composites for Thermal Insulation, Converting CSV Files to RKSML Files, Service Management Database for DSN Equipment, Chemochromic Hydrogen Leak Detectors, Compatibility of Segments of Thermoelectric Generators, Complementary Barrier Infrared Detector, JPL Greenland Moulin Exploration Probe, Ultra-Lightweight Self-Deployable Nanocomposite Structure for Habitat Applications, and Room-Temperature Ionic Liquids for Electrochemical Capacitors.

  6. NASA Tech Briefs, July 2005

    2005-01-01

    Thin-Film Resistance Heat-Flux Sensors Circuit Indicates that Voice-Recording Disks are Nearly Full Optical Sensing of Combustion Instabilities in Gas Turbines Topics include: Crane-Load Contact Sensor; Hexagonal and Pentagonal Fractal Multiband Antennas; Multifunctional Logic Gate Controlled by Temperature; Multifunctional Logic Gate Controlled by Supply Voltage; Power Divider for Waveforms Rich in Harmonics; SCB Quantum Computers Using iSWAP and 1-Qubit Rotations; CSAM Metrology Software Tool; Update on Rover Sequencing and Visualization Program; Selecting Data from a Star Catalog; Rotating Desk for Collaboration by Two Computer Programmers; Variable-Pressure Washer; Magnetically Attached Multifunction Maintenance Rover; Improvements in Fabrication of Sand/Binder Cores for Casting; Solid Freeform Fabrication of Composite-Material Objects; Efficient Computational Model of Hysteresis; Gauges for Highly Precise Metrology of a Compound Mirror; Improved Electrolytic Hydrogen Peroxide Generator; High-Power Fiber Lasers Using Photonic Band Gap Materials; Ontology-Driven Information Integration; Quantifying Traversability of Terrain for a Mobile Robot; More About Arc-Welding Process for Making Carbon Nanotubes; Controlling Laser Spot Size in Outer Space; or Software-Reconfigurable Processors for Spacecraft.

  7. Djungle power. A more remote AC bus

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  8. Electrothermally driven flows in ac electrowetting.

    García-Sánchez, Pablo; Ramos, Antonio; Mugele, Frieder

    2010-01-01

    Mixing within sessile drops can be enhanced by generating internal flow patterns using ac electrowetting. While for low ac frequencies, the flow patterns have been attributed to oscillations of the drop surface, we provide here the driving mechanism of the hitherto unexplained high-frequency flows. We show that: (1) the electric field in the liquid bulk becomes important, leading to energy dissipation due to Joule heating and a temperature increase of several degrees Celsius, and (2) the fluid flow at these frequencies is generated by electrothermal effect, i.e., gradients in temperature give rise to gradients in conductivity and permittivity, the electric field acting on these inhomogeneities induces an electrical body force that generates the flow. We solved numerically the equations for the electric, temperature and flow fields. The temperature is obtained from a convection-diffusion equation where Joule heating is introduced as a source term. From the solution of the electric field and the temperature, we compute the electrical force that acts as a body force in Stokes equations. Our numerical results agree with previous experimental observations.

  9. Cascading failures in ac electricity grids

    Rohden, Martin; Jung, Daniel; Tamrakar, Samyak; Kettemann, Stefan

    2016-09-01

    Sudden failure of a single transmission element in a power grid can induce a domino effect of cascading failures, which can lead to the isolation of a large number of consumers or even to the failure of the entire grid. Here we present results of the simulation of cascading failures in power grids, using an alternating current (AC) model. We first apply this model to a regular square grid topology. For a random placement of consumers and generators on the grid, the probability to find more than a certain number of unsupplied consumers decays as a power law and obeys a scaling law with respect to system size. Varying the transmitted power threshold above which a transmission line fails does not seem to change the power-law exponent q ≈1.6 . Furthermore, we study the influence of the placement of generators and consumers on the number of affected consumers and demonstrate that large clusters of generators and consumers are especially vulnerable to cascading failures. As a real-world topology, we consider the German high-voltage transmission grid. Applying the dynamic AC model and considering a random placement of consumers, we find that the probability to disconnect more than a certain number of consumers depends strongly on the threshold. For large thresholds the decay is clearly exponential, while for small ones the decay is slow, indicating a power-law decay.

  10. Transport AC Losses in Striated YBCO Coated Conductors (Postprint)

    2012-02-01

    AFRL-RZ-WP-TP-2012-0124 TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) G.A. Levin and P.N. Barnes Mechanical Energy...TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) 5a. CONTRACT NUMBER In-house 5b. GRANT NUMBER 5c. PROGRAM ELEMENT...2006. 14. ABSTRACT DC current-voltage characteristics and transport ac losses of striated and non-striated Y1Ba2Cu3O7-δ ( YBCO ) coated conductors

  11. AC Electric Field Activated Shape Memory Polymer Composite

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.

    2011-01-01

    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  12. AC electric motors control advanced design techniques and applications

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  13. AC Own Motion Percentage of Randomly Sampled Cases

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  14. In Brief: Science teaching certificate

    Showstack, Randy

    2008-11-01

    More than 200 educators will receive fellowships over the next 5 years to participate in NASA's Endeavor Science Teaching Certificate Project, the agency announced on 14 November. Through workshops, online and on-site graduate courses, and NASA educational materials, the project will expose educators to NASA science and engineering and support them in translating the information for use in classrooms. ``Through the program, educators will learn to deliver cutting-edge science into the classroom, promoting science, technology, engineering, and mathematics education,'' according to Joyce Winterton, assistant administrator for education at NASA Headquarters, in Washington, D. C. Project fellows will earn a certificate from Teachers College Innovations at Teachers College, Columbia University, New York, and graduate credit from other institutional partners. For more information, visit http://education.nasa.gov/home/index.html.

  15. Application of advanced materials to rotating machines

    Triner, J. E.

    1983-01-01

    In discussing the application of advanced materials to rotating machinery, the following topics are covered: the torque speed characteristics of ac and dc machines, motor and transformer losses, the factors affecting core loss in motors, advanced magnetic materials and conductors, and design tradeoffs for samarium cobalt motors.

  16. NASA Tech Briefs, June 2011

    2011-01-01

    Topics covered include: Wind and Temperature Spectrometry of the Upper Atmosphere in Low-Earth Orbit; Health Monitor for Multitasking, Safety-Critical, Real-Time Software; Stereo Imaging Miniature Endoscope; Early Oscillation Detection Technique for Hybrid DC/DC Converters; Parallel Wavefront Analysis for a 4D Interferometer; Schottky Heterodyne Receivers With Full Waveguide Bandwidth; Carbon Nanofiber-Based, High-Frequency, High-Q, Miniaturized Mechanical Resonators; Ultracapacitor-Based Uninterrupted Power Supply System; Coaxial Cables for Martian Extreme Temperature Environments; Using Spare Logic Resources To Create Dynamic Test Points; Autonomous Coordination of Science Observations Using Multiple Spacecraft; Autonomous Phase Retrieval Calibration; EOS MLS Level 1B Data Processing Software, Version 3; Cassini Tour Atlas Automated Generation; Software Development Standard Processes (SDSP); Graphite Composite Panel Polishing Fixture; Material Gradients in Oxygen System Components Improve Safety; Ridge Waveguide Structures in Magnesium-Doped Lithium Niobate; Modifying Matrix Materials to Increase Wetting and Adhesion; Lightweight Magnetic Cooler With a Reversible Circulator; The Invasive Species Forecasting System; Method for Cleanly and Precisely Breaking Off a Rock Core Using a Radial Compressive Force; Praying Mantis Bending Core Breakoff and Retention Mechanism; Scoring Dawg Core Breakoff and Retention Mechanism; Rolling-Tooth Core Breakoff and Retention Mechanism; Vibration Isolation and Stabilization System for Spacecraft Exercise Treadmill Devices; Microgravity-Enhanced Stem Cell Selection; Diagnosis and Treatment of Neurological Disorders by Millimeter-Wave Stimulation; Passive Vaporizing Heat Sink; Remote Sensing and Quantization of Analog Sensors; Phase Retrieval for Radio Telescope and Antenna Control; Helium-Cooled Black Shroud for Subscale Cryogenic Testing; Receive Mode Analysis and Design of Microstrip Reflectarrays; and Chance-Constrained Guidance

  17. NASA Tech Briefs, June 2013

    2013-01-01

    Topics include: Cloud Absorption Radiometer Autonomous Navigation System - CANS, Software Method for Computed Tomography Cylinder Data Unwrapping, Re-slicing, and Analysis, Discrete Data Qualification System and Method Comprising Noise Series Fault Detection, Simple Laser Communications Terminal for Downlink from Earth Orbit at Rates Exceeding 10 Gb/s, Application Program Interface for the Orion Aerodynamics Database, Hyperspectral Imager-Tracker, Web Application Software for Ground Operations Planning Database (GOPDb) Management, Software Defined Radio with Parallelized Software Architecture, Compact Radar Transceiver with Included Calibration, Software Defined Radio with Parallelized Software Architecture, Phase Change Material Thermal Power Generator, The Thermal Hogan - A Means of Surviving the Lunar Night, Micromachined Active Magnetic Regenerator for Low-Temperature Magnetic Coolers, Nano-Ceramic Coated Plastics, Preparation of a Bimetal Using Mechanical Alloying for Environmental or Industrial Use, Phase Change Material for Temperature Control of Imager or Sounder on GOES Type Satellites in GEO, Dual-Compartment Inflatable Suitlock, Modular Connector Keying Concept, Genesis Ultrapure Water Megasonic Wafer Spin Cleaner, Piezoelectrically Initiated Pyrotechnic Igniter, Folding Elastic Thermal Surface - FETS, Multi-Pass Quadrupole Mass Analyzer, Lunar Sulfur Capture System, Environmental Qualification of a Single-Crystal Silicon Mirror for Spaceflight Use, Planar Superconducting Millimeter-Wave/Terahertz Channelizing Filter, Qualification of UHF Antenna for Extreme Martian Thermal Environments, Ensemble Eclipse: A Process for Prefab Development Environment for the Ensemble Project, ISS Live!, Space Operations Learning Center (SOLC) iPhone/iPad Application, Software to Compare NPP HDF5 Data Files, Planetary Data Systems (PDS) Imaging Node Atlas II, Automatic Calibration of an Airborne Imaging System to an Inertial Navigation Unit, Translating MAPGEN to ASPEN for

  18. NASA Tech Briefs, August 2012

    2012-01-01

    Topics covered include: Mars Science Laboratory Drill; Ultra-Compact Motor Controller; A Reversible Thermally Driven Pump for Use in a Sub-Kelvin Magnetic Refrigerator; Shape Memory Composite Hybrid Hinge; Binding Causes of Printed Wiring Assemblies with Card-Loks; Coring Sample Acquisition Tool; Joining and Assembly of Bulk Metallic Glass Composites Through Capacitive Discharge; 670-GHz Schottky Diode-Based Subharmonic Mixer with CPW Circuits and 70-GHz IF; Self-Nulling Lock-in Detection Electronics for Capacitance Probe Electrometer; Discontinuous Mode Power Supply; Optimal Dynamic Sub-Threshold Technique for Extreme Low Power Consumption for VLSI; Hardware for Accelerating N-Modular Redundant Systems for High-Reliability Computing; Blocking Filters with Enhanced Throughput for X-Ray Microcalorimetry; High-Thermal-Conductivity Fabrics; Imidazolium-Based Polymeric Materials as Alkaline Anion-Exchange Fuel Cell Membranes; Electrospun Nanofiber Coating of Fiber Materials: A Composite Toughening Approach; Experimental Modeling of Sterilization Effects for Atmospheric Entry Heating on Microorganisms; Saliva Preservative for Diagnostic Purposes; Hands-Free Transcranial Color Doppler Probe; Aerosol and Surface Parameter Retrievals for a Multi-Angle, Multiband Spectrometer LogScope; TraceContract; AIRS Maps from Space Processing Software; POSTMAN: Point of Sail Tacking for Maritime Autonomous Navigation; Space Operations Learning Center; OVERSMART Reporting Tool for Flow Computations Over Large Grid Systems; Large Eddy Simulation (LES) of Particle-Laden Temporal Mixing Layers; Projection of Stabilized Aerial Imagery Onto Digital Elevation Maps for Geo-Rectified and Jitter-Free Viewing; Iterative Transform Phase Diversity: An Image-Based Object and Wavefront Recovery; 3D Drop Size Distribution Extrapolation Algorithm Using a Single Disdrometer; Social Networking Adapted for Distributed Scientific Collaboration; General Methodology for Designing Spacecraft Trajectories

  19. NASA Tech Briefs, July 2012

    2012-01-01

    Topics covered include: Instrument Suite for Vertical Characterization of the Ionosphere-Thermosphere System; Terahertz Radiation Heterodyne Detector Using Two-Dimensional Electron Gas in a GaN Heterostructure; Pattern Recognition Algorithm for High-Sensitivity Odorant Detection in Unknown Environments; Determining Performance Acceptability of Electrochemical Oxygen Sensors; Versatile Controller for Infrared Lamp and Heater Arrays; High-Speed Scanning Interferometer Using CMOS Image Sensor and FPGA Based on Multifrequency Phase-Tracking Detection; Ultra-Low-Power MEMS Selective Gas Sensors; Compact Receiver Front Ends for Submillimeter-Wave Applications; Dynamically Reconfigurable Systolic Array Accelerator; Blocking Losses With a Photon Counter; Motion-Capture-Enabled Software for Gestural Control of 3D Mod; Orbit Software Suite; CoNNeCT Baseband Processor Module Boot Code SoftWare (BCSW); Trajectory Software With Upper Atmosphere Model; ALSSAT Version 6.0; Employing a Grinding Technology to Assess the Microbial Density for Encapsulated Organisms; Demonstration of Minimally Machined Honeycomb Silicon Carbide Mirrors; Polyimide Aerogel Thin Films; Nanoengineered Thermal Materials Based on Carbon Nanotube Array Composites; Composite Laminate With Coefficient of Thermal Expansion Matching D263 Glass; Robust Tensioned Kevlar Suspension Design; Focal Plane Alignment Utilizing Optical CMM; Purifying, Separating, and Concentrating Cells From a Sample Low in Biomass; Virtual Ultrasound Guidance for Inexperienced Operators; Beat-to-Beat Blood Pressure Monitor; Non-Contact Conductivity Measurement for Automated Sample Processing Systems; An MSK Radar Waveform; Telescope Alignment From Sparsely Sampled Wavefront Measurements Over Pupil Subapertures; Method to Remove Particulate Matter from Dusty Gases at Low Pressures; Terahertz Quantum Cascade Laser With Efficient Coupling and Beam Profile; Measurement Via Optical Near-Nulling and Subaperture Stitching; 885-nm Pumped

  20. Educational Access in India. Country Policy Brief

    Online Submission, 2009

    2009-01-01

    This Policy Brief describes and explains patterns of access to schools in India. It outlines policy and legislation on access to education and provides an analysis of access, vulnerability and exclusion. The quantitative data is supported by a review of research which explains the patterns of access and exclusion. It is based on findings from the…

  1. Counseling Services and Student Success. Research Brief

    Francis, Perry C.; Horn, Aaron S.

    2016-01-01

    The purpose of this research brief is to provide an overview of mental health issues and counseling services on college campuses. The findings from several national surveys are reviewed to estimate the prevalence of anxiety and depression, suicide and suicidal ideation, and violence among college students. Common prevention and treatment programs…

  2. Quality Physical Education. NASPE Resource Brief

    National Association for Sport and Physical Education, 2013

    2013-01-01

    A quality physical education program provides learning opportunities, appropriate instruction, meaningful and challenging content, and student and program assessment. In addition, a quality physical education improves mental alertness, academic performance, and readiness and enthusiasm for learning in the nation's youth. This brief provides a list…

  3. Four Useful Interventions in Brief Family Therapy.

    de Shazer, Steve; Molnar, Alex

    1984-01-01

    Describes four interventions in brief family therapy, illustrated by case examples. Interventions are aimed at helping clients solve problems, and three assumptions about the nature of change are described. Results of these interventions suggest there is no clinical distinction between clients' perceived change and observed change. (JAC)

  4. A Brief Introduction to SLA Theories

    佘阿莉

    2015-01-01

    There are a large number of theories,models or hypotheses in the history of SLA research.A brief introduction is made in this paper on several typical ones which have a great influence on foreign language teaching and it is hoped to be useful for the study of SLA research and foreign language teaching.

  5. Economic Education in Malaysia: A Brief Report.

    Rao, C. A.

    1978-01-01

    This report provides a brief description of economic education in Malaysia and indicates interest, on the part of various Asian countries, i.e., Malaysia, Singapore, Indonesia, Thailand, and the Philippines, in the establishment of economic education programs. (Editor/RK)

  6. The Wage Gap: Briefing Paper #1.

    National Committee on Pay Equity, Washington, DC.

    Women have made slow, steady progress in the labor market since 1979, but the wage gap has not narrowed significantly. This briefing paper updates a September 1987 paper based on "Male-Female Differences in Work Experience, Occupations, and Earnings: 1984" (Current Population Reports, Household Economic Studies, Series P-70, No. 10, issued in…

  7. Genre Identification of Very Brief Musical Excerpts

    Mace, Sandra T.; Wagoner, Cynthia L.; Teachout, David J.; Hodges, Donald A.

    2012-01-01

    The purpose of this study was to examine how well individuals were able to identify different music genres from very brief excerpts and whether musical training, gender and preference played a role in genre identification. Listeners were asked to identify genre from classical, jazz, country, metal, and rap/hip hop excerpts that were 125, 250, 500,…

  8. Program/Planning. [Brief No.] 4.

    Ingalls, Wilbur R., Jr.

    This report is one of a series of briefs prepared by the American Institute of Architects National Committee on Architecture for Education addressing ways and means of reducing costs in the design and delivery of educational facilities. Specifically, this report is a useful guide to understanding the relationships between educational philosophy…

  9. Early Learning and Educational Technology Policy Brief

    Lee, Joan

    2016-01-01

    Recognizing the growth of technology use in early learning settings, the U.S. Department of Education and U.S. Department of Health and Human Services collaborated in the development of the "Early Learning and Educational Technology Policy Brief" to promote developmentally appropriate use of technology in homes and early learning…

  10. Competency-Based Business Degree. Issue Brief

    Washington State Board for Community and Technical Colleges, 2014

    2014-01-01

    In January 2015, thirteen Washington community colleges launched an online, competency-based business transfer degree--the first in the state's community and technical college system. This issue brief provides answers to commonly asked questions about the new competency-based degree.

  11. Trouble Brewing in Los Angeles. Policy Brief

    Buck, Stuart

    2010-01-01

    The city of Los Angeles will face enormous budgetary pressures from the growing deficits in public pensions, both at a state and local level. In this policy brief, the author estimates that Los Angeles faces a total $152.6 billion liability for pensions that are underfunded--including $49.1 billion for the city pension systems, $2.4 billion for…

  12. Trouble Brewing in Orange County. Policy Brief

    Buck, Stuart

    2010-01-01

    Orange County will soon face enormous budgetary pressures from the growing deficits in public pensions, both at a state and local level. In this policy brief, the author estimates that Orange County faces a total $41.2 billion liability for retiree benefits that are underfunded--including $9.4 billion for the county pension system and an estimated…

  13. Trouble Brewing in San Francisco. Policy Brief

    Buck, Stuart

    2010-01-01

    The city of San Francisco will face enormous budgetary pressures from the growing deficits in public pensions, both at a state and local level. In this policy brief, the author estimates that San Francisco faces an aggregate $22.4 billion liability for pensions and retiree health benefits that are underfunded--including $14.1 billion for the city…

  14. NASA Ames Fluid Mechanics Laboratory research briefs

    Davis, Sanford (Editor)

    1994-01-01

    The Ames Fluid Mechanics Laboratory research program is presented in a series of research briefs. Nineteen projects covering aeronautical fluid mechanics and related areas are discussed and augmented with the publication and presentation output of the Branch for the period 1990-1993.

  15. CTE's Role in Urban Education. Issue Brief

    Association for Career and Technical Education (ACTE), 2012

    2012-01-01

    This Issue Brief explores the promising role that career and technical education programs play in addressing key student achievement issues facing urban schools. CTE programs engage urban students by providing rigorous and relevant coursework, fostering positive relationships, establishing clear pathways and connecting education and…

  16. A brief history of dosage compensation

    Stanley M. Gartler

    2014-08-01

    In 1914, H. J. Muller postulated the origin of the Y chromosome as having resulted from restricted recombination between homologous sex chromosomes in the male and the accumulation of deleterious mutations. This evolutionary process leads to dosage compensation. This article lays out a brief history of dosage compensation in genetics.

  17. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  18. Particle Suspension Mechanisms - Supplemental Material

    Dillon, M B

    2011-03-03

    This supplemental material provides a brief introduction to particle suspension mechanisms that cause exfoliated skin cells to become and remain airborne. The material presented here provides additional context to the primary manuscript and serves as background for designing possible future studies to assess the impact of skin cells as a source of infectious aerosols. This introduction is not intended to be comprehensive and interested readers are encouraged to consult the references cited.

  19. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  20. The correlation between superparamagnetic blocking temperatures and peak temperatures obtained from ac magnetization measurements

    Madsen, Daniel Esmarch; Hansen, Mikkel Fougt; Mørup, Steen

    2008-01-01

    We study the correlation between the superparamagnetic blocking temperature TB and the peak positions Tp observed in ac magnetization measurements for nanoparticles of different classes of magnetic materials. In general, Tp=α+βTB . The parameters α and β are different for the in-phase (χ') and out......-of-phase (χ") components and depend on the width σv of the log-normal volume distribution and the class of magnetic material (ferromagnetic/antiferromagnetic). Consequently, knowledge of both α and β is required if the anisotropy energy barrier KV and the attempt time To are to be reliably obtained from...

  1. NASA Tech Briefs, January 2013

    2013-01-01

    Topics include: Single-Photon-Sensitive HgCdTe Avalanche Photodiode Detector; Surface-Enhanced Raman Scattering Using Silica Whispering-Gallery Mode Resonators; 3D Hail Size Distribution Interpolation/Extrapolation Algorithm; Color-Changing Sensors for Detecting the Presence of Hypergolic Fuels; Artificial Intelligence Software for Assessing Postural Stability; Transformers: Shape-Changing Space Systems Built with Robotic Textiles; Fibrillar Adhesive for Climbing Robots; Using Pre-Melted Phase Change Material to Keep Payloads in Space Warm for Hours without Power; Development of a Centrifugal Technique for the Microbial Bioburden Analysis of Freon (CFC-11); Microwave Sinterator Freeform Additive Construction System (MS-FACS); DSP/FPGA Design for a High-Speed Programmable S-Band Space Transceiver; On-Chip Power-Combining for High-Power Schottky Diode-Based Frequency Multipliers; FPGA Vision Data Architecture; Memory Circuit Fault Simulator; Ultra-Compact Transputer-Based Controller for High-Level, Multi-Axis Coordination; Regolith Advanced Surface Systems Operations Robot Excavator; Magnetically Actuated Seal; Hybrid Electrostatic/Flextensional Mirror for Lightweight, Large-Aperture, and Cryogenic Space Telescopes; System for Contributing and Discovering Derived Mission and Science Data; Remote Viewer for Maritime Robotics Software; Stackfile Database; Reachability Maps for In Situ Operations; JPL Space Telecommunications Radio System Operating Environment; RFI-SIM: RFI Simulation Package; ION Configuration Editor; Dtest Testing Software; IMPaCT - Integration of Missions, Programs, and Core Technologies; Integrated Systems Health Management (ISHM) Toolkit; Wind-Driven Wireless Networked System of Mobile Sensors for Mars Exploration; In Situ Solid Particle Generator; Analysis of the Effects of Streamwise Lift Distribution on Sonic Boom Signature; Rad-Tolerant, Thermally Stable, High-Speed Fiber-Optic Network for Harsh Environments; Towed Subsurface Optical

  2. NASA Tech Briefs, June 2014

    2014-01-01

    Topics include: Real-Time Minimization of Tracking Error for Aircraft Systems; Detecting an Extreme Minority Class in Hyperspectral Data Using Machine Learning; KSC Spaceport Weather Data Archive; Visualizing Acquisition, Processing, and Network Statistics Through Database Queries; Simulating Data Flow via Multiple Secure Connections; Systems and Services for Near-Real-Time Web Access to NPP Data; CCSDS Telemetry Decoder VHDL Core; Thermal Response of a High-Power Switch to Short Pulses; Solar Panel and System Design to Reduce Heating and Optimize Corridors for Lower-Risk Planetary Aerobraking; Low-Cost, Very Large Diamond-Turned Metal Mirror; Very-High-Load-Capacity Air Bearing Spindle for Large Diamond Turning Machines; Elevated-Temperature, Highly Emissive Coating for Energy Dissipation of Large Surfaces; Catalyst for Treatment and Control of Post-Combustion Emissions; Thermally Activated Crack Healing Mechanism for Metallic Materials; Subsurface Imaging of Nanocomposites; Self-Healing Glass Sealants for Solid Oxide Fuel Cells and Electrolyzer Cells; Micromachined Thermopile Arrays with Novel Thermo - electric Materials; Low-Cost, High-Performance MMOD Shielding; Head-Mounted Display Latency Measurement Rig; Workspace-Safe Operation of a Force- or Impedance-Controlled Robot; Cryogenic Mixing Pump with No Moving Parts; Seal Design Feature for Redundancy Verification; Dexterous Humanoid Robot; Tethered Vehicle Control and Tracking System; Lunar Organic Waste Reformer; Digital Laser Frequency Stabilization via Cavity Locking Employing Low-Frequency Direct Modulation; Deep UV Discharge Lamps in Capillary Quartz Tubes with Light Output Coupled to an Optical Fiber; Speech Acquisition and Automatic Speech Recognition for Integrated Spacesuit Audio Systems, Version II; Advanced Sensor Technology for Algal Biotechnology; High-Speed Spectral Mapper; "Ascent - Commemorating Shuttle" - A NASA Film and Multimedia Project DVD; High-Pressure, Reduced-Kinetics Mechanism for N

  3. ETV Tech Brief: Rapid Fungi and Bacteria Detection Technologies

    Technical brief that summarizes the results for Mycometer, Inc. Mycometer®-test and Bactiquant®-test, which are rapid detection technologies for fungi and bacteria. The brief summarizes the results of the verification report and statement.

  4. Citizens Science for Sustainability (SuScit) Project Briefing

    Eames, Malcolm; Mortensen, Jonas Egmose; Adebowale, Maria;

    This project briefing gives a short overview of the Citizens Science for Sustainability (SuScit) Project.......This project briefing gives a short overview of the Citizens Science for Sustainability (SuScit) Project....

  5. NASA Tech Briefs, September 2004

    2004-01-01

    Topics covered include: Brazing SiC/SiC Composites to Metals; Composite-Material Tanks with Chemically Resistant Liners; Thermally Conductive Metal-Tube/Carbon-Composite Joints; Improved BN Coatings on SiC Fibers in SiC Matrices; Iterative Demodulation and Decoding of Non-Square QAM; Measuring Radiation Patterns of Reconfigurable Patch Antennas on Wafers; Low-Cutoff, High-Pass Digital Filtering of Neural Signals; Further Improvement in 3DGRAPE; Ground Support Software for Spaceborne Instrumentation; MER SPICE Interface; Simulating Operation of a Planetary Rover; Analyzing Contents of a Computer Cache; Discrepancy Reporting Management System; Silicone-Rubber Microvalves Actuated by Paraffin; Hydraulic Apparatus for Mechanical Testing of Nuts; Heat Control via Torque Control in Friction Stir Welding; Manufacturing High-Quality Carbon Nanotubes at Lower Cost; Setup for Visual Observation of Carbon-Nanotube Arc Process; Solution Preserves Nucleic Acids in Body-Fluid Specimens; Oligodeoxynucleotide Probes for Detecting Intact Cells; Microwave-Spectral Signatures Would Reveal Concealed Objects; Digital Averaging Phasemeter for Heterodyne Interferometry; Optoelectronic Instrument Monitors pH in a Culture Medium; Imaging of gamma-Irradiated Regions of a Crystal; Photodiode-Based, Passive Ultraviolet Dosimeters; Discrete Wavelength-Locked External Cavity Laser; Flexible Shields for Protecting Spacecraft Against Debris; Part 2 of a Computational Study of a Drop-Laden Mixing Layer; Controllable Curved Mirrors Made from Single-Layer EAP Films; and Demonstration of a Pyrotechnic Bolt-Retractor System.

  6. NASA Tech Briefs, July 2004

    2004-01-01

    Topics: Optoelectronic Sensor System for Guidance in Docking; Hybrid Piezoelectric/Fiber-Optic Sensor Sheets; Multisensor Arrays for Greater Reliability and Accuracy; Integrated-Optic Oxygen Sensors; Ka-Band Autonomous Formation Flying Sensor; CMOS VLSI Active-Pixel Sensor for Tracking; Lightweight, Self-Deploying Foam Antenna Structures; Electrically Small Microstrip Quarter-Wave Monopole Antennas; A 2-to-28-MHz Phase-Locked Loop; Portable Electromyograph; Open-Source Software for Modeling of Nanoelectronic Devices; Software for Generating Strip Maps from SAR Data; Calibration Software for use with Jurassicprok; Software for Probabilistic Risk Reduction; Software Processes SAR Motion-Measurement Data; Improved Method of Purifying Carbon Nanotubes; Patterned Growth of Carbon Nanotubes or Nanofibers; Lightweight, Rack-Mountable Composite Cold Plate/Shelves; SiC-Based Miniature High-Temperature Cantilever Anemometer; Inlet Housing for a Partial-Admission Turbine; Lightweight Thermoformed Structural Components and Optics; Growing High-Quality InAs Quantum Dots for Infrared Lasers; Selected Papers on Protoplanetary Disks; Module for Oxygenating Water without Generating Bubbles; Coastal Research Imaging Spectrometer; Rapid Switching and Modulation by use of Coupled VCSELs; Laser-Induced-Fluorescence Photogrammetry and Videogrammetry; Laboratory Apparatus Generates Dual-Species Cold Atomic Beam; Laser Ablation of Materials for Propulsion of Spacecraft; Small Active Radiation Monitor; Hybrid Image-Plane/Stereo Manipulation; Partitioning a Gridded Rectangle into Smaller Rectangles; Digital Radar-Signal Processors Implemented in FPGAs; Part 1 of a Computational Study of a Drop-Laden Mixing Layer; and Some Improvements in Signal-Conditioning Circuits.

  7. NASA Tech Briefs, August 2006

    2006-01-01

    Topics covered include: Measurement and Controls Data Acquisition System IMU/GPS System Provides Position and Attitude Data Using Artificial Intelligence to Inform Pilots of Weather Fast Lossless Compression of Multispectral-Image Data Developing Signal-Pattern-Recognition Programs Implementing Access to Data Distributed on Many Processors Compact, Efficient Drive Circuit for a Piezoelectric Pump; Dual Common Planes for Time Multiplexing of Dual-Color QWIPs; MMIC Power Amplifier Puts Out 40 mW From 75 to 110 GHz; 2D/3D Visual Tracker for Rover Mast; Adding Hierarchical Objects to Relational Database General-Purpose XML-Based Information Managements; Vaporizable Scaffolds for Fabricating Thermoelectric Modules; Producing Quantum Dots by Spray Pyrolysis; Mobile Robot for Exploring Cold Liquid/Solid Environments; System Would Acquire Core and Powder Samples of Rocks; Improved Fabrication of Lithium Films Having Micron Features; Manufacture of Regularly Shaped Sol-Gel Pellets; Regulating Glucose and pH, and Monitoring Oxygen in a Bioreactor; Satellite Multiangle Spectropolarimetric Imaging of Aerosols; Interferometric System for Measuring Thickness of Sea Ice; Microscale Regenerative Heat Exchanger Protocols for Handling Messages Between Simulation Computers Statistical Detection of Atypical Aircraft Flights NASA's Aviation Safety and Modeling Project Multimode-Guided-Wave Ultrasonic Scanning of Materials Algorithms for Maneuvering Spacecraft Around Small Bodies Improved Solar-Radiation-Pressure Models for GPS Satellites Measuring Attitude of a Large, Flexible, Orbiting Structure

  8. Effective ac response in weakly nonlinear composites

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  9. Fuzzy efficiency optimization of AC induction motors

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  10. Transcranial alternating current stimulation (tACS

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  11. AC Dielectrophoresis Using Elliptic Electrode Geometry

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  12. Inkjet printing of multifilamentary YBCO for low AC loss coated conductors

    Hopkins, S. C.; Joseph, D.; Mitchell-Williams, T. B.; Calleja, A.; Vlad, V. R.; Vilardell, M.; Ricart, S.; Granados, X.; Puig, T.; Obradors, X.; Usoskin, A.; Falter, M.; Bäcker, M.; Glowacki, B. A.

    2014-05-01

    Considerable progress has been made with the development of REBCO coated conductors in recent years, and high performance conductors are available commercially. For many applications, however, the cost remains prohibitive, and AC losses discourage their selection for higher frequency applications. Chemical solution deposition (CSD) methods are attractive for low-cost, scalable preparation of buffer and superconductor layers, and in many respects inkjet printing is the method of choice, permitting non-contact deposition with minimal materials wastage and excellent control of coating thickness. Highly textured coatings of YBCO and Gd-doped CeO2 have previously been reported on buffered metal substrates. Inkjet printing also introduces the possibility of patterning - directly depositing two and three dimensional structures without subtractive processing - offering a low-cost route to coated conductors with reduced AC losses. In this contribution, the inkjet deposition of superconducting YBCO tracks is reported on industrially relevant buffered metal substrates both by direct printing and an inverse patterning approach. In the latter approach, ceria tracks were printed reported, which are a candidate both for resistive filament spacers and buffer layers. TFA-based precursor solutions have been printed on SS/ABAD-YSZ/CeO2 and Ni-W/LZO/CeO2 RABiTS substrates, and the resulting multifilamentary samples characterised by microscopy and scanning Hall probe measurements. The prospects for future inkjet-printed low AC loss coated conductors are discussed, including control of interfilamentary resistivity and bridging, transposed filamentary structures and stabilisation material.

  13. NASA Tech Briefs, September 2013

    2013-01-01

    Topics include: ISS Ammonia Leak Detection Through X-Ray Fluorescence; A System for Measuring the Sway of the Vehicle Assembly Building; Fast, High-Precision Readout Circuit for Detector Arrays; Victim Simulator for Victim Detection Radar; Hydrometeor Size Distribution Measurements by Imaging the Attenuation of a Laser Spot; Quasi-Linear Circuit; High-Speed, High-Resolution Time-to-Digital Conversion; Li-Ion Battery and Supercapacitor Hybrid Design for Long Extravehicular Activities; Ultrasonic Low-Friction Containment Plate for Thermal and Ultrasonic Stir Weld Processes; High-Powered, Ultrasonically Assisted Thermal Stir Welding; Next-Generation MKIII Lightweight HUT/Hatch Assembly; Centrifugal Sieve for Gravity-Level-Independent Size; Segregation of Granular Materials; Ion Exchange Technology Development in Support of the Urine Processor Assembly; Nickel-Graphite Composite Compliant Interface and/or Hot Shoe Material; UltraSail CubeSat Solar Sail Flight Experiment; Mechanism for Deploying a Long, Thin-Film Antenna From a Rover; Counterflow Regolith Heat Exchanger; Acquisition and Retaining Granular Samples via a Rotating Coring Bit; Very-Low-Cost, Rugged Vacuum System; Medicine Delivery Device With Integrated Sterilization and Detection; FRET-Aptamer Assays for Bone Marker Assessment, C-Telopeptide, Creatinine, and Vitamin D; Multimode Directional Coupler for Utilization of Harmonic Frequencies from TWTAs; Dual-Polarization, Multi-Frequency Antenna Array for use with Hurricane Imaging Radiometer; Complementary Barrier Infrared Detector (CBIRD) Contact Methods; Autonomous Control of Space Nuclear Reactors; High-Power, High-Speed Electro-Optic Pockels Cell Modulator; Covariance Analysis Tool (G-CAT) for Computing Ascent, Descent, and Landing Errors; Enigma Version 12; Micrometeoroid and Orbital Debris (MMOD) Shield Ballistic Limit Analysis Program; Spitzer Telemetry Processing System; Planetary Protection Bioburden Analysis Program; Wing Leading Edge RCC Rapid

  14. Brief history of laser AGEX

    Perry, T S

    2001-01-26

    A great deal of physics understanding is required for the design and construction of thermonuclear weapons. Since the days of the Manhattan Project, physicists have relied on a combination of theory and experiment for the successful creation of nuclear weapons. One of the great experimental difficulties faced by the designers of nuclear weapons is that nuclear weapons operate in a high energy density regime not found on the earth except during a nuclear weapon detonation. Replicating these conditions is difficult unless a nuclear weapon is actually detonated. One of the reasons for the large number of expensive tests at the Nevada Test Site was that there was no other way to obtain the required data. When the laser was first developed many in the weapons program realized that the ability of a laser to concentrate a large amount of energy in a small volume could create experimental conditions that would be useful for studying the physics of nuclear weapons. The national weapons labs began investigating this possibility and started building ever bigger and better lasers. The vast difference in energy scales between the laboratory and a nuclear weapons explosion meant large and powerful lasers were required. By the early '80s concrete plans for the use of lasers in weapon physics experiments were beginning to be proposed. One of the earliest was the ''Proposals for Laboratory Weapon Physics Experiments'' in 1982 put out by the Physics Experiments Advisory Panel. The radiation hydrodynamics experiments described in these early proposals formed the basis for many of the experiments on lasers that have performed for the last two decades. The Nova laser, which operated between 1984 and 1998 successfully, showed that many of these proposals could be carried out on a large laser system. One of the earliest experiments on Nova was in the area of x-ray opacity. Materials vary in the degree to which they absorb and re-emit radiation of given

  15. Investigating the factor structure of the Questionnaire on Smoking Urges-Brief (QSU-Brief).

    Toll, Benjamin A; Katulak, Nicole A; McKee, Sherry A

    2006-07-01

    This study was designed to investigate the proposed two-factor structure of the 10-item Questionnaire on Smoking Urges-Brief (QSU-Brief) and to provide evidence for the psychometric properties of this questionnaire using the seven-point scoring set from the original QSU study [Tiffany, S.T., Drobes, D.J. (1991). The development and initial validation of a questionnaire on smoking urges. British Journal of Addiction, 86, 1467-1476.]. The study sample (N=576) was comprised of smokers presenting for treatment. Although an initial exploratory factor analysis appeared to replicate the original factor analytic findings of Cox et al. [Cox, L.S., Tiffany, S.T., Christen, A.G. (2001). Evaluation of the brief questionnaire of smoking urges (QSU-Brief) in laboratory and clinical settings. Nicotine and Tobacco Research, 3, 7-16.], when subjected to confirmatory factor analyses, a five-item, two-factor model using the most robust items from the original QSU-Brief factor analysis was the best explanation of the data in the present study. Good internal consistency reliability estimates were also obtained with this model. These results suggest that this shortened form of the QSU-Brief can be used with the original seven-point scoring set as a reliable assessment of the dual nature of smoking urges in a treatment-seeking population.

  16. NASA Tech Briefs, November 2004

    2004-01-01

    Topics include: Multifunction Imaging and Spectroscopic Instrument; Position-Finding Instrument Built Around a Magnetometer; Improved Measurement of Dispersion in an Optical Fiber; Probe for Sampling of Interstitial Fluid From Bone; Neuropsychological Testing of Astronauts; Method of Calibration for a Large Cathetometer System; Four-Channel PC/104 MIL-STD-1553 Circuit Board; Improved Method of Locating Defects in Wiring Insulation; Strobe Traffic Lights Warn of Approaching Emergency Vehicles; Improved Timing Scheme for Spaceborne Precipitation Radar; Concept for Multiple-Access Free-Space Laser Communications; Variable Shadow Screens for Imaging Optical Devices; Verifying Diagnostic Software; Initial Processing of Infrared Spectral Data; Activity-Centric Approach to Distributed Programming; Controlling Distributed Planning; New Material for Surface-Enhanced Raman Spectroscopy; Treated Carbon Nanofibers for Storing Energy in Aqueous KOH; Advanced Infant Car Seat Would Increase Highway Safety; Development of Biomorphic Flyers; Second-Generation Six-Limbed Experimental Robot; Miniature Linear Actuator for Small Spacecraft; Process for Making Single-Domain Magnetite Crystals; A New Process for Fabricating Random Silicon Nanotips; Resin-Transfer-Molding of a Tool Face; Improved Phase-Mask Fabrication of Fiber Bragg Gratings; Tool for Insertion of a Fiber-Optic Terminus in a Connector; Nanofluidic Size-Exclusion Chromatograph; Lightweight, Low-CTE Tubes Made From Biaxially Oriented LCPs; Using Redundancy To Reduce Errors in Magnetometer Readings; Compact Instrument for Measuring Profile of a Light Beam; Multilayer Dielectric Transmissive Optical Phase Modulator; Second-Generation Multi-Angle Imaging Spectroradiometer; Real-Time Adaptive Color Segmentation by Neural Networks; Research and Development in Optical Communications; Tests of Multibeam Scintillation Mitigation on Laser Uplinks; and Spaceborne Infrared Atmospheric Sounder.

  17. NASA Tech Briefs, September 2010

    2010-01-01

    Topics covered include: Instrument for Measuring Thermal Conductivity of Materials at Low Temperatures; Multi-Axis Accelerometer Calibration System; Pupil Alignment Measuring Technique and Alignment Reference for Instruments or Optical Systems; Autonomous System for Monitoring the Integrity of Composite Fan Housings; A Safe, Self-Calibrating, Wireless System for Measuring Volume of Any Fuel at Non-Horizontal Orientation; Adaptation of the Camera Link Interface for Flight-Instrument Applications; High-Performance CCSDS Encapsulation Service Implementation in FPGA; High-Performance CCSDS AOS Protocol Implementation in FPGA; Advanced Flip Chips in Extreme Temperature Environments; Diffuse-Illumination Systems for Growing Plants; Microwave Plasma Hydrogen Recovery System; Producing Hydrogen by Plasma Pyrolysis of Methane; Self-Deployable Membrane Structures; Reactivation of a Tin-Oxide-Containing Catalys; Functionalization of Single-Wall Carbon Nanotubes by Photo-Oxidation; Miniature Piezoelectric Macro-Mass Balance; Acoustic Liner for Turbomachinery Applications; Metering Gas Strut for Separating Rocket Stages; Large-Flow-Area Flow-Selective Liquid/Gas Separator; Counterflowing Jet Subsystem Design; Water Tank with Capillary Air/Liquid Separation; True Shear Parallel Plate Viscometer; Focusing Diffraction Grating Element with Aberration Control; Universal Millimeter-Wave Radar Front End; Mode Selection for a Single-Frequency Fiber Laser; Qualification and Selection of Flight Diode Lasers for Space Applications; Plenoptic Imager for Automated Surface Navigation; Maglev Facility for Simulating Variable Gravity; Hybrid AlGaN-SiC Avalanche Photodiode for Deep-UV Photon Detection; High-Speed Operation of Interband Cascade Lasers; 3D GeoWall Analysis System for Shuttle External Tank Foreign Object Debris Events; Charge-Spot Model for Electrostatic Forces in Simulation of Fine Particulates; Hidden Statistics Approach to Quantum Simulations; Reconstituted Three

  18. NASA Tech Briefs, November 2009

    2009-01-01

    Topics covered include: Cryogenic Chamber for Servo-Hydraulic Materials Testing; Apparatus Measures Thermal Conductance Through a Thin Sample from Cryogenic to Room Temperature; Rover Attitude and Pointing System Simulation Testbed; Desktop Application Program to Simulate Cargo-Air-Drop Tests; Multimodal Friction Ignition Tester; Small-Bolt Torque-Tension Tester; Integrated Spacesuit Audio System Enhances Speech Quality and Reduces Noise; Hardware Implementation of a Bilateral Subtraction Filter; Simple Optoelectronic Feedback in Microwave Oscillators; Small X-Band Oscillator Antennas; Free-Space Optical Interconnect Employing VCSEL Diodes; Discrete Fourier Transform Analysis in a Complex Vector Space; Miniature Scroll Pumps Fabricated by LIGA; Self-Assembling, Flexible, Pre-Ceramic Composite Preforms; Flight-speed Integral Image Analysis Toolkit; Work Coordination Engine; Multi-Mission Automated Task Invocation Subsystem; Autonomously Calibrating a Quadrupole Mass Spectrometer; Determining Spacecraft Reaction Wheel Friction Parameters; Composite Silica Aerogels Opacified with Titania; Multiplexed Colorimetric Solid-Phase Extraction; Detecting Airborne Mercury by Use of Polymer/Carbon Films; Lattice-Matched Semiconductor Layers on Single Crystalline Sapphire Substrate; Pressure-Energized Seal Rings to Better Withstand Flows; Rollerjaw Rock Crusher; Microwave Sterilization and Depyrogenation System; Quantifying Therapeutic and Diagnostic Efficacy in 2D Microvascular Images; NiF2/NaF:CaF2/Ca Solid-State High-Temperature Battery Cells; Critical Coupling Between Optical Fibers and WGM Resonators; Microwave Temperature Profiler Mounted in a Standard Airborne Research Canister; Alternative Determination of Density of the Titan Atmosphere; Solar Rejection Filter for Large Telescopes; Automated CFD for Generation of Airfoil Performance Tables; Progressive Classification Using Support Vector Machines; Active Learning with Irrelevant Examples; A Data Matrix Method for

  19. NASA Tech Briefs, February 2011

    2011-01-01

    Topics covered include: Multi-Segment Radius Measurement Using an Absolute Distance Meter Through a Null Assembly; Fiber-Optic Magnetic-Field-Strength Measurement System for Lightning Detection; Photocatalytic Active Radiation Measurements and Use; Computer Generated Hologram System for Wavefront Measurement System Calibration; Non-Contact Thermal Properties Measurement with Low-Power Laser and IR Camera System; SpaceCube 2.0: An Advanced Hybrid Onboard Data Processor; CMOS Imager Has Better Cross-Talk and Full-Well Performance; High-Performance Wireless Telemetry; Telemetry-Based Ranging; JWST Wavefront Control Toolbox; Java Image I/O for VICAR, PDS, and ISIS; X-Band Acquisition Aid Software; Antimicrobial-Coated Granules for Disinfecting Water; Range 7 Scanner Integration with PaR Robot Scanning System; Methods of Antimicrobial Coating of Diverse Materials; High-Operating-Temperature Barrier Infrared Detector with Tailorable Cutoff Wavelength; A Model of Reduced Kinetics for Alkane Oxidation Using Constituents and Species for N-Heptane; Thermally Conductive Tape Based on Carbon Nanotube Arrays; Two Catalysts for Selective Oxidation of Contaminant Gases; Nanoscale Metal Oxide Semiconductors for Gas Sensing; Lightweight, Ultra-High-Temperature, CMC-Lined Carbon/Carbon Structures; Sample Acquisition and Handling System from a Remote Platform; Improved Rare-Earth Emitter Hollow Cathode; High-Temperature Smart Structures for Engine Noise Reduction and Performance Enhancement; Cryogenic Scan Mechanism for Fourier Transform Spectrometer; Piezoelectric Rotary Tube Motor; Thermoelectric Energy Conversion Technology for High-Altitude Airships; Combustor Computations for CO2-Neutral Aviation; Use of Dynamic Distortion to Predict and Alleviate Loss of Control; Cycle Time Reduction in Trapped Mercury Ion Atomic Frequency Standards; and A (201)Hg+ Comagnetometer for (199)Hg+ Trapped Ion Space Atomic Clocks.

  20. NASA Tech Briefs, April 2012

    2012-01-01

    Topics include: Computational Ghost Imaging for Remote Sensing; Digital Architecture for a Trace Gas Sensor Platform; Dispersed Fringe Sensing Analysis - DFSA; Indium Tin Oxide Resistor-Based Nitric Oxide Microsensors; Gas Composition Sensing Using Carbon Nanotube Arrays; Sensor for Boundary Shear Stress in Fluid Flow; Model-Based Method for Sensor Validation; Qualification of Engineering Camera for Long-Duration Deep Space Missions; Remotely Powered Reconfigurable Receiver for Extreme Environment Sensing Platforms; Bump Bonding Using Metal-Coated Carbon Nanotubes; In Situ Mosaic Brightness Correction; Simplex GPS and InSAR Inversion Software; Virtual Machine Language 2.1; Multi-Scale Three-Dimensional Variational Data Assimilation System for Coastal Ocean Prediction; Pandora Operation and Analysis Software; Fabrication of a Cryogenic Bias Filter for Ultrasensitive Focal Plane; Processing of Nanosensors Using a Sacrificial Template Approach; High-Temperature Shape Memory Polymers; Modular Flooring System; Non-Toxic, Low-Freezing, Drop-In Replacement Heat Transfer Fluids; Materials That Enhance Efficiency and Radiation Resistance of Solar Cells; Low-Cost, Rugged High-Vacuum System; Static Gas-Charging Plug; Floating Oil-Spill Containment Device; Stemless Ball Valve; Improving Balance Function Using Low Levels of Electrical Stimulation of the Balance Organs; Oxygen-Methane Thruster; Lunar Navigation Determination System - LaNDS; Launch Method for Kites in Low-Wind or No-Wind Conditions; Supercritical CO2 Cleaning System for Planetary Protection and Contamination Control Applications; Design and Performance of a Wideband Radio Telescope; Finite Element Models for Electron Beam Freeform Fabrication Process Autonomous Information Unit for Fine-Grain Data Access Control and Information Protection in a Net-Centric System; Vehicle Detection for RCTA/ANS (Autonomous Navigation System); Image Mapping and Visual Attention on the Sensory Ego-Sphere; HyDE Framework for

  1. NASA Tech Briefs, May 2013

    2013-01-01

    Topics include: Test Waveform Applications for JPL STRS Operating Environment; Pneumatic Proboscis Heat-Flow Probe; Method to Measure Total Noise Temperature of a Wireless Receiver During Operation; Cursor Control Device Test Battery; Functional Near-Infrared Spectroscopy Signals Measure Neuronal Activity in the Cortex; ESD Test Apparatus for Soldering Irons; FPGA-Based X-Ray Detection and Measurement for an X-Ray Polarimeter; Sequential Probability Ratio Test for Spacecraft Collision Avoidance Maneuver Decisions; Silicon/Carbon Nanotube Photocathode for Splitting Water; Advanced Materials and Fabrication Techniques for the Orion Attitude Control Motor; Flight Hardware Packaging Design for Stringent EMC Radiated Emission Requirements; RF Reference Switch for Spaceflight Radiometer Calibration; An Offload NIC for NASA, NLR, and Grid Computing; Multi-Scale CNT-Based Reinforcing Polymer Matrix Composites for Lightweight Structures; Ceramic Adhesive and Methods for On-Orbit Repair of Re-Entry Vehicles; Self-Healing Nanocomposites for Reusable Composite Cryotanks; Pt-Ni and Pt-Co Catalyst Synthesis Route for Fuel Cell Applications; Aerogel-Based Multilayer Insulation with Micrometeoroid Protection; Manufacturing of Nanocomposite Carbon Fibers and Composite Cylinders; Optimized Radiator Geometries for Hot Lunar Thermal Environments; A Mission Concept: Re-Entry Hopper-Aero-Space-Craft System on-Mars (REARM-Mars); New Class of Flow Batteries for Terrestrial and Aerospace Energy Storage Applications; Reliability of CCGA 1152 and CCGA 1272 Interconnect Packages for Extreme Thermal Environments; Using a Blender to Assess the Microbial Density of Encapsulated Organisms; Mixed Integer Programming and Heuristic Scheduling for Space Communication; Video Altimeter and Obstruction Detector for an Aircraft; Control Software for Piezo Stepping Actuators; Galactic Cosmic Ray Event-Based Risk Model (GERM) Code; Sasquatch Footprint Tool; and Multi-User Space Link Extension (SLE) System.

  2. NASA Tech Briefs, October 2007

    2007-01-01

    Topics covered include; Wirelessly Interrogated Position or Displacement Sensors; Ka-Band Radar Terminal Descent Sensor; Metal/Metal Oxide Differential Electrode pH Sensors; Improved Sensing Coils for SQUIDs; Inductive Linear-Position Sensor/Limit-Sensor Units; Hilbert-Curve Fractal Antenna With Radiation- Pattern Diversity; Single-Camera Panoramic-Imaging Systems; Interface Electronic Circuitry for an Electronic Tongue; Inexpensive Clock for Displaying Planetary or Sidereal Time; Efficient Switching Arrangement for (N + 1)/N Redundancy; Lightweight Reflectarray Antenna for 7.115 and 32 GHz; Opto-Electronic Oscillator Using Suppressed Phase Modulation; Alternative Controller for a Fiber-Optic Switch; Strong, Lightweight, Porous Materials; Nanowicks; Lightweight Thermal Protection System for Atmospheric Entry; Rapid and Quiet Drill; Hydrogen Peroxide Concentrator; MMIC Amplifiers for 90 to 130 GHz; Robot Would Climb Steep Terrain; Measuring Dynamic Transfer Functions of Cavitating Pumps; Advanced Resistive Exercise Device; Rapid Engineering of Three-Dimensional, Multicellular Tissues With Polymeric Scaffolds; Resonant Tunneling Spin Pump; Enhancing Spin Filters by Use of Bulk Inversion Asymmetry; Optical Magnetometer Incorporating Photonic Crystals; WGM-Resonator/Tapered-Waveguide White-Light Sensor Optics; Raman-Suppressing Coupling for Optical Parametric Oscillator; CO2-Reduction Primary Cell for Use on Venus; Cold Atom Source Containing Multiple Magneto- Optical Traps; POD Model Reconstruction for Gray-Box Fault Detection; System for Estimating Horizontal Velocity During Descent; Software Framework for Peer Data-Management Services; Autogen Version 2.0; Tracking-Data-Conversion Tool; NASA Enterprise Visual Analysis; Advanced Reference Counting Pointers for Better Performance; C Namelist Facility; and Efficient Mosaicking of Spitzer Space Telescope Images.

  3. NASA Tech Briefs, September 2008

    2008-01-01

    Topics covered include: Nanotip Carpets as Antireflection Surfaces; Nano-Engineered Catalysts for Direct Methanol Fuel Cells; Capillography of Mats of Nanofibers; Directed Growth of Carbon Nanotubes Across Gaps; High-Voltage, Asymmetric-Waveform Generator; Magic-T Junction Using Microstrip/Slotline Transitions; On-Wafer Measurement of a Silicon-Based CMOS VCO at 324 GHz; Group-III Nitride Field Emitters; HEMT Amplifiers and Equipment for their On-Wafer Testing; Thermal Spray Formation of Polymer Coatings; Improved Gas Filling and Sealing of an HC-PCF; Making More-Complex Molecules Using Superthermal Atom/Molecule Collisions; Nematic Cells for Digital Light Deflection; Improved Silica Aerogel Composite Materials; Microgravity, Mesh-Crawling Legged Robots; Advanced Active-Magnetic-Bearing Thrust- Measurement System; Thermally Actuated Hydraulic Pumps; A New, Highly Improved Two-Cycle Engine; Flexible Structural-Health-Monitoring Sheets; Alignment Pins for Assembling and Disassembling Structures; Purifying Nucleic Acids from Samples of Extremely Low Biomass; Adjustable-Viewing-Angle Endoscopic Tool for Skull Base and Brain Surgery; UV-Resistant Non-Spore-Forming Bacteria From Spacecraft-Assembly Facilities; Hard-X-Ray/Soft-Gamma-Ray Imaging Sensor Assembly for Astronomy; Simplified Modeling of Oxidation of Hydrocarbons; Near-Field Spectroscopy with Nanoparticles Deposited by AFM; Light Collimator and Monitor for a Spectroradiometer; Hyperspectral Fluorescence and Reflectance Imaging Instrument; Improving the Optical Quality Factor of the WGM Resonator; Ultra-Stable Beacon Source for Laboratory Testing of Optical Tracking; Transmissive Diffractive Optical Element Solar Concentrators; Delaying Trains of Short Light Pulses in WGM Resonators; Toward Better Modeling of Supercritical Turbulent Mixing; JPEG 2000 Encoding with Perceptual Distortion Control; Intelligent Integrated Health Management for a System of Systems; Delay Banking for Managing Air Traffic; and Spline

  4. NASA Tech Briefs, March 2013

    2013-01-01

    Topics covered include: Remote Data Access with IDL Data Compression Algorithm Architecture for Large Depth-of-Field Particle Image Velocimeters Vectorized Rebinning Algorithm for Fast Data Down-Sampling Display Provides Pilots with Real-Time Sonic-Boom Information Onboard Algorithms for Data Prioritization and Summarization of Aerial Imagery Monitoring and Acquisition Real-time System (MARS) Analog Signal Correlating Using an Analog-Based Signal Conditioning Front End Micro-Textured Black Silicon Wick for Silicon Heat Pipe Array Robust Multivariable Optimization and Performance Simulation for ASIC Design; Castable Amorphous Metal Mirrors and Mirror Assemblies; Sandwich Core Heat-Pipe Radiator for Power and Propulsion Systems; Apparatus for Pumping a Fluid; Cobra Fiber-Optic Positioner Upgrade; Improved Wide Operating Temperature Range of Li-Ion Cells; Non-Toxic, Non-Flammable, -80 C Phase Change Materials; Soft-Bake Purification of SWCNTs Produced by Pulsed Laser Vaporization; Improved Cell Culture Method for Growing Contracting Skeletal Muscle Models; Hand-Based Biometric Analysis; The Next Generation of Cold Immersion Dry Suit Design Evolution for Hypothermia Prevention; Integrated Lunar Information Architecture for Decision Support Version 3.0 (ILIADS 3.0); Relay Forward-Link File Management Services (MaROS Phase 2); Two Mechanisms to Avoid Control Conflicts Resulting from Uncoordinated Intent; XTCE GOVSAT Tool Suite 1.0; Determining Temperature Differential to Prevent Hardware Cross-Contamination in a Vacuum Chamber; SequenceL: Automated Parallel Algorithms Derived from CSP-NT Computational Laws; Remote Data Exploration with the Interactive Data Language (IDL); Mixture-Tuned, Clutter Matched Filter for Remote Detection of Subpixel Spectral Signals; Partitioned-Interval Quantum Optical Communications Receiver; and Practical UAV Optical Sensor Bench with Minimal Adjustability.

  5. NASA Tech Briefs, March 2014

    2014-01-01

    Topics include: Data Fusion for Global Estimation of Forest Characteristics From Sparse Lidar Data; Debris and Ice Mapping Analysis Tool - Database; Data Acquisition and Processing Software - DAPS; Metal-Assisted Fabrication of Biodegradable Porous Silicon Nanostructures; Post-Growth, In Situ Adhesion of Carbon Nanotubes to a Substrate for Robust CNT Cathodes; Integrated PEMFC Flow Field Design for Gravity-Independent Passive Water Removal; Thermal Mechanical Preparation of Glass Spheres; Mechanistic-Based Multiaxial-Stochastic-Strength Model for Transversely-Isotropic Brittle Materials; Methods for Mitigating Space Radiation Effects, Fault Detection and Correction, and Processing Sensor Data; Compact Ka-Band Antenna Feed with Double Circularly Polarized Capability; Dual-Leadframe Transient Liquid Phase Bonded Power Semiconductor Module Assembly and Bonding Process; Quad First Stage Processor: A Four-Channel Digitizer and Digital Beam-Forming Processor; Protective Sleeve for a Pyrotechnic Reefing Line Cutter; Metabolic Heat Regenerated Temperature Swing Adsorption; CubeSat Deployable Log Periodic Dipole Array; Re-entry Vehicle Shape for Enhanced Performance; NanoRacks-Scale MEMS Gas Chromatograph System; Variable Camber Aerodynamic Control Surfaces and Active Wing Shaping Control; Spacecraft Line-of-Sight Stabilization Using LWIR Earth Signature; Technique for Finding Retro-Reflectors in Flash LIDAR Imagery; Novel Hemispherical Dynamic Camera for EVAs; 360 deg Visual Detection and Object Tracking on an Autonomous Surface Vehicle; Simulation of Charge Carrier Mobility in Conducting Polymers; Observational Data Formatter Using CMOR for CMIP5; Propellant Loading Physics Model for Fault Detection Isolation and Recovery; Probabilistic Guidance for Swarms of Autonomous Agents; Reducing Drift in Stereo Visual Odometry; Future Air-Traffic Management Concepts Evaluation Tool; Examination and A Priori Analysis of a Direct Numerical Simulation Database for High

  6. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  7. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...... the correct volt-sec average at its output, while simultaneously achieving inductive voltage boosting. More interestingly, these performance features are achieved with no increase in the number of semiconductor commutations, and hence no increase in switching losses. The proposed converter therefore offers...

  8. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  9. Scaling and universality of ac conduction in disordered solids

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  10. The topological AC effect on noncommutative phase space

    Li, K; Li, Kang; Wang, Jianhua

    2006-01-01

    The Aharonov-Casher (AC) effect in non-commutative(NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on noncommutative space and noncommutative phase space by the new method, we obtain the corrections to AC phase on NC space and NC phase space respectively.

  11. Considerations for an Ac Dipole for the LHC

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  12. Equivalent circuit models for ac impedance data analysis

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  13. A remark on Kov\\'acs' vanishing theorem

    Fujino, Osamu

    2012-01-01

    We give an alternative proof of Kov\\'acs' vanishing theorem. Our proof is based on the standard arguments of the minimal model theory. We do not need the notion of Du Bois pairs. We reduce Kov\\'acs' vanishing theorem to the well-known relative Kawamata--Viehweg--Nadel vanishing theorem.

  14. Flexible AC transmission systems: the state of the art

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  15. Precursors of Short GRBs Registered by SPI-ACS/INTEGRAL

    Minaev, P.; Pozanenko, A.

    2016-10-01

    We have searched for precursors in light curves of short gamma-ray bursts registered by SPI-ACS/INTEGRAL in 2002-2014. The portion of short bursts with precursor activity will be less than 0.4% from all short bursts registered by SPI-ACS.

  16. 39 CFR 3001.115 - Participant statement or brief.

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Participant statement or brief. 3001.115 Section... Participant statement or brief. (a) Participant statement. Upon the filing of the petition for review of a... or she may file a brief as described in paragraph (b) of this section presenting the arguments,...

  17. The Impact of Ultrasound on Developing Brain Neurons. Science Briefs

    National Scientific Council on the Developing Child, 2007

    2007-01-01

    "Science Briefs" summarize the findings and implications of a recent study in basic science or clinical research. This brief reports on the study. This Brief summarizes the findings and implications of "Prenatal Exposure to Ultrasound Waves Impacts Neuronal Migration in Mice" (E. S. B. C. Ang, Jr.; V. Gluncic; A. Duque; M. E. Schafer; and P.…

  18. 42 CFR 405.1120 - Filing briefs with the MAC.

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Filing briefs with the MAC. 405.1120 Section 405....1120 Filing briefs with the MAC. Upon request, the MAC will give the party requesting review, as well... ending with the date the brief is received by the MAC will not be counted toward the...

  19. Adapting the Brief COPE for Chinese Adolescents with Visual Impairments

    Yuan, Wei; Zhang, Li-fang; Li, Bing

    2017-01-01

    Introduction: The present research pioneered the effort in assessing adolescents' coping with visual impairment through adapting the Brief COPE in an eastern context. The first study preliminarily explored the applicability of the Brief COPE to Chinese adolescent students with visual impairments. Based on the results, the Brief COPE was modified…

  20. Development of an in-line filter to prevent intrusion of NO2 toxic vapors into A/C systems

    Meneghelli, Barry; Mcnulty, R. J.; Springer, Mike; Lueck, Dale E.

    1995-01-01

    The hypergolic propellant nitrogen tetroxide (N2O4 or NTO) is routinely used in spacecraft launched at Kennedy Space Center (KSC) and Cape Canaveral Air Station (CCAS). In the case of a catastrophic failure of the spacecraft, there would be a release of the unspent propellant in the form of a toxic cloud. Inhalation of this material at downwind concentrations which may be as high as 20 parts per million (ppm) for 30 minutes in duration, may produce irritation to the eyes, nose and respiratory tract. Studies at both KSC and CCAS have shown that the indoor concentrations of N2O4 during a toxic release may range from 1 to 15 ppm and depend on the air change rate (ACR) for a particular building and whether or not the air conditioning (A/C) system has been shut down or left in an operating mode. This project was initiated in order to assess how current A/C systems could be easily modified to prevent personnel from being exposed to toxic vapors. A sample system has been constructed to test the ability of several types of filter material to capture the N2O4 vapors prior to their infiltration into the A/C system. Test results will be presented which compare the efficiencies of standard A/C filters, water wash systems, and chemically impregnated filter material in taking toxic vapors out of the incoming air stream.

  1. Material progress at Cerro Prieto, Mexico

    Mercado, A.M.

    1978-01-01

    A brief general description is presented about the principal problems observed on the materials used in the Cerro Prieto geothermal project. These include those problems that have been observed in drill pipes, well casing separation equipment and conduction pipes for geothermal water and steam as well as the problems observed in geothermal power plant materials.

  2. On Using Materiality in Information Systems Development

    Carugati, Andrea

    This research brief presents a discussion on the use of the concept of materiality and material knowing in information systems development (ISD). The discussion addresses some of the practical problems still plaguing ISD, augmenting existing ISD methodologies with contributions from systems theory...

  3. New switching pattern for AC/AC converters with RB-IGBTs for offshore wind parks

    Mogstad, Anne Berit

    2008-01-01

    Offshore wind power has an increasing interest in the research community and among the politicians. Therefore it is important to find the right solutions to meet the environmental and commercial requirements to give offshore wind power a promising future. This thesis are proposing a new converter topology for offshore wind parks. Since the topology is based on DC transmission in stead of AC transmission it is better suited for use in this type of parks. All the converters are located in the w...

  4. NASA Tech Briefs, December 2008

    2008-01-01

    Topics covered include: Crew Activity Analyzer; Distributing Data to Hand-Held Devices in a Wireless Network; Reducing Surface Clutter in Cloud Profiling Radar Data; MODIS Atmospheric Data Handler; Multibeam Altimeter Navigation Update Using Faceted Shape Model; Spaceborne Hybrid-FPGA System for Processing FTIR Data; FPGA Coprocessor for Accelerated Classification of Images; SiC JFET Transistor Circuit Model for Extreme Temperature Range; TDR Using Autocorrelation and Varying-Duration Pulses; Update on Development of SiC Multi-Chip Power Modules; Radio Ranging System for Guidance of Approaching Spacecraft; Electromagnetically Clean Solar Arrays; Improved Short-Circuit Protection for Power Cells in Series; Electromagnetically Clean Solar Arrays; Logic Gates Made of N-Channel JFETs and Epitaxial Resistors; Improved Short-Circuit Protection for Power Cells in Series; Communication Limits Due to Photon-Detector Jitter; System for Removing Pollutants from Incinerator Exhaust; Sealing and External Sterilization of a Sample Container; Converting EOS Data from HDF-EOS to netCDF; HDF-EOS 2 and HDF-EOS 5 Compatibility Library; HDF-EOS Web Server; HDF-EOS 5 Validator; XML DTD and Schemas for HDF-EOS; Converting from XML to HDF-EOS; Simulating Attitudes and Trajectories of Multiple Spacecraft; Specialized Color Function for Display of Signed Data; Delivering Alert Messages to Members of a Work Force; Delivering Images for Mars Rover Science Planning; Oxide Fiber Cathode Materials for Rechargeable Lithium Cells; Electrocatalytic Reduction of Carbon Dioxide to Methane; Heterogeneous Superconducting Low-Noise Sensing Coils; Progress toward Making Epoxy/Carbon-Nanotube Composites; Predicting Properties of Unidirectional-Nanofiber Composites; Deployable Crew Quarters; Nonventing, Regenerable, Lightweight Heat Absorber; Miniature High-Force, Long-Stroke SMA Linear Actuators; "Bootstrap" Configuration for Multistage Pulse-Tube Coolers; Reducing Liquid Loss during Ullage Venting in

  5. NASA Tech Briefs, March 2012

    2012-01-01

    The topics include: 1) Spectral Profiler Probe for In Situ Snow Grain Size and Composition Stratigraphy; 2) Portable Fourier Transform Spectroscopy for Analysis of Surface Contamination and Quality Control; 3) In Situ Geochemical Analysis and Age Dating of Rocks Using Laser Ablation-Miniature Mass Spectrometer; 4) Physics Mining of Multi-Source Data Sets; 5) Photogrammetry Tool for Forensic Analysis; 6) Connect Global Positioning System RF Module; 7) Simple Cell Balance Circuit; 8) Miniature EVA Software Defined Radio; 9) Remotely Accessible Testbed for Software Defined Radio Development; 10) System-of-Systems Technology-Portfolio-Analysis Tool; 11) VESGEN Software for Mapping and Quantification of Vascular Regulators; 12) Constructing a Database From Multiple 2D Images for Camera Pose Estimation and Robot Localization; 13) Adaption of G-TAG Software for Validating Touch and Go Asteroid Sample Return Design Methodology; 14) 3D Visualization for Phoenix Mars Lander Science Operations; 15) RxGen General Optical Model Prescription Generator; 16) Carbon Nanotube Bonding Strength Enhancement Using Metal Wicking Process; 17) Multi-Layer Far-Infrared Component Technology; 18) Germanium Lift-Off Masks for Thin Metal Film Patterning; 19) Sealing Materials for Use in Vacuum at High Temperatures; 20) Radiation Shielding System Using a Composite of Carbon Nanotubes Loaded With Electropolymers; 21) Nano Sponges for Drug Delivery and Medicinal Applications; 22) Molecular Technique to Understand Deep Microbial Diversity; 23) Methods and Compositions Based on Culturing Microorganisms in Low Sedimental Fluid Shear Conditions; 24) Secure Peer-to-Peer Networks for Scientific Information Sharing; 25) Multiplexer/Demultiplexer Loading Tool (MDMLT); 26) High-Rate Data-Capture for an Airborne Lidar System; 27) Wavefront Sensing Analysis of Grazing Incidence Optical Systems; 28) Foam-on-Tile Damage Model; 29) Instrument Package Manipulation Through the Generation and Use of an Attenuated

  6. NASA Tech Briefs, Februrary 2013

    2013-01-01

    Topics covered include: Measurements of Ultra-Stable Oscillator (USO) Allan Deviations in Space; Gaseous Nitrogen Orifice Mass Flow Calculator; Validation of Proposed Metrics for Two-Body Abrasion Scratch Test Analysis Standards; Rover Low Gain Antenna Qualification for Deep Space Thermal Environments; Automated, Ultra-Sterile Solid Sample Handling and Analysis on a Chip; Measuring and Estimating Normalized Contrast in Infrared Flash Thermography; Spectrally and Radiometrically Stable, Wideband, Onboard Calibration Source; High-Reliability Waveguide Vacuum/Pressure Window; Methods of Fabricating Scintillators With Radioisotopes for Beta Battery Applications; Magnetic Shield for Adiabatic Demagnetization Refrigerators (ADR); CMOS-Compatible SOI MESFETS for Radiation-Hardened DC-to-DC Converters; Silicon Heat Pipe Array; Adaptive Phase Delay Generator; High-Temperature, Lightweight, Self-Healing Ceramic Composites for Aircraft Engine Applications; Treatment to Control Adhesion of Silicone-Based Elastomers; High-Temperature Adhesives for Thermally Stable Aero-Assist Technologies; Rockballer Sample Acquisition Tool; Rock Gripper for Sampling, Mobility, Anchoring, and Manipulation; Advanced Magnetic Materials Methods and Numerical Models for Fluidization in Microgravity and Hypogravity; Data Transfer for Multiple Sensor Networks Over a Broad Temperature Range; Using Combustion Synthesis to Reinforce Berms and Other Regolith Structures; Visible-Infrared Hyperspectral Image Projector; Three-Axis Attitude Estimation With a High-Bandwidth Angular Rate Sensor Change_Detection.m; AGATE: Adversarial Game Analysis for Tactical Evaluation; Ionospheric Simulation System for Satellite Observations and Global Assimilative; Modeling Experiments (ISOGAME); An Extensible, User- Modifiable Framework for Planning Activities; Mission Operations Center (MOC) - Precipitation Processing System (PPS) Interface Software System (MPISS); Automated 3D Damaged Cavity Model Builder for Lower

  7. NASA Tech Briefs, March 2010

    2010-01-01

    Topics covered include: Software Tool Integrating Data Flow Diagrams and Petri Nets; Adaptive Nulling for Interferometric Detection of Planets; Reducing the Volume of NASA Earth-Science Data; Reception of Multiple Telemetry Signals via One Dish Antenna; Space-Qualified Traveling-Wave Tube; Smart Power Supply for Battery-Powered Systems; Parallel Processing of Broad-Band PPM Signals; Inexpensive Implementation of Many Strain Gauges; Constant-Differential-Pressure Two-Fluid Accumulator; Inflatable Tubular Structures Rigidized with Foams; Power Generator with Thermo-Differential Modules; Mechanical Extraction of Power From Ocean Currents and Tides; Nitrous Oxide/Paraffin Hybrid Rocket Engines; Optimized Li-Ion Electrolytes Containing Fluorinated Ester Co-Solvents; Probabilistic Multi-Factor Interaction Model for Complex Material Behavior; Foldable Instrumented Bits for Ultrasonic/Sonic Penetrators; Compact Rare Earth Emitter Hollow Cathode; High-Precision Shape Control of In-Space Deployable Large Membrane/Thin-Shell Reflectors; Rapid Active Sampling Package; Miniature Lightweight Ion Pump; Cryogenic Transport of High-Pressure-System Recharge Gas; Water-Vapor Raman Lidar System Reaches Higher Altitude; Compact Ku-Band T/R Module for High-Resolution Radar Imaging of Cold Land Processes; Wide-Field-of-View, High-Resolution, Stereoscopic Imager; Electrical Capacitance Volume Tomography with High-Contrast Dielectrics; Wavefront Control and Image Restoration with Less Computing; Polarization Imaging Apparatus; Stereoscopic Machine-Vision System Using Projected Circles; Metal Vapor Arcing Risk Assessment Tool; Performance Bounds on Two Concatenated, Interleaved Codes; Parameterizing Coefficients of a POD-Based Dynamical System; Confidence-Based Feature Acquisition; Algorithm for Lossless Compression of Calibrated Hyperspectral Imagery; Universal Decoder for PPM of any Order; Algorithm for Stabilizing a POD-Based Dynamical System; Mission Reliability Estimation for

  8. NASA Tech Briefs, October 2010

    2010-01-01

    Topics covered include: Hybrid Architecture Active Wavefront Sensing and Control; Carbon-Nanotube-Based Chemical Gas Sensor; Aerogel-Positronium Technology for the Detection of Small Quantities of Organic and/or Toxic Materials; Graphene-Based Reversible Nano-Switch/Sensor Schottky Diode; Inductive Non-Contact Position Sensor; High-Temperature Surface-Acoustic-Wave Transducer; Grid-Sphere Electrodes for Contact with Ionospheric Plasma; Enabling IP Header Compression in COTS Routers via Frame Relay on a Simplex Link; Ka-Band SiGe Receiver Front-End MMIC for Transponder Applications; Robust Optimization Design Algorithm for High-Frequency TWTs; Optimal and Local Connectivity Between Neuron and Synapse Array in the Quantum Dot/Silicon Brain; Method and Circuit for In-Situ Health Monitoring of Solar Cells in Space; BGen: A UML Behavior Network Generator Tool; Platform for Post-Processing Waveform-Based NDE; Electrochemical Hydrogen Peroxide Generator; Fabrication of Single, Vertically Aligned Carbon Nanotubes in 3D Nanoscale Architectures; Process to Create High-Fidelity Lunar Dust Simulants; Lithium-Ion Electrolytes Containing Phosphorous-Based, Flame-Retardant Additives; InGaP Heterojunction Barrier Solar Cells; Straight-Pore Microfilter with Efficient Regeneration; Determining Shear Stress Distribution in a Laminate; Self-Adjusting Liquid Injectors for Combustors; Handling Qualities Prediction of an F-16XL-Based Reduced Sonic Boom Aircraft; Tele-Robotic ATHLETE Controller for Kinematics - TRACK; Three-Wheel Brush-Wheel Sampler; Heterodyne Interferometer Angle Metrology; Aligning Astronomical Telescopes via Identification of Stars; Generation of Optical Combs in a WGM Resonator from a Bichromatic Pump; Large-Format AlGaN PIN Photodiode Arrays for UV Images; Fiber-Coupled Planar Light-Wave Circuit for Seed Laser Control in High Spectral Resolution Lidar Systems; On Calculating the Zero-Gravity Surface Figure of a Mirror; Optical Modification of Casimir Forces for

  9. NASA Tech Briefs, September 2012

    2012-01-01

    Topics covered include: Beat-to-Beat Blood Pressure Monitor; Measurement Techniques for Clock Jitter; Lightweight, Miniature Inertial Measurement System; Optical Density Analysis of X-Rays Utilizing Calibration Tooling to Estimate Thickness of Parts; Fuel Cell/Electrochemical Cell Voltage Monitor; Anomaly Detection Techniques with Real Test Data from a Spinning Turbine Engine-Like Rotor; Measuring Air Leaks into the Vacuum Space of Large Liquid Hydrogen Tanks; Antenna Calibration and Measurement Equipment; Glass Solder Approach for Robust, Low-Loss, Fiber-to-Waveguide Coupling; Lightweight Metal Matrix Composite Segmented for Manufacturing High-Precision Mirrors; Plasma Treatment to Remove Carbon from Indium UV Filters; Telerobotics Workstation (TRWS) for Deep Space Habitats; Single-Pole Double-Throw MMIC Switches for a Microwave Radiometer; On Shaft Data Acquisition System (OSDAS); ASIC Readout Circuit Architecture for Large Geiger Photodiode Arrays; Flexible Architecture for FPGAs in Embedded Systems; Polyurea-Based Aerogel Monoliths and Composites; Resin-Impregnated Carbon Ablator: A New Ablative Material for Hyperbolic Entry Speeds; Self-Cleaning Particulate Prefilter Media; Modular, Rapid Propellant Loading System/Cryogenic Testbed; Compact, Low-Force, Low-Noise Linear Actuator; Loop Heat Pipe with Thermal Control Valve as a Variable Thermal Link; Process for Measuring Over-Center Distances; Hands-Free Transcranial Color Doppler Probe; Improving Balance Function Using Low Levels of Electrical Stimulation of the Balance Organs; Developing Physiologic Models for Emergency Medical Procedures Under Microgravity; PMA-Linked Fluorescence for Rapid Detection of Viable Bacterial Endospores; Portable Intravenous Fluid Production Device for Ground Use; Adaptation of a Filter Assembly to Assess Microbial Bioburden of Pressurant Within a Propulsion System; Multiplexed Force and Deflection Sensing Shell Membranes for Robotic Manipulators; Whispering Gallery Mode

  10. NASA Tech Briefs, June 2008

    2008-01-01

    ; Simulation of Stochastic Processes by Coupled ODE-PDE; Cluster Inter-Spacecraft Communications; Genetic Algorithm Optimizes Q-LAW Control Parameters; Low-Impact Mating System for Docking Spacecraft; Non-Destructive Evaluation of Materials via Ultraviolet Spectroscopy; Gold-on-Polymer-Based Sensing Films for Detection of Organic and Inorganic Analytes in the Air; and Quantum-Inspired Maximizer.

  11. NASA Tech Briefs, July 2009

    2009-01-01

    Topics covered include: Dual Cryogenic Capacitive Density Sensor; Hail Monitor Sensor; Miniature Six-Axis Load Sensor for Robotic Fingertip; Improved Blackbody Temperature Sensors for a Vacuum Furnace; Wrap-Around Out-the-Window Sensor Fusion System; Wide-Range Temperature Sensors with High-Level Pulse Train Output; Terminal Descent Sensor Simulation; A Robust Mechanical Sensing System for Unmanned Sea Surface Vehicles; Additive for Low-Temperature Operation of Li-(CF)n Cells; Li/CFx Cells Optimized for Low-Temperature Operation; Number Codes Readable by Magnetic-Field-Response Recorders; Determining Locations by Use of Networks of Passive Beacons; Superconducting Hot-Electron Submillimeter-Wave Detector; Large-Aperture Membrane Active Phased-Array Antennas; Optical Injection Locking of a VCSEL in an OEO; Measuring Multiple Resistances Using Single-Point Excitation; Improved-Bandwidth Transimpedance Amplifier; Inter-Symbol Guard Time for Synchronizing Optical PPM; Novel Materials Containing Single-Wall Carbon Nanotubes Wrapped in Polymer Molecules; Light-Curing Adhesive Repair Tapes; Thin-Film Solid Oxide Fuel Cells; Zinc Alloys for the Fabrication of Semiconductor Devices; Small, Lightweight, Collapsible Glove Box; Radial Halbach Magnetic Bearings; Aerial Deployment and Inflation System for Mars Helium Balloons; Steel Primer Chamber Assemblies for Dual Initiated Pyrovalves; Voice Coil Percussive Mechanism Concept for Hammer Drill; Inherently Ducted Propfans and Bi-Props; Silicon Nanowire Growth at Chosen Positions and Orientations; Detecting Airborne Mercury by Use of Gold Nanowires; Detecting Airborne Mercury by Use of Palladium Chloride; Micro Electron MicroProbe and Sample Analyzer; Nanowire Electron Scattering Spectroscopy; Electron-Spin Filters Would Offer Spin Polarization Greater than 1; Subcritical-Water Extraction of Organics from Solid Matrices; A Model for Predicting Thermoelectric Properties of Bi2Te3; Integrated Miniature Arrays of Optical Biomolecule

  12. Determination for β-delayed fission probability of 230Ac

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  13. Characterisation of AC1: a naturally decaffeinated coffee

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  14. Ac response of a coupled double quantum dot

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  15. Estimation of the Thurstonian model for the 2-AC protocol

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  16. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  17. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  18. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  19. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  20. Sensitivity analysis on an AC600 aluminum skin component

    Mendiguren, J.; Agirre, J.; Mugarra, E.; Galdos, L.; Saenz de Argandoña, E.

    2016-08-01

    New materials are been introduced on the car body in order to reduce weight and fulfil the international CO2 emission regulations. Among them, the application of aluminum alloys is increasing for skin panels. Even if these alloys are beneficial for the car design, the manufacturing of these components become more complex. In this regard, numerical simulations have become a necessary tool for die designers. There are multiple factors affecting the accuracy of these simulations e.g. hardening, anisotropy, lubrication, elastic behavior. Numerous studies have been conducted in the last years on high strength steels component stamping and on developing new anisotropic models for aluminum cup drawings. However, the impact of the correct modelling on the latest aluminums for the manufacturing of skin panels has been not yet analyzed. In this work, first, the new AC600 aluminum alloy of JLR-Novelis is characterized for anisotropy, kinematic hardening, friction coefficient, elastic behavior. Next, a sensitivity analysis is conducted on the simulation of a U channel (with drawbeads). Then, the numerical an experimental results are correlated in terms of springback and failure. Finally, some conclusions are drawn.

  1. Negotiating Visualities in Briefing and Design

    Koch, Christian; Bendixen, Mads

    2007-01-01

    Building on an in-depth ethnographic study and the approaches of ‘practice-based studies’ and ‘science and technology studies’, the role of visual representations is explored in briefing and design processes. Three characteristic ways in which drawings contribute to ongoing negotiations are discu......Building on an in-depth ethnographic study and the approaches of ‘practice-based studies’ and ‘science and technology studies’, the role of visual representations is explored in briefing and design processes. Three characteristic ways in which drawings contribute to ongoing negotiations...... are discussed. First, drawings are shown to be inscribed with particular interests, making them political instruments. Second, they have prescriptive effects as partially independent actors in the project. Third, they are shown to participate as conscriptions in a complementary process of inscription...

  2. Three brief assessments of math achievement.

    Steiner, Eric T; Ashcraft, Mark H

    2012-12-01

    Because of wide disparities in college students' math knowledge-that is, their math achievement-studies of cognitive processing in math tasks also need to assess their individual level of math achievement. For many research settings, however, using existing math achievement tests is either too costly or too time consuming. To solve this dilemma, we present three brief tests of math achievement here, two drawn from the Wide Range Achievement Test and one composed of noncopyrighted items. All three correlated substantially with the full achievement test and with math anxiety, our original focus, and all show acceptable to excellent reliability. When lengthy testing is not feasible, one of these brief tests can be substituted.

  3. NASA Tech Briefs, September 2006

    2006-01-01

    Topics covered include: Improving Thermomechanical Properties of SiC/SiC Composites; Aerogel/Particle Composites for Thermoelectric Devices; Patches for Repairing Ceramics and Ceramic- Matrix Composites; Lower-Conductivity Ceramic Materials for Thermal-Barrier Coatings; An Alternative for Emergency Preemption of Traffic Lights; Vehicle Transponder for Preemption of Traffic Lights; Automated Announcements of Approaching Emergency Vehicles; Intersection Monitor for Traffic-Light-Preemption System; Full-Duplex Digital Communication on a Single Laser Beam; Stabilizing Microwave Frequency of a Photonic Oscillator; Microwave Oscillators Based on Nonlinear WGM Resonators; Pointing Reference Scheme for Free-Space Optical Communications Systems; High-Level Performance Modeling of SAR Systems; Spectral Analysis Tool 6.2 for Windows; Multi-Platform Avionics Simulator; Silicon-Based Optical Modulator with Ferroelectric Layer; Multiplexing Transducers Based on Tunnel-Diode Oscillators; Scheduling with Automated Resolution of Conflicts; Symbolic Constraint Maintenance Grid; Discerning Trends in Performance Across Multiple Events; Magnetic Field Solver; Computing for Aiming a Spaceborne Bistatic- Radar Transmitter; 4-Vinyl-1,3-Dioxolane-2-One as an Additive for Li-Ion Cells; Probabilistic Prediction of Lifetimes of Ceramic Parts; STRANAL-PMC Version 2.0; Micromechanics and Piezo Enhancements of HyperSizer; Single-Phase Rare-Earth Oxide/Aluminum Oxide Glasses; Tilt/Tip/Piston Manipulator with Base-Mounted Actuators; Measurement of Model Noise in a Hard-Wall Wind Tunnel; Loci-STREAM Version 0.9; The Synergistic Engineering Environment; Reconfigurable Software for Controlling Formation Flying; More About the Tetrahedral Unstructured Software System; Computing Flows Using Chimera and Unstructured Grids; Avoiding Obstructions in Aiming a High-Gain Antenna; Analyzing Aeroelastic Stability of a Tilt-Rotor Aircraft; Tracking Positions and Attitudes of Mars Rovers; Stochastic Evolutionary

  4. Briefing paper for universities on Core Maths

    Glaister, Paul

    2015-01-01

    This briefing paper outlines the rationale for and development of the new Core Maths qualifications, the characteristics of Core Maths, and why Core Maths is important for higher education. It is part of a communication to university vice-chancellors from the Department for Business, Innovation and Skills (BIS) comprising this paper and a joint Ministerial letter from Jo Johnson, Minister of State for Universities and Science in BIS, and Nick Gibb, Minister of State for Schools in the Departm...

  5. Instance Based Methods --- A Brief Overview

    Baumgartner, Peter; 10.1007/s13218-010-0002-x

    2012-01-01

    Instance-based methods are a specific class of methods for automated proof search in first-order logic. This article provides an overview of the major methods in the area and discusses their properties and relations to the more established resolution methods. It also discusses some recent trends on refinements and applications. This overview is rather brief and informal, but we provide a comprehensive literature list to follow-up on the details.

  6. A brief history of new realism

    Ferraris Maurizio

    2016-01-01

    Full Text Available In this paper I try to sketch a brief history of new realism. Starting from nineteenth century idealism, I then move on to discuss twentieth century postmodernism, which, I argue, is the heir of idealism and the theoretical enemy of new realism. Finally, I offer a reconstruction of how and why contemporary new realism came into being and propose a few remarks on its future perspectives.

  7. Europe BlackHat Briefings 2005

    Boschini, Matteo

    2005-01-01

    Anche quest'anno si è svolta ad Amsterdam la conferenza BlackHat Briefings – Digital Self-Defense. E' una delle più importanti conferenze sulla sicurezza informatica, nella quale vengono presentate le novità tecniche sia per la difesa che per i penetration test od i vulnerability assessment. L'edizione di quest'anno ha dato particolare rilievo agli assessment di web Applications, senza tuttavia trascurare i più bassi livelli protocollari

  8. Trouble Brewing in San Diego. Policy Brief

    Buck, Stuart

    2010-01-01

    The city of San Diego will face enormous budgetary pressures from the growing deficits in public pensions, both at a state and local level. In this policy brief, the author estimates that San Diego faces total of $45.4 billion, including $7.95 billion for the county pension system, $5.4 billion for the city pension system, and an estimated $30.7…

  9. Minimum requirements for new dental materials.

    Mjör, I A

    2007-12-01

    A brief review of the development of standards for testing and certification of dental materials is presented. The tests employed in the standards are not correlated for the clinical use of the materials, nor to the reasons for failures of the materials. They are, therefore, of limited value for the selection of materials to be used in practice but they are important for quality control of the manufacture of the materials. Previous certification programmes are being discontinued. The responsibility for selecting safe and efficient materials is transferred to the clinicians whereas making safe and efficient materials still is the responsibility of the manufacturers.

  10. Tribological properties of AC44200 based composites strenghead with AlB2BOB3 Bparticles

    J.W. Kaczmar

    2011-04-01

    Full Text Available The paper presents a research on abrasion resistance of aluminium-based composites consisting of EN AC-44200 matrix reinforcedwith AlB2BOB3B particles. The examinations revealed that wear intensity of the composites decreased with increasing volume fraction of the particles. Much more intensive abrasive wear was observed on the first kilometre in comparison to the wear on the subsequent distances, i.e. from 1 to 3.5 km and from 3.5 to 8.5 km of the wear distance. Microscopic examinations permitted determining the way and type of wear occurring in the examined materials. In the case of the AC-44200 matrix, typical adhesive wear is observed. In composite materials however, abrasive wear prevails over adhesive wear. Increased volume fraction of AlB2BOB3B particles in composite materials results in increasing friction factor in average by 0.250 per each 10 vol.%. Wear of the cast-iron counterspecimen is also strongly dependent on volume fraction of the reinforcing particles. The counterspecimen demonstrates the largest wear when working in contact with a composite material containing 40 vol.% of AlB2BOB3B particles.

  11. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  12. Measurement of AC loss of superconductors by vaporizing method

    Wakabayashi, Hiroshi; Isono, Takaaki; Matsui, Kunihiro; Fujisaki, Reishi; Nunoya, Yoshihiko; Koizumi, Norikiyo; Takahashi, Yoshikazu; Tsuji, Hiroshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1995-07-01

    In Japan Atomic Energy Research Institute, the development of superconducting pulse conductors for next period nuclear fusion reactors has been carried out. For these conductors, the rated current of 46 kA and the rated magnetic field of 13T are demanded. When the pulse excitation of superconductors is carried out, AC loss arises, and the temperature of the superconductors rises, and when it exceeds a certain value, the superconducting state cannot be maintained. Therefore, the AC loss of pulse conductors must be limited to a low value. It is difficult to evaluate the AC loss of superconductors by calculation, therefore, it is evaluated by actual measurement. There are magnetizing method and vaporizing method for measuring the AC loss. This time, the equipment for measuring the AC loss of 40 kA class superconductors by vaporizing method which measures the helium gas quantity vaporizing at the time of AC loss occurrence was designed and manufactured for the first time. The method of measuring the AC loss, the structure of the measuring equipment, the helium gas recovering part and the measuring part, the countermeasures for preventing helium gas leakage, the resistance heater for calibration, and the results of measurement are reported. (K.I.)

  13. Faint Galaxies in deep ACS observations

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  14. Neurinoma central do nervo acústico

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  15. Geological Cartography of Inner Materials of an Impact Crater on Nepenthes Mensae, Mars

    Valenciano, A.; de Pablo, M. A.

    2012-03-01

    We present the geological map and a brief description of the materials, its geological history and an approach to their astrobiological and exopaleontological implications from sedimentary materials located into impact crater, in Nepenthes Mensae, Mars.

  16. Cyclotron production of Ac-225 for targeted alpha therapy.

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  17. An Improved AC-BM Algorithm for Monitoring Watch List

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  18. Recurrent Security Gaps In 802.11ac Routers

    Mohammed Farik; ABM Shawkat Ali

    2015-01-01

    Abstract In comparison to earlier IEEE 802.11 standard abgn routers todays popular 802.11ac standard routers have enhanced security. However 802.11ac router still has major security vulnerabilities. The novelty of this paper is that we not only highlight multiple security vulnerabilities in 802.11ac router technologies that still have not been secured since the earlier standards but also present some new ideas with solutions. We believe that our line of thoughts on security vulnerabilities ga...

  19. Analysis of Input and Output Ripples of PWM AC Choppers

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  20. Advanced DC/AC inverters applications in renewable energy

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  1. Normatização de medidas acústicas da voz normal

    Araújo Simone Adad

    2002-01-01

    Full Text Available Introdução: A análise acústica da voz com o avanço da tecnologia digital surge como um exame complementar promissor para aumentar a precisão diagnóstica em laringologia. Objetivo: Normatização das medidas acústicas de freqüência fundamental, perturbação e ruído na voz normal de brasileiros dos sexos masculino e feminino. Forma de estudo: Clínico prospectivo. Material e Método: Pesquisa no período de março a agosto de 1997, no Ambulatório de Otorrinolaringologia do Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo, com 80 voluntários da cidade de Ribeirão Preto e região, sendo 40 do sexo masculino e 40 do feminino, selecionados por meio de triagem, foram realizadas gravações digitais dos fonemas /a/, /e/ e /i/, originando uma amostra de 240 sinais acústicos submetidos ao Programa de Análise Acústica da Voz, desenvolvido na Escola de Engenharia de São Carlos da Universidade de São Paulo com obtenção das medidas acústicas. Resultados: Foram obtidos valores médios em relação a sexo e fonemas das medidas de: Freqüência fundamental, Jitter (Directional Perturbation Factor, Perturbation Variation Index, Jitter Ratio, Jitter Factor, Period Perturbation Quotient, Shimmer (Directional Perturbation Factor, Amplitude Variation Index, Amplitude Perturbation Quotient, Spectral Noise Level, Harmonic-to-noise ratio, Harmonic-to-noise ratio cepstrum, Normalized Noise Energy e Breathiness ratio. Conclusão: A normatização das medidas acústicas é necessária para conhecer melhor a voz normal. Os valores obtidos são compatíveis em sua grande maioria com à literatura existente.

  2. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites

    Navin Chand; Deepak Jain

    2004-06-01

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled and unfilled epoxy composites. It was observed that the dielectric constant, tan and a.c. conductivity increase with increasing temperature. Near the transition temperature the materials show anomalous behaviour for the observed properties. Peaks of dielectric constant, tan and a.c. conductivity were observed to shift towards lower temperature with increasing frequency. Clear relaxation (tan ) peaks around 169°C were observed in epoxy resin, which shifted to lower temperature side on increasing the frequency. Addition of 2.91 wt% graphite shifted the tan peaks towards higher temperature side by creating hindrances to the rotation of polymer dipoles. Addition of 2.91 wt% graphite leads to an increased relaxation time of dipoles in polysulphide epoxy from 1.44 × 10-5-3.92 × 10-5 (s) at 90°C by creating the hindrance to the rotation of dipoles.

  3. Fabrication of cobalt-nickel binary nanowires in a highly ordered alumina template via AC electrodeposition.

    Ali, Ghafar; Maqbool, Muhammad

    2013-08-14

    Cobalt-nickel (Co-Ni) binary alloy nanowires of different compositions were co-deposited in the nanopores of highly ordered anodic aluminum oxide (AAO) templates from a single sulfate bath using alternating current (AC) electrodeposition. AC electrodeposition was accomplished without modifying or removing the barrier layer. Field emission scanning electron microscope was used to study the morphology of templates and alloy nanowires. Energy-dispersive X-ray analysis confirmed the deposition of Co-Ni alloy nanowires in the AAO templates. Average diameter of the alloy nanowires was approximately 40 nm which is equal to the diameter of nanopore. X-ray diffraction analysis showed that the alloy nanowires consisted of both hexagonal close-packed and face-centered cubic phases. Magnetic measurements showed that the easy x-axis of magnetization is parallel to the nanowires with coercivity of approximately 706 Oe. AC electrodeposition is very simple, fast, and is useful for the homogenous deposition of various secondary nanostuctured materials into the nanopores of AAO.

  4. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  5. Investigating the factor structure of the Questionnaire on Smoking Urges-Brief (QSU-Brief)

    Toll, Benjamin A.; Katulak, Nicole A.; McKee, Sherry A.

    2005-01-01

    This study was designed to investigate the proposed two-factor structure of the 10-item Questionnaire on Smoking Urges-Brief (QSU-Brief) and to provide evidence for the psychometric properties of this questionnaire using the seven-point scoring set from the original QSU study [Tiffany, S.T., Drobes, D.J. (1991). The development and initial validation of a questionnaire on smoking urges. British Journal of Addiction 86, 1467–1476.]. The study sample (N =576) was comprised of smokers presenting...

  6. AC-130H Gunship Armor Upgrade Project

    Shell, T.E.; Landingham, R.L.

    1990-09-19

    This report covers the test methods and equipment for testing aircraft armor both hard and soft. The hard armor are the typical ceramic type while the soft armor are various types of layered composite materials. 10 figs. (JEF)

  7. Amicus Curiae Brief for the United States Supreme Court on Mental Health Issues Associated with "Physician-Assisted Suicide"

    Werth, James L., Jr.; Gordon, Judith R.

    2002-01-01

    After providing background material related to the Supreme Court cases on "physician-assisted suicide" (Washington v. Glucksberg, 1997, and Vacco v. Quill, 1997), this article presents the amicus curiae brief that was submitted to the United States Supreme Court by 2 national mental health organizations, a state psychological association, and an…

  8. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  9. Hydrolysis of polycarbonate catalyzed by ionic liquid [Bmim][Ac].

    Song, Xiuyan; Liu, Fusheng; Li, Lei; Yang, Xuequn; Yu, Shitao; Ge, Xiaoping

    2013-01-15

    Hydrolysis of polycarbonate (PC) was studied using ionic liquid 1-butyl-3-methylimidazolium acetate ([Bmim][Ac]) as a catalyst. The influences of temperature, time, water dosage and [Bmim][Ac] dosage on the hydrolysis reaction were examined. Under the conditions of temperature 140°C, reaction time 3.0 h, m([Bmim][Ac]):m(PC)=1.5:1 and m(H(2)O):m(PC)=0.35:1, the conversion of PC was nearly 100% and the yield of bisphenol A (BPA) was over 96%. The ionic liquid could be reused up to 6 times without apparent decrease in the conversion of PC and yield of BPA. The kinetics of the reaction was also investigated. The results showed that the hydrolysis of PC in [Bmim][Ac] was a first-order kinetic reaction with an activation energy of 228 kJ/mol.

  10. Methanolysis of polycarbonate catalysed by ionic liquid [Bmim][Ac].

    Liu, Fusheng; Li, Lei; Yu, Shitao; Lv, Zhiguo; Ge, Xiaoping

    2011-05-15

    The methanolysis of polycarbonate (PC) was studied using ionic liquid [Bmim][Ac] as a catalyst. The effects of temperature, time, methanol dosage and [Bmim][Ac] dosage on the methanolysis reaction were examined. It was shown that the conversion of PC was nearly 100%, and the yield of bisphenol A (BPA) was over 95% under the following conditions: m([Bmim][Ac]):m(PC) = 0.75:1;m(methanol):m(PC) = 0.75:1; a reaction temperature of 90 °C and a total time of 2.5h. The ionic liquid could be reused up to 6 times with no apparent decrease in the conversion of PC and yield of BPA. The kinetics of the reaction was also investigated. The results indicated that the methanolysis of PC in [Bmim][Ac] was a first-order kinetic reaction with an activation energy of 167 kJ/mol.

  11. ACS Algorithm in Discrete Ordinates for Pressure Vessel Dosimetry

    Walters William

    2016-01-01

    Full Text Available The Adaptive Collision Source (ACS method can solve the Linear Boltzmann Equation (LBE more efficiently by adaptation of the angular quadrature order. This is similar to, and essentially an extension of, the first collision source method. Previously, the ACS methodology has been implemented into the TITAN discrete ordinates code, and has shown speedups of 2–4 on a simple test problem, with very little loss of accuracy (within a provided adaptive tolerance. This work examines the use of the ACS method for a more realistic problem: pressure vessel dosimetry with the VENUS-2 MOX-fuelled reactor dosimetry benchmark. The ACS method proved to be able to obtain accurate results while being approximately twice as efficient as using a constant quadrature in a standard source iteration scheme.

  12. Fabrication of alumina films with laminated structures by ac anodization

    Hiroyo Segawa

    2014-01-01

    Full Text Available Anodization techniques by alternating current (ac are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials.

  13. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  14. A hybrid electromechanical solid state switch for ac power control

    1972-01-01

    Bidirectional thyristor coupled to a series of actuator driven electromechanical contacts generates hybrid electromechanical solid state switch for ac power control. Device is useful in power control applications where zero crossover switching is required.

  15. A precursor of β-delayed fission:230Ac

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  16. Physical Tools for Creativity with Textile Materials

    Heimdal, Elisabeth Jacobsen

    2010-01-01

    This paper seeks to develop a better understanding of how physical objects can stimulate creativity, studying the case of textile material samples employed to inspire textile designers to use new responsive materials and technologies in their designs. I show: 1) how physical objects can act both...... qualities. I finish with a brief presentation of an ongoing project investigating how architects can be inspired to use textile materials....

  17. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  18. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  19. Development of the Field of Flexible AC Transmission Systems (FACTS)

    2000-01-01

    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  20. The topological AC effect on non-commutative phase space

    Li, Kang [Hangzhou Teachers College, Department of Physics, Hangzhou (China); The Abdus Salam International Center for Theoretical Physics, Trieste (Italy); Wang, Jianhua [Shaanxi University of Technology, Department of Physics, Hanzhong (China); The Abdus Salam International Center for Theoretical Physics, Trieste (Italy)

    2007-05-15

    The Aharonov-Casher (AC) effect in non-commutative (NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on non-commutative space and non-commutative phase space by the new method, we obtain corrections to the AC phase on NC space and NC phase space, respectively. (orig.)

  1. Antifriction coatings based on a-C for biomedicine applications

    Yurjev, Y. N.; Kiseleva, D. V.; Zaitcev, D. A.; Sidelev, D. V.; Korneva, O. S.

    2016-01-01

    This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp2-phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications.

  2. An AC magnetohydrodynamic micropump: towards a true integrated microfluidic system

    Lee, A P; Lemoff, A V; McConaghy, C F; Miles, R R

    1999-03-01

    An AC Magnetohydrodynamic (MHD) micropump has been demonstrated in which the Lorentz force is used to propel an electrolytic solution along a microchannel etched in silicon. This micropump has no moving parts, produces a continuous (not pulsatile) flow, and is compatible with solutions containing biological specimens. micropump, using the Lorentz force as the pumping mechanism for biological analysis. The AC Magnetohydrodynamic (MHD) micropump investigated produces a continuous flow and allows for complex microchannel design.

  3. GaAs/Ge solar cell AC parameters at different temperatures

    Kumar, R. Anil; Suresh, M.S. [ISRO Satellite centre, ISRO, Bangalore 560 017 (India); Nagaraju, J. [Department of Instrumentation, Indian Institute of Science, Bangalore 560 012 (India)

    2003-05-15

    The AC parameters of Gallium Arsenide (GaAs/Ge) solar cell were measured at different cell temperatures (198-348K) by varying the cell bias voltage (forward and reverse) under dark condition using impedance spectroscopy technique. It was found that the cell capacitance increases with the cell temperature where as the cell resistance decreases, at any bias voltage. The measured cell parameters were used to calculate the intrinsic concentration of electron-hole pair, cell material relative permittivity and its band gap energy. The diode factor and the cell dynamic resistance at the corresponding maximum power point decrease with the cell temperature.

  4. Ac breakdown in near-atmospheric pressure noble gases: I. Experiment

    Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F; Gendre, M F; Hendriks, J, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

    2011-06-08

    Ac-driven breakdown processes have been explored much less than the pulsed or dc breakdown, even though they have possible applications in industry. This paper focuses on the frequency range between 60 kHz and 1 MHz, at a pin-pin electrode geometry and gap lengths of 4 or 7 mm. The breakdown process was examined in argon and xenon at 0.3 and 0.7 bar. We used electrical and optical measurements to characterize the breakdown process, to observe the influence of frequency change and the effect of ignition enhancers-UV irradiation and radioactive material.

  5. A Brief Analysis on William Blake's London

    张莉; 尚彦飞

    2014-01-01

    William Blake (1757-1827) is a renowned British poet in the 18th century. His lyric poems display the characteristics of romantic spirit, and he is regarded as the forefather of the British Romanticism. His London is a well-known lyric poetry, which is thought to be the best vesicle in the West. This paper will analyse this poem in terms of its form, theme, and im-age and then draw a brief conclusion for the characteristics of William Blake's poem.

  6. A brief history of topographical anatomy.

    Standring, Susan

    2016-07-01

    This brief history of topographical anatomy begins with Egyptian medical papyri and the works known collectively as the Greco-Arabian canon, the time line then moves on to the excitement of discovery that characterised the Renaissance, the increasing regulatory and legislative frameworks introduced in the 18th and 19th centuries, and ends with a consideration of the impact of technology that epitomises the period from the late 19th century to the present day. This paper is based on a lecture I gave at the Winter Meeting of the Anatomical Society in Cambridge in December 2015, when I was awarded the Anatomical Society Medal.

  7. The Raychaudhuri equations: A brief review

    Sayan Kar; Soumitra Sengupta

    2007-07-01

    We present a brief review on the Raychaudhuri equations. Beginning with a summary of the essential features of the original article by Raychaudhuri and subsequent work of numerous authors, we move on to a discussion of the equations in the context of alternate non-Riemannian spacetimes as well as other theories of gravity, with a special mention on the equations in spacetimes with torsion (Einstein–Cartan–Sciama–Kibble theory). Finally, we give an overview of some recent applications of these equations in general relativity, quantum field theory, string theory and the theory of relativisitic membranes. We conclude with a summary and provide our own perspectives on directions of future research.

  8. Negotiating Visualizations in Briefing and Design

    Bendixen, Mads; Koch, Christian

    2007-01-01

    and prescription, changing their roles and configurations, and intersecting and affecting the project process in characteristic ways. Visual representations play a temporary role, and ‘time’ and ‘phase’ set boundaries for them. For practice, the analysis suggests the implication that communitarian management......Building on an in-depth ethnographic study and the approaches of ‘practice-based studies’ and ‘science and technology studies’, the role of visual representations is explored in briefing and design processes. Three characteristic ways in which drawings contribute to ongoing negotiations...

  9. A brief analysis on English etymology

    李明珠

    2015-01-01

    In the process of learning English, proficiency in vocabulary is the key point to study a language well. Obviously, it’s very crucial to know about the origin and history of the words. Research on English etymology is conducive to memory, interpretation and understanding of the words. Generally speaking, English etymology is closely connected with British history. Western culture also has exerted profound impact on English etymology, which leads to considerable borrowings pouring into English vocabulary. In brief, this dissertation will inquire into English etymology preliminarily.

  10. Update on bedside ultrasound (US) diagnosis of acute cholecystitis (AC).

    Zenobii, Maria Francesca; Accogli, Esterita; Domanico, Andrea; Arienti, Vincenzo

    2016-03-01

    Acute cholecystitis (AC) represents a principal cause of morbidity worldwide and is one of the most frequent reasons for hospitalization due to gastroenteric tract diseases. AC should be suspected in presence of clinical signs and of gallstones on an imaging study. Upper abdominal US represents the first diagnostic imaging step in the case of suspected AC. Computed tomography (CT) with intravenous contrast (IV) or magnetic resonance imaging (MRI) with gadolinium contrast and technetium hepatobiliary iminodiacetic acid (Tc-HIDA) can be employed to exclude complications. US examination should be performed with right subcostal oblique, with longitudinal and intercostal scans. Normal gallbladder US findings and AC major and minor US signs are described. Polyps, sludge and gallbladder wall thickening represent the more frequent pitfalls and they must be differentiated from stones, duodenal artifacts and many other non-inflammatory conditions that cause wall thickening, respectively. By means of bedside ultrasound, the finding of gallstones in combination with acute pain, when the clinician presses the gallbladder with the US probe (the sonographic Murphy's sign), has a 92.2 % positive predictive value for AC. In our preliminary experience, bedside US-performed by echoscopy (ES) and/or point-of-care US (POCUS) demonstrated good reliability in detecting signs of AC, and was always integrated with physical examination and performed by a skilled operator.

  11. Temperature integration at the AC thermosensory neurons in Drosophila.

    Tang, Xin; Platt, Michael D; Lagnese, Christopher M; Leslie, Jennifer R; Hamada, Fumika N

    2013-01-16

    Temperature sensation has a strong impact on animal behavior and is necessary for animals to avoid exposure to harmful temperatures. It is now well known that thermoTRP (transient receptor potential) channels in thermosensory neurons detect a variable range of temperature stimuli. However, little is known about how a range of temperature information is relayed and integrated in the neural circuits. Here, we show novel temperature integration between two warm inputs via Drosophila TRPA channels, TRPA1 and Pyrexia (Pyx). The internal AC (anterior cell) thermosensory neurons, which express TRPA1, detect warm temperatures and mediate temperature preference behavior. We found that the AC neurons were activated twice when subjected to increasing temperatures. The first response was at ∼25°C via TRPA1 channel, which is expressed in the AC neurons. The second response was at ∼27°C via the second antennal segments, indicating that the second antennal segments are involved in the detection of warm temperatures. Further analysis reveals that pyx-Gal4-expressing neurons have synapses on the AC neurons and that mutation of pyx eliminates the second response of the AC neurons. These data suggest that AC neurons integrate both their own TRPA1-dependent temperature responses and a Pyx-dependent temperature response from the second antennal segments. Our data reveal the first identification of temperature integration, which combines warm temperature information from peripheral to central neurons and provides the possibility that temperature integration is involved in the plasticity of behavioral outputs.

  12. Diagnostics of the Fermilab Tevatron using an AC dipole

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  13. A Novel High Performance Bridgeless Ac-Dc Boost Converter

    S.M.AshrafulAlam Mohon

    2016-08-01

    Full Text Available A new single phase high performance bridgeless AC-DC Boost converter is proposed. The converter is made bridgeless by the use of two unidirectional switches and two diodes at the input ac side for power conversion for both positive and negative half cycle. Because of the high frequency switching, the power factor of the circuit is inherently corrected and it requires a small filter to make the input current near sinusoidal with limited THD. The significant improvement in THD makes the circuit a good choice in applications needing AC-DC conversion with power conditioning. The circuit exhibits such better performances than conventional AC-DC boost converter with variable loads at constant frequency switching with no additional control circuits. The efficiency of the circuit is also satisfactory. Analysis and simulation results of the circuit are obtained by using software simulation. The main advantage of this new AC-DC converter is its superior power quality over conventional AC-DC boost converter

  14. Proposed Train and Equip Authorities for Syria: In Brief

    2014-12-03

    Proposed Train and Equip Authorities for Syria : In Brief Christopher M. Blanchard Specialist in Middle Eastern Affairs Amy Belasco...COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Proposed Train and Equip Authorities for Syria : In Brief 5a. CONTRACT NUMBER 5b. GRANT...Authorities for Syria : In Brief Congressional Research Service Summary The FY2015 continuing appropriations resolution (H.J.Res. 124, P.L. 113-164

  15. The early history of ideas on brief interventions for alcohol.

    2014-01-01

    AIMS: This study explores the early development of brief interventions for alcohol using a history of ideas approach with a particular focus on intervention content. METHODS: The source publications of the key primary studies published from approximately 1962 to 1992 were examined, followed by a brief review of the earliest reviews in this field. These studies were placed in the context of developments in alcohol research and in public health. RESULTS: After early pioneering work on brief int...

  16. Material Instabilities in Particulate Systems

    Goddard, J. D.

    1999-01-01

    Following is a brief summary of a theoretical investigation of material (or constitutive) instability associated with shear induced particle migration in dense particulate suspensions or granular media. It is shown that one can obtain a fairly general linear-stability analysis, including the effects of shear-induced anisotropy in the base flow as well as Reynolds dilatancy. A criterion is presented here for simple shearing instability in the absence of inertia and dilatancy.

  17. 21 CFR 880.6320 - AC-powered medical examination light.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate...

  18. Pre-flight safety briefings, mood and information retention.

    Tehrani, Morteza; Molesworth, Brett R C

    2015-11-01

    Mood is a moderating factor that is known to affect performance. For airlines, the delivery of the pre-flight safety briefing prior to a commercial flight is not only an opportunity to inform passengers about the safety features on-board the aircraft they are flying, but an opportunity to positively influence their mood, and hence performance in the unlikely event of an emergency. The present research examined whether indeed the pre-flight safety briefing could be used to positively impact passengers' mood. In addition, the present research examined whether the recall of key safety messages contained within the pre-flight safety briefing was influenced by the style of briefing. Eighty-two participants were recruited for the research and divided into three groups; each group exposed to a different pre-flight cabin safety briefing video (standard, humorous, movie theme). Mood was measured prior and post safety briefing. The results revealed that pre-flight safety briefing videos can be used to manipulate passengers' mood. Safety briefings that are humorous or use movie themes to model their briefing were found to positively affect mood. However, there was a trade-off between entertainment and education, the greater the entertainment value, the poorer the retention of key safety messages. The results of the research are discussed from both an applied and theoretical perspective.

  19. Materials for Adaptive Structural Acoustic Controls

    1994-01-31

    found in ing atoms collapse systematically around ultrasonic motors . Electrooptic materials the small B ions. will become future key components in dis...electromechanical devices (piezoelectric ac- aries by thermal treatment so as to make tuators, ultrasonic motors ) the boundary layer highly-resistive

  20. A brief etymology of the collateral circulation.

    Faber, James E; Chilian, William M; Deindl, Elisabeth; van Royen, Niels; Simons, Michael

    2014-09-01

    It is well known that the protective capacity of the collateral circulation falls short in many individuals with ischemic disease of the heart, brain, and lower extremities. In the past 15 years, opportunities created by molecular and genetic tools, together with disappointing outcomes in many angiogenic trials, have led to a significant increase in the number of studies that focus on: understanding the basic biology of the collateral circulation; identifying the mechanisms that limit the collateral circulation's capacity in many individuals; devising methods to measure collateral extent, which has been found to vary widely among individuals; and developing treatments to increase collateral blood flow in obstructive disease. Unfortunately, accompanying this increase in reports has been a proliferation of vague terms used to describe the disposition and behavior of this unique circulation, as well as the increasing misuse of well-ensconced ones by new (and old) students of collateral circulation. With this in mind, we provide a brief glossary of readily understandable terms to denote the formation, adaptive growth, and maladaptive rarefaction of collateral circulation. We also propose terminology for several newly discovered processes that occur in the collateral circulation. Finally, we include terms used to describe vessels that are sometimes confused with collaterals, as well as terms describing processes active in the general arterial-venous circulation when ischemic conditions engage the collateral circulation. We hope this brief review will help unify the terminology used in collateral research.

  1. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Manoj Chugh; B R Gulati; S K Gakhar

    2010-03-01

    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  2. Confirmation of hydroxyl radicals ({sup •} OH) generated in the presence of TiO{sub 2} supported on AC under microwave irradiation

    Zhang, Zhaohong, E-mail: lnuhjhx@163.com [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Fengyang; Huang, Lirong; Jiatieli, Jianaerguli; Li, Yuanyuan; Song, Lijun [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Ning [Experiment Center of Environmental Monitoring of Liaoning Province, Shenyang 110161 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)

    2014-08-15

    Graphical abstract: - Highlights: • Generation of {sup •} OH in MW integrated with loaded TiO{sub 2}/AC system was confirmed. • Confirmation of {sup •} OH was conducted using radical scavenger such as BHT, MT and VC. • More {sup •} OH was formed using anatase TiO{sub 2}/AC than rutile TiO{sub 2}/AC under MW irradiation. • Effect of mass ratio, irradiation time, catalyst dose and DPCI on {sup •} OH was studied. - Abstract: In order to study the degradation mechanism of technology of microwave (MW) combined with TiO{sub 2} supported on activated carbon (TiO{sub 2}/AC), the reactive oxygen species (ROS) was explored through oxidation of 1,5-diphenyl carbazide (DPCI) to 1,5-diphenyl carbazone (DPCO). Furthermore, 2,6-di-tert-butyl-4-methylphenol (BHT), Mannitol (MT) and Vitamin C (VC) were used as radical scavengers to confirm the generation of the hydroxyl radicals ({sup •} OH). In addition, the influence of some parameters such as TiO{sub 2} mass ratio content, irradiation time, material dose, DPCI concentration and MW power on the determination of {sup •} OH were examined. The results showed that the {sup •} OH could be generated under MW combined with loaded TiO{sub 2}/AC. Also, anatase TiO{sub 2}/AC can generate more {sup •} OH radicals than rutile TiO{sub 2}/AC under MW irradiation. This work would provide new mechanistic insights on the enhanced degradation effect of organic pollutants in water using the supported TiO{sub 2}/AC coupled with MW technology.

  3. Development of Rapidly Quenched Soft Magnetic Materials in China

    2000-01-01

    The discovery of the first Fe-based ferromagnetic amorphous alloy in 1966 had made an impact on conventional magnetic materials because of its unique properties. Since then, a number of amorphous magnetic materials have been successfully developed and used in a wide variety of applications. A brief review of R & D activities on amorphous soft magnetic materials in China is given from the beginning to the present in a somewhat chronological order, followed by a brief introduction to their applications on electric and electronic industries. An analysis and a prospect of Chinese market of such amorphous materials are also presented.

  4. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... independent producers/consumers to connect to multiple distribution grids in order to optimise the electricity price, as this will vary during the day from one power distribution company to another one. It will be needed to have a load that can smoothly adjust the power consumed from each power grid in order...... these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the grids...

  5. Temas de Física para Ingeniería: Acústica

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  6. The Characteristics of Asphalt Concrete Binder Course (AC-BC Mixture with Bottom Ash as Aggregate Substitute

    Sugiyanto G.

    2015-01-01

    Full Text Available Highways serve nearly 80-90% of the population mobility and flow of goods. Utilization of bottom ash, a waste from coal combustion, in highway construction is one of the alternatives to reduce environmental pollution and support Clean Development Mechanism Program of Kyoto Protocol. The aim of this study is to analyze the characteristics of AC-BC mixture that uses bottom ash as partial substitute of fine aggregate and comparing with a standard mixture. Laboratory tests are performed on two different types of mixtures. The tests show that optimum asphalt content for AC-BCStandard mixture is 5.20% while AC-BCBottom Ash mixture is 5.25%. Bottom ash has higher porosity along with a little break field and has round shape so that the asphalt absorption is bigger than the crushed stone. Bottom ash can be used as an alternative aggregate to increase the value of flow of the AC-BC mixture, thus converting waste to valuable material.

  7. On the optical and electrical properties of rf and a.c. plasma polymerized aniline thin films

    U S Sajeev; C Joseph Mathai; S Saravanan; Rajeev R Ashokan; S Venkatachalam; M R Anantharaman

    2006-04-01

    Polyaniline is a widely studied conducting polymer and is a useful material in its bulk and thin film form for many applications, because of its excellent optical and electrical properties. Pristine and iodine doped polyaniline thin films were prepared by a.c. and rf plasma polymerization techniques separately for the comparison of their optical and electrical properties. Doping of iodine was effected in situ. The structural properties of these films were evaluated by FTIR spectroscopy and the optical band gap was estimated from UV-vis-NIR measurements. Comparative studies on the structural, optical and electrical properties of a.c. and rf polymerization are presented here. It has been found that the optical band gap of the polyaniline thin films prepared by rf and a.c. plasma polymerization techniques differ considerably and the band gap is further reduced by in situ doping of iodine. The electrical conductivity measurements on these films show a higher value of electrical conductivity in the case of rf plasma polymerized thin films when compared to the a.c. plasma polymerized films. Also, it is found that the iodine doping enhanced conductivity of the polymer thin films considerably. The results are compared and correlated and have been explained with respect to the different structures adopted under these two preparation techniques.

  8. 历史著述中的叙述、史料与文化形态——论《澳门史略》的编撰观念%Narration, Historical Materials and Culture Forms in Historical Writing: On Compilation Conception of A Brief History of Macao

    龙其林

    2011-01-01

    Probing into macau ' s development process from historical details and scene feeling of culture, the compilers of A Brief History of Macao break away from narrativization of traditional historiography, historical - data school's scientism and politicized and eventualized narration mode, explore the spiritual factors in historical culture form to provide animation and culture traits in Macao historical research. This is an innovation to the mode of researching Macao history and inherent demand from Macao - history researchers' inheriting historical and cultural resources.%《澳门史略》从历史的细节与文化的现场感切入澳门发展历程,跳出传统史学的叙述化、史料学派的唯科学主义,摆脱了事件化、政治化的叙述模式,代之以对历史文化形态中精神因素的发掘,赋予澳门史研究生命气息和文化特质。这既是澳门史研究模式的创新,也是研究者续接澳门历史文化资源的内在诉求。

  9. Ocorrência de reflexo acústico alterado em desordens do processamento auditivo

    Meneguello Juliana

    2001-01-01

    Full Text Available Introdução: O limiar do reflexo acústico corresponde à menor intensidade de um som capaz de desencadear o mecanismo de proteção da orelha média frente a sons intensos (Metz, 1952; Jerger, 1970, sendo necessária a integridade estrutural e funcional do sistema auditivo periférico e central em nível de tronco encefálico. Algumas dessas estruturas são também responsáveis pelo processamento central da informação auditiva. Objetivo: Procuramos verificar se alterações do reflexo acústico também estariam presentes na Desordem do Processamento Auditivo Central (DPA, levando a queixas relacionadas aos distúrbios da comunicação. Forma de estudo: Prospectivo randomizado. Material e método: Foram analisados cem protocolos de avaliações do Processamento Auditivo Central (PAC, realizadas segundo Pereira (1997, de indivíduos dos sexos masculino e feminino, de 7 a 18 anos, com limiares de audibilidade normais e timpanograma tipo A. A diferença entre os limiares do reflexo acústico e os de audibilidade forneceu os níveis de reflexos acústicos (NRA, considerados normais entre 70-90dB e alterados quando acima deste intervalo ou quando ocorreu ausência em uma ou mais freqüências (Carvallo, 1996; 1997; Metz, 1952. Resultados: Das crianças avaliadas 97% apresentaram algum tipo de DPA. Destas, 62% tiveram NRA alterados, numa relação estatisticamente significante. Além disso, pacientes com DPA mostraram NRA alterados, mais freqüentemente, nas desordens de grau severo, naquelas com prejuízos gnósicos auditivos combinados e naquelas com mais de uma habilidade auditiva alterada. Conclusão: Assim, indivíduos com alterações no reflexo acústico e sem alterações audiométricas devem submeter-se a provas de PAC, já que esses sintomas podem ser manifestações patológicas do sistema nervoso central.

  10. Alcohol screening and brief intervention among drug users in primary care: a discussion paper.

    Field, C A

    2011-08-24

    BACKGROUND: Problem alcohol use is common among problem drug users (PDU) and associated with adverse health outcomes. Primary care has an important role in the overall stepped approach to alcohol treatment, especially screening and brief intervention (SBI). AIM: To discuss three themes that emerged from an exploration of the literature on SBI for problem alcohol use in drug users attending primary care. METHODS: Material for this discussion paper was gathered from three biomedical databases (PubMed, PsycINFO and Cochrane library), conference proceedings and online resources of professional organisations or national health agencies. RESULTS: Themes discussed in this paper are: (a) the potential of primary care for delivery of alcohol SBIs to PDUs, (b) screening methods and (c) application of brief interventions to PDUs. CONCLUSIONS: Although SBI improves health outcomes associated with problem alcohol use in the general population, further research is needed among high-risk patient groups, especially PDUs.

  11. A viable electrode material for use in microbial fuel cells for tropical regions

    Offei, Felix; Thygesen, Anders; Mensah, Moses;

    2016-01-01

    Electrode materials are critical for microbial fuel cells (MFC) since they influence the construction and operational costs. This study introduces a simple and efficient electrode material in the form of palm kernel shell activated carbon (AC) obtained in tropical regions. The novel introduction...... of this material is also targeted at introducing an inexpensive and durable electrode material, which can be produced in rural communities to improve the viability of MFCs. The maximum voltage and power density obtained (under 1000 Ω load) using an H-shaped MFC with AC as both anode and cathode electrode material...... was 0.66 V and 1.74 W/m3, respectively. The power generated by AC was as high as 86% of the value obtained with the extensively used carbon paper. Scanning electron microscopy and Denaturing Gradient Gel Electrophoresis (DGGE) analysis of AC anode biofilms confirmed that electrogenic bacteria were...

  12. 一种简单新型拓扑Cuk AC/AC变换器及其仿真研究%A New Simple Topology of Cuk AC/AC Converter and Its Simulation

    陈溪; 刘韬; 谭光慧; 纪延超

    2006-01-01

    由Cuk DC/DC变换器的拓扑结构导出一种只具有两个开关的PWM AC/AC变换器的简单新型拓扑--Cuk AC/AC变换器.给出单相和三相Cuk AC/AC变换器的拓扑结构,分析Cuk AC/AC变换器的外特性及小信号特性.仿真结果验证了所提的Cuk AC/AC变换器的合理性和可行性.

  13. Modelling ac ripple currents in HTS coated conductors

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  14. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  15. AC losses in circular arrangements of parallel superconducting tapes

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  16. AC propulsion system for an electric vehicle, phase 2

    Slicker, J. M.

    1983-01-01

    A second-generation prototype ac propulsion system for a passenger electric vehicle was designed, fabricated, tested, installed in a modified Mercury Lynx vehicle and track tested at the Contractor's site. The system consisted of a Phase 2, 18.7 kw rated ac induction traction motor, a 192-volt, battery powered, pulse-width-modulated, transistorized inverter packaged for under rear seat installation, a 2-axis, 2-speed, automatically-shifted mechanical transaxle and a microprocessor-based powertrain/vehicle controller. A diagnostics computer to assist tuning and fault finding was fabricated. Dc-to-mechanical-system efficiency varied from 78% to 82% as axle speed/torque ranged from 159 rpm/788 nm to 65 rpm/328 nm. Track test efficiency results suggest that the ac system will be equal or superior to dc systems when driving urban cycles. Additional short-term work is being performed under a third contract phase (AC-3) to raise transaxle efficiency to predicted levels, and to improve starting and shifting characteristics. However, the long-term challenge to the system's viability remains inverter cost. A final report on the Phase 2 system, describing Phase 3 modifications, will be issued at the conclusion of AC-3.

  17. Impedance, AC conductivity and dielectric behavior Adeninium Trichloromercurate (II)

    Fersi, M. Amine; Chaabane, I.; Gargouri, M.

    2016-09-01

    In this work, we report the measurements impedance spectroscopy technique for the organic-inorganic hybrid compound (C5H6N5) HgCl3, 11/2H2O measured in the 209 Hz-5 MHz frequency range from 378 to 428 K. Besides, the Cole-Cole (Z″ versus Z‧) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experiment results indicated that AC conductivity (σac) was proportional to σdc + A ωS . The obtained results are discussed in terms of the correlated barrier hopping (CBH) model. An agreement between the experimental and theoretical results suggests that the AC conductivity behavior of Adeninium Trichloromercurate (II) can be successfully explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.

  18. AC impedance spectroscopy and conductivity studies of Dy doped Bi4V2O11 ceramics

    Bag, Sasmitarani; Das, Parthasarathi; Behera, Banarji

    2017-03-01

    The ac impedance and conductivity properties of Dy doped Bi4V2 - x Dy x O11 (x = 0.05, 0.10, 0.15 and 0.20) ceramics prepared by solid-state reaction technique, in a wide frequency range at different temperatures have been studied. All the samples exhibited β-type phase orthorhombic structure at room temperature. The Nyquist plot confirmed the presence of both grain and grain boundary effects for all Dy doped samples. Double relaxation behavior was also observed. The grain and grain boundary resistance decreases with rise in temperature for all the concentration and exhibits a typical negative temperature co-efficient of resistance (NTCR) behavior. An analysis of the electric modulus suggests the possible hopping mechanism for electrical transport processes of all the materials. The ac conductivity spectrum obeys Jonscher's universal power law. DC conductivity of the materials were also studied and values of the activation energy found to be 0.40, 0.49, 0.73 and 0.78 eV for the compositions x = 0.05, 0.10, 0.15 and 0.20, respectively, at different temperatures (150-375 °C).

  19. COMPARISON OF BACTERIAL ADSORPTION AND ANTIBACTERIAL PROPERTIES BETWEEN AC AND AC(Ag)%AC及AC(Ag)对细菌的吸附及灭菌功能的对比研究

    万怡灶; 王玉林; 董向红; 周福刚; 成国祥; 温廷益; 韩森

    2000-01-01

    测定了活性碳(AC)及载银活性碳(AC(Ag))的比表面积和孔径分布曲线,对比研究了AC及AC(Ag))对大肠杆菌的吸附能力和灭菌性能.结果表明,载银后,虽然AC(Ag)的比表面积下降,但由于银的存在,使其吸附的大肠杆菌数量高于AC,而吸附速率低于AC.灭菌试验表明,AC对大肠杆菌没有杀灭能力,而AC(Ag)对大肠杆菌有较好的灭菌功能.

  20. "Talking Pictures Therapy" as Brief Therapy in a School Setting

    Loewenthal, Del

    2013-01-01

    This article presents "talking pictures therapy" as an approach to brief therapy, in which photographs are used in brief psychotherapy and counseling with the purpose of enabling clients to express and explore through photographs aspects of their lives they would like to talk about. The author presents case examples using "talking pictures…

  1. "Talking Pictures Therapy" as Brief Therapy in a School Setting

    Loewenthal, Del

    2013-01-01

    This article presents "talking pictures therapy" as an approach to brief therapy, in which photographs are used in brief psychotherapy and counseling with the purpose of enabling clients to express and explore through photographs aspects of their lives they would like to talk about. The author presents case examples using "talking…

  2. Drama in design: An open brief to design for wellbeing

    Liao, T.; Person, F.E.O.K.

    2012-01-01

    This paper presents a design module in which student teams were challenged in an open brief to design for wellbeing. To design for wellbeing is difficult. Wellbeing is ambiguous, hard to define and highly personal. In the process of defining their own briefs, a drama workshop was set up to help the

  3. 42 CFR 423.2120 - Filing briefs with the MAC.

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Filing briefs with the MAC. 423.2120 Section 423... (CONTINUED) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Reopening, ALJ Hearings, MAC review, and Judicial Review § 423.2120 Filing briefs with the MAC. Upon request, the MAC will give...

  4. Mobile health systems: a brief overview

    Voskarides, S.; Pattichis, Constantinos S.; Habib Istepanian, Robert S.; Kyriacou, E.; Pattichis, Marios S.; Schizas, C. N.

    2002-06-01

    Rapid advances in information technology and telecommunications, and more specifically wireless and mobile communications, and their convergence (telematics) are leading to the emergence of a new type of information infrastructure that has the potential of supporting an array of advanced services for healthcare. The objective of this paper is to provide a snapshot of the applications of mobile technology in healthcare. A brief review of the spectrum of these applications and the potential benefits of these efforts will be presented, followed by success case studies in electronic patient record, emergency telemedicine, teleradiology, and home monitoring. It is anticipated that the progress carried out in these efforts, and the potential benefits of emerging mobile technologies will trigger the development of more applications, thus enabling the offering of a better service to the citizen.

  5. Brief fear preexposure facilitates subsequent fear conditioning.

    Iwasaki, Satoshi; Sakaguchi, Tetsuya; Ikegaya, Yuji

    2015-06-01

    Post-traumatic stress disorder (PTSD) is an anxiety disorder that occurs following an unexpected exposure to a severe psychological event. A history of a brief trauma is reported to affect a risk for future PTSD development; however, little is known about the mechanisms by which a previous trauma exposure drives the sensitivity to a late-coming trauma. Using a mouse PTSD model, we found that a prior foot shock enhances contextual fear conditioning. This shock-induced facilitation of fear conditioning (i.e., priming effect) persisted for 7 days and was prevented by MK801, an N-methyl-D-aspartate receptor antagonist. Other types of trauma, such as forced swimming or tail pinch, did not induce a priming effect on fear conditioning. Thus, a trauma is unlikely generalized to modify the sensitivity to other traumatic experiences. The behavioral procedure employed in this study may be a useful tool to elucidate the etiology of PTSD.

  6. Bats and Viruses: a Brief Review

    Lin-Fa Wang

    2009-01-01

    Bats, probably the most abundant, diverse and geographically dispersed vertebrates on earth, have recently been shown to be the reservoir hosts of a number of emerging viruses responsible for severe human and livestock disease outbreaks. Flying foxes have been demonstrated to be the natural reservoir for Hendra and Nipah viruses. Evidence supporting the possibility of bats as potential reservoirs for SARS coronavirus (SARS-CoV) and Ebola virus has also been reported. The recent discovery of these viruses and other viruses occurring naturally in the bat population provides a unique insight into a diverse pool of potentially emergent and pathogenic viruses. The factors which influence the ability of zoonotic viruses to effectively cross the species barrier from bats to other animal populations are poorly understood. A brief review is provided here on the recently emerged bat viruses and on current and future strategies for research in this area.

  7. Catastrophic Oxidation of Copper: A Brief Review

    Belousov, V. V.; Klimashin, A. A.

    2012-10-01

    A brief review of the current understanding of copper accelerated oxidation in the presence of low-melting oxides (Bi2O3, MoO3, and V2O5) is given. Special attention is paid to the kinetics, thermodynamics, and mechanisms of accelerated oxidation of copper. The mechanisms of two stages (fast and superfast) of the copper accelerated oxidation are considered. It is shown that the fast oxidation of copper occurs by a diffusion mechanism. Oxygen diffusion along the liquid channels in the oxide scale is the rate-limiting step in the overall mechanism. The superfast oxidation of copper occurs by a fluxing mechanism. Realization of the particular mechanism depends on the mass ratio of low-melting oxide to the metal. The mass ratios of low-melting oxide to the metal and the oxygen partial pressures for superfast oxidation of copper are established. A model of the fast oxidation of copper is discussed.

  8. The Financial Therapy Association: A Brief History

    Sonya Britt

    2010-10-01

    Full Text Available The purpose of this brief review is to provide a historical context for the conceptualization, development, and launch of the Financial Therapy Association (FTA. The FTA membership base consists of practicing financial planners, financial counselors, psychologists, marriage and family therapists, social workers, financial coaches, psychotherapists, and researchers from these and other disciplines. From the outset, the Association’s purpose has encompassed five goals:To promote a vision of financial therapy, which is the study of cognitive, emotional, behavioral, relational, economic, and integrative aspects of financial health.To provide a forum for researchers, practitioners, the media, and policy makers to share research and practice methods and models of financial therapy.To promote methods of training for those involved in financial therapy.To inform policy and practice management standards as these relate to financial therapy.To stimulate and disseminate clinical, experimental, and survey research on financial therapy.

  9. A brief review on viscosity of nanofluids

    Mishra, Purna Chandra; Mukherjee, Sayantan; Nayak, Santosh Kumar; Panda, Arabind

    2014-10-01

    Since the past decade, rapid development in nanotechnology has produced several aspects for the scientists and technologists to look into. Nanofluid is one of the incredible outcomes of such advancement. Nanofluids (colloidal suspensions of metallic and nonmetallic nanoparticles in conventional base fluids) are best known for their remarkable change to enhanced heat transfer abilities. Earlier research work has already acutely focused on thermal conductivity of nanofluids. However, viscosity is another important property that needs the same attention due to its very crucial impact on heat transfer. Therefore, viscosity of nanofluids should be thoroughly investigated before use for practical heat transfer applications. In this contribution, a brief review on theoretical models is presented precisely. Furthermore, the effects of nanoparticles' shape and size, temperature, volume concentration, pH, etc. are organized together and reviewed.

  10. A brief review of molecular information theory

    Schneider, Thomas D.

    2011-01-01

    The idea that we could build molecular communications systems can be advanced by investigating how actual molecules from living organisms function. Information theory provides tools for such an investigation. This review describes how we can compute the average information in the DNA binding sites of any genetic control protein and how this can be extended to analyze its individual sites. A formula equivalent to Claude Shannon’s channel capacity can be applied to molecular systems and used to compute the efficiency of protein binding. This efficiency is often 70% and a brief explanation for that is given. The results imply that biological systems have evolved to function at channel capacity, which means that we should be able to build molecular communications that are just as robust as our macroscopic ones. PMID:22110566

  11. Briefing paper -- Remedial Action Assessment System

    Buelt, J.L.

    1990-04-01

    Congress has mandated a more comprehensive management of hazardous wastes with the Resource Conservation and Recovery Act (RCRA), the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA or Superfund'') and the Superfund Amendment and Reauthorization Act (SARA). This mandate includes restoration of disposal sites contaminated through past disposal practices. This mandate applies to facilities operated for and by the Department of Energy (DOE), just as it does to industrial and other institutions. To help implement the CERCLA/SARA remedial investigation and feasibility study (RI/FS) process in a consistent, timely, and cost-effective manner, a methodology needs to be developed that will allow definition, sorting, and screening of remediation technologies for each operable unit (waste site). This need is stated specifically in Section 2.2.2.1 of the October 1989 Applied Research, Development, Demonstration, Testing, and Evaluation (RDDT E) Plan of the DOE. This Briefing Paper is prepared to respond to this need. 1 fig.

  12. Affordances for robots: a brief survey

    Thomas E. Horton

    2012-12-01

    Full Text Available In this paper, we consider the influence of Gibson's affordance theory on the design of robotic agents. Affordance theory (and the ecological approach to agent design in general has in many cases contributed to the development of successful robotic systems; we provide a brief survey of AI research in this area. However, there remain significant issues that complicate discussions on this topic, particularly in the exchange of ideas between researchers in artificial intelligence and ecological psychology. We identify some of these issues, specifically the lack of a generally accepted definition of "affordance" and fundamental differences in the current approaches taken in AI and ecological psychology. While we consider reconciliation between these fields to be possible and mutually beneficial, it will require some flexibility on the issue of direct perception.

  13. A brief history of mechanical engineering

    Dixit, Uday Shanker; Davim, J Paulo

    2017-01-01

    What is mechanical engineering? What a mechanical engineering does? How did the mechanical engineering change through ages? What is the future of mechanical engineering? This book answers these questions in a lucid manner. It also provides a brief chronological history of landmark events and answers questions such as: When was steam engine invented? Where was first CNC machine developed? When did the era of additive manufacturing start? When did the marriage of mechanical and electronics give birth to discipline of mechatronics? This book informs and create interest on mechanical engineering in the general public and particular in students. It also helps to sensitize the engineering fraternity about the historical aspects of engineering. At the same time, it provides a common sense knowledge of mechanical engineering in a handy manner.

  14. Brief mindfulness induction reduces inattentional blindness.

    Schofield, Timothy P; Creswell, J David; Denson, Thomas F

    2015-12-01

    Prior research has linked mindfulness to improvements in attention, and suggested that the effects of mindfulness are particularly pronounced when individuals are cognitively depleted or stressed. Yet, no studies have tested whether mindfulness improves declarative awareness of unexpected stimuli in goal-directed tasks. Participants (N=794) were either depleted (or not) and subsequently underwent a brief mindfulness induction (or not). They then completed an inattentional blindness task during which an unexpected distractor appeared on the computer monitor. This task was used to assess declarative conscious awareness of the unexpected distractor's presence and the extent to which its perceptual properties were encoded. Mindfulness increased awareness of the unexpected distractor (i.e., reduced rates of inattentional blindness). Contrary to predictions, no mindfulness×depletion interaction emerged. Depletion however, increased perceptual encoding of the distractor. These results suggest that mindfulness may foster awareness of unexpected stimuli (i.e., reduce inattentional blindness).

  15. STS-114: Discovery Launch Postponement Press Briefing

    2005-01-01

    This press briefing addresses the problem that occurred prior to the launch of the STS-114. Dean Acosta, Deputy Assistant Administrator of Public Affairs, introduces the panel which consists of Dr. Michael Griffin, NASA Administrator, William Readdy, Associate Administrator for Space Operations, Wayne Hale, Space Shuttle Program Deputy Manager, Steve Poulas, Orbiter Project Manager, Mike Leinbach, NASA Launch Director, and Bill Parsons, Space Shuttle Program Manager. Wayne Hale expresses that a problem occurred with one of the low level sensors in the hydrogen tank and that the cause of the problem must be identified and rectified. Steve Poulos talks about establishing a troubleshooting plan as a part of the scrub effort and Mike Leinbach describes the process of draining the external tank. Wayne Hale answers questions about the sensors and if the Space Shuttle Discovery is safe to fly and Steve Poulos answers questions about the possible suspects for this problem.

  16. A brief journey through the immune system.

    Yatim, Karim M; Lakkis, Fadi G

    2015-07-07

    This review serves as an introduction to an Immunology Series for the Nephrologist published in CJASN. It provides a brief overview of the immune system, how it works, and why it matters to kidneys. This review describes in broad terms the main divisions of the immune system (innate and adaptive), their cellular and tissue components, and the ways by which they function and are regulated. The story is told through the prism of evolution in order to relay to the reader why the immune system does what it does and why imperfections in the system can lead to renal disease. Detailed descriptions of cell types, molecules, and other immunologic curiosities are avoided as much as possible in an effort to not detract from the importance of the broader concepts that define the immune system and its relationship to the kidney.

  17. A brief history of gravitational wave research

    Chen, Chiang-Mei; Ni, Wei-Tou

    2016-01-01

    For the benefit of the readers of this journal, the editors requested that we prepare a brief review of the history of the development of the theory, the experimental attempts to detect them, and the recent direct observations of gravitational waves (GWs). The theoretical ideas and disputes beginning with Einstein in 1916 regarding the existence and nature of GWs and the extent to which one can rely on the electromagnetic analogy, especially the controversies regarding the quadrupole formula and whether GWs carry energy, are discussed. The theoretical conclusions eventually received strong observational support from the binary pulsar. This provided compelling, although indirect, evidence for GWs carrying away energy--as predicted by the quadrupole formula. On the direct detection experimental side, Weber started more than 50 years ago. In 1966, his bar for GW detection reached a strain sensitivity of a few times 10^-16. His announcement of coincident signals (now considered spurious) stimulated many experimen...

  18. Brief assessment of negative dysmorphic signs

    Patrizia Fiori

    2010-09-01

    Full Text Available Patrizia Fiori1, Antonio Monaco1, Maria Giannetti Luigi21Central Operative Unit of Neurology, 2Infantile Neuropsychiatry and Social Service, ASL AV, Civil Hospital of Ariano Irpino, University of Naples, ItalyAbstract: Body dysmorphic disorder is a body image dysperception, characterized either by an excessive preoccupation with a presumed or minimal flaw in appearance, or by unrecognition, denial, or even neglect regarding an obvious defect. These features are evaluated by a novel questionnaire, the Brief Assessment of Negative Dysmorphic Signs (BANDS. Moreover, the temperament and character background is examined. The relationship with addictive mentality/behavior and schizoaffectivity is also highlighted. Lastly, the potential shift toward cognitive impairment and dementia is considered.Keywords: body dysmorphic disorder, schizoaffectivity, addiction, behavioral-cognitive impairment

  19. Absorbent Material

    1985-01-01

    A superabsorbent fabric developed by Johnson Space Center and described in Tech Briefs was adapted by Honeywell and fabricated into special containment devices used on Navy "smart" torpedos. The superabsorbent fabric can sequester up to 400 times its own weight in water and protects the torpedo electronic controls from possible short circuiting by deepwater hull seepage.

  20. Astrobiology Research in India - A Brief Overview

    Peda Nageswara Rao, Pinnamaneni

    2012-07-01

    strobiology is study of the origin, evolution, distribution and future of life on Earth and in the Universe. The discovery of amino acids in carbonaceous chondrite meteorites and complex organic molecules in interstellar clouds, comets and interplanetary dust forced biological interest into space research. The existence of different life forms in extreme environments of Earth, their ability to adapt and survive for long periods in stasis and then recover has given hope that life might exist on other planets. A lot more insight into the origin of life is gained by studying the analogous life on Earth to predict how extraterrestrial life might live. In this paper, a brief account is given on the exogenous and endogenous origin of life on Earth, biochemical basis of life, the need and approach for research in astrobiology, scientific strength of Indian institutions to launch space missions in search of life. A review of the results of the two balloon experiments carried out by Indian Space Research Organization (ISRO) in collaboration with many research institutes in the country as well as the studies carried out elsewhere is also given. An attempt made to address the limitations of the previous experiments, improvements needed, implications of engineering design changes to meet the gaps and institutional resources needed to carry out further studies in astrobiology in the Indian context. A few priority investigations that can be carried out in collaboration with premier national laboratories in India have been identified. A brief account of the international missions that are aimed at finding out habitable Earth-like planets is given. The educational opportunities and interdisciplinary unifying nature of astrobiology research are discussed. The paper concludes with an approach that can be adopted for coordinating the research in this new space science in a programmatic mode.

  1. Variable transposition of eight maize activator (ac) elements located on the short arm of chromosome 1.

    Sheridan, William F

    2011-09-01

    Eight Activator (Ac) transposable elements mapped to the maize chromosome arm 1S were assessed for Ac transposition rates. For each of the Ac stocks, plants homozygous for the single Ac element and the Ds reporter r1-sc:m3 on chromosome 10 were crossed as females by a homozygous r1-sc:m3 tester color-converted W22 line. The resulting ears produced mostly coarsely spotted kernels and a low frequency of either near-colorless fine-spotted kernels or nonspotted kernels. The relative frequency of these two types of near-colorless kernels differed among the eight Ac stocks. The extent to which increased Ac dosage results in nonspotted kernels may be Ac-specific. Although all of the Ac elements are in near-isogenic inbred W22 lines, they varied to a large extent in their transposition frequency. These differences might possibly result from structural differences among the Ac elements. Because one pair of Ac elements derived from Ac33 on chromosome arm 5S differed about 13-fold in transposition frequency and a second pair of Ac elements derived from Ac12 on chromosome arm 1S differed about 3-fold in transposition frequency, this is not a likely explanation for all eight Ac elements. The data presented here support the notion that the differences in transposition frequency of the eight Ac elements may be a reflection of variability in Ac transcription or accessibility of the transposase to the Ac element, resulting from differences in the chromatin environments wherein the Ac elements are located. This is the first report of variability in transposition rates among different Ac donor lines.

  2. The brief family relationship scale: a brief measure of the relationship dimension in family functioning.

    Fok, Carlotta Ching Ting; Allen, James; Henry, David

    2014-02-01

    The Relationship dimension of the Family Environment Scale, which consists of the Cohesion, Expressiveness, and Conflict subscales, measures a person's perception of the quality of his or her family relationship functioning. This study investigates an adaptation of the Relationship dimension of the Family Environment Scale for Alaska Native youth. The authors tested the adapted measure, the Brief Family Relationship Scale, for psychometric properties and internal structure with 284 12- to 18-year-old predominately Yup'ik Eskimo Alaska Native adolescents from rural, remote communities. This non-Western cultural group is hypothesized to display higher levels of collectivism traditionally organized around an extended kinship family structure. Results demonstrate a subset of the adapted items function satisfactorily, a three-response alternative format provided meaningful information, and the subscale's underlying structure is best described through three distinct first-order factors, organized under one higher order factor. Convergent and discriminant validity of the Brief Family Relationship Scale was assessed through correlational analysis.

  3. On the Application of TLS Techniques to AC Electrical Drives

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  4. Reliability of emergency ac power systems at nuclear power plants

    Battle, R E; Campbell, D J

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project.

  5. Security analysis of interconnected AC/DC systems

    Eriksson, Robert

    2015-01-01

    This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid. The red......This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid....... The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...

  6. Harmonic-free line-commutated ac/dc rectifiers

    Villablanca, Miguel E. [Electrical Engineering Department, University of Santiago, P.O. Box 10233, Santiago (Chile)

    2009-11-15

    In this paper both a method and apparatus are applied to different configurations of line-commutated ac/dc rectifiers to reduce the distortion of currents flowing from the ac supply. The load may be either inductive or capacitive. The technology involves an accurate shaping of the dc current by using two self-commutated switches. This dc-current shaping is reflected back into the shaping of the ac input currents, which become pure sine waves. Thyristor-based rectifying operation is possible with a simple control circuit, which is able to deal with both rapid load variations and failures in the self-commutated switches. Furthermore, the overlap conduction of bridge thyristors is eliminated completely. Experimental verification is provided from a 400-V 30-kVA 50-Hz laboratory prototype. (author)

  7. Neural network based PWM AC chopper fed induction motor drive

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  8. Superconducting shielded core reactor with reduced AC losses

    Cha, Yung S.; Hull, John R.

    2006-04-04

    A superconducting shielded core reactor (SSCR) operates as a passive device for limiting excessive AC current in a circuit operating at a high power level under a fault condition such as shorting. The SSCR includes a ferromagnetic core which may be either closed or open (with an air gap) and extends into and through a superconducting tube or superconducting rings arranged in a stacked array. First and second series connected copper coils each disposed about a portion of the iron core are connected to the circuit to be protected and are respectively wound inside and outside of the superconducting tube or rings. A large impedance is inserted into the circuit by the core when the shielding capability of the superconducting arrangement is exceeded by the applied magnetic field generated by the two coils under a fault condition to limit the AC current in the circuit. The proposed SSCR also affords reduced AC loss compared to conventional SSCRs under continuous normal operation.

  9. Modeling and Correcting the Time-Dependent ACS PSF

    Rhodes, Jason; Massey, Richard; Albert, Justin; Taylor, James E.; Koekemoer, Anton M.; Leauthaud, Alexie

    2006-01-01

    The ability to accurately measure the shapes of faint objects in images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST) depends upon detailed knowledge of the Point Spread Function (PSF). We show that thermal fluctuations cause the PSF of the ACS Wide Field Camera (WFC) to vary over time. We describe a modified version of the TinyTim PSF modeling software to create artificial grids of stars across the ACS field of view at a range of telescope focus values. These models closely resemble the stars in real ACS images. Using 10 bright stars in a real image, we have been able to measure HST s apparent focus at the time of the exposure. TinyTim can then be used to model the PSF at any position on the ACS field of view. This obviates the need for images of dense stellar fields at different focus values, or interpolation between the few observed stars. We show that residual differences between our TinyTim models and real data are likely due to the effects of Charge Transfer Efficiency (CTE) degradation. Furthermore, we discuss stochastic noise that is added to the shape of point sources when distortion is removed, and we present MultiDrizzle parameters that are optimal for weak lensing science. Specifically, we find that reducing the MultiDrizzle output pixel scale and choosing a Gaussian kernel significantly stabilizes the resulting PSF after image combination, while still eliminating cosmic rays/bad pixels, and correcting the large geometric distortion in the ACS. We discuss future plans, which include more detailed study of the effects of CTE degradation on object shapes and releasing our TinyTim models to the astronomical community.

  10. Introducing high performance distributed logging service for ACS

    Avarias, Jorge A.; López, Joao S.; Maureira, Cristián; Sommer, Heiko; Chiozzi, Gianluca

    2010-07-01

    The ALMA Common Software (ACS) is a software framework that provides the infrastructure for the Atacama Large Millimeter Array and other projects. ACS, based on CORBA, offers basic services and common design patterns for distributed software. Every properly built system needs to be able to log status and error information. Logging in a single computer scenario can be as easy as using fprintf statements. However, in a distributed system, it must provide a way to centralize all logging data in a single place without overloading the network nor complicating the applications. ACS provides a complete logging service infrastructure in which every log has an associated priority and timestamp, allowing filtering at different levels of the system (application, service and clients). Currently the ACS logging service uses an implementation of the CORBA Telecom Log Service in a customized way, using only a minimal subset of the features provided by the standard. The most relevant feature used by ACS is the ability to treat the logs as event data that gets distributed over the network in a publisher-subscriber paradigm. For this purpose the CORBA Notification Service, which is resource intensive, is used. On the other hand, the Data Distribution Service (DDS) provides an alternative standard for publisher-subscriber communication for real-time systems, offering better performance and featuring decentralized message processing. The current document describes how the new high performance logging service of ACS has been modeled and developed using DDS, replacing the Telecom Log Service. Benefits and drawbacks are analyzed. A benchmark is presented comparing the differences between the implementations.

  11. Examining the Efficacy of a Brief Mindfulness-Based Stress Reduction (Brief MBSR) Program on Psychological Health

    Bergen-Cico, Dessa; Possemato, Kyle; Cheon, Sanghyeon

    2013-01-01

    Objective: The purpose of the study was to examine potential psychological health benefits of participating in a brief (5-week) mindfulness-based stress reduction (brief MBSR) program integrated into an academic course. Participants: Participants were 119 undergraduate students (treatment: "n" = 72; control: "n" = 47) enrolled…

  12. Brief guided imagery and body scanning interventions reduce food cravings.

    Hamilton, Jonathan; Fawson, Sophie; May, Jon; Andrade, Jackie; Kavanagh, David J

    2013-12-01

    Elaborated Intrusion (EI) Theory proposes that cravings occur when involuntary thoughts about food are elaborated; a key part of elaboration is affectively-charged imagery. Craving can be weakened by working memory tasks that block imagery. EI Theory predicts that cravings should also be reduced by preventing involuntary thoughts being elaborated in the first place. Research has found that imagery techniques such as body scanning and guided imagery can reduce the occurrence of food thoughts. This study tested the prediction that these techniques also reduce craving. We asked participants to abstain from food overnight, and then to carry out 10 min of body scanning, guided imagery, or a control mind wandering task. They rated their craving at 10 points during the task on a single item measure, and before and after the task using the Craving Experience Questionnaire. While craving rose during the task for the mind wandering group, neither the guided imagery nor body scanning group showed an increase. These effects were not detected by the CEQ, suggesting that they are only present during the competing task. As they require no devices or materials and are unobtrusive, brief guided imagery strategies might form useful components of weight loss programmes that attempt to address cravings.

  13. Biological restoration in pediatric dentistry: a brief insight.

    Md, Indira; Singh Dhull, Kanika; Nandlal, B; Kumar Ps, Praveen; Singh Dhull, Rachita

    2014-01-01

    Dental caries is the most prevalent disease in humans, especially during early childhood. The restoration of such an extensive carious lesion should be done properly to reestablish their anatomy and hence their masticatory, phonetic, esthetic and space-maintainer functions in the dental arches. The consequences of premature loss of primary teeth are well known, namely the loss of vertical dimension of occlusion, tongue thrusting and mouth breathing habits, which can be the sources of future malocclusion. Satisfactory restoration of these teeth, improving esthetics, along with the management of space and function has always been a challenge for pediatric dentist. An ever increasing demand for esthetics has led to innovation and development of newer treatment modalities for these problems. In an attempt to widen the treatment options as biologically and conservatively as possible, tooth structure is used as a restorative material to rehabilitate severely destroyed tooth crowns. This technique consists of bonding sterile dental fragments, obtained either from the patient or from a tooth bank, to the teeth. Such a technique was termed as 'biological restoration'. This article aims at reviewing the evolution, techniques and outcome of such biological restorations. How to cite this article: MD Indira, Dhull KS, Nandlal B, Kumar PSP, Dhull RS. Biological Restoration in Pediatric Dentistry: A Brief Insight. Int J Clin Pediatr Dent 2014;7(3):197-201.

  14. Simultaneous dynamic electrical and structural measurements of functional materials

    Vecchini, C.; Stewart, M.; Muñiz-Piniella, A.; Wooldridge, J. [National Physical Laboratory, Hampton Road, Teddington TW11 0LW (United Kingdom); Thompson, P.; McMitchell, S. R. C.; Bouchenoire, L.; Brown, S.; Wermeille, D.; Lucas, C. A. [XMaS, The UK-CRG, ESRF-The European Synchrotron, CS40220, F-38043, Grenoble Cedex 09 (France); Department of Physics, University of Liverpool, Liverpool L69 3BX (United Kingdom); Lepadatu, S. [National Physical Laboratory, Hampton Road, Teddington TW11 0LW (United Kingdom); Jeremiah Horrocks Institute, University of Central Lancashire, Preston PR1 2HE (United Kingdom); Bikondoa, O.; Hase, T. P. A. [XMaS, The UK-CRG, ESRF-The European Synchrotron, CS40220, F-38043, Grenoble Cedex 09 (France); Department of Physics, University of Warwick, Coventry CV4 7AL (United Kingdom); Lesourd, M. [ESRF-The European Synchrotron, CS40220, F-38043, Grenoble Cedex 09 (France); Dontsov, D. [SIOS Meßtechnik GmbH, Am Vogelherd 46, 98693 Ilmenau (Germany); Cain, M. G. [National Physical Laboratory, Hampton Road, Teddington TW11 0LW (United Kingdom); Electrosciences Ltd., Farnham, Surrey GU9 9QT (United Kingdom)

    2015-10-15

    A new materials characterization system developed at the XMaS beamline, located at the European Synchrotron Radiation Facility in France, is presented. We show that this new capability allows to measure the atomic structural evolution (crystallography) of piezoelectric materials whilst simultaneously measuring the overall strain characteristics and electrical response to dynamically (ac) applied external stimuli.

  15. System and method for determining stator winding resistance in an AC motor using motor drives

    Lu, Bin; Habetler, Thomas G; Zhang, Pinjia

    2013-02-26

    A system and method for determining the stator winding resistance of AC motors is provided. The system includes an AC motor drive having an input connectable to an AC source and an output connectable to an input terminal of an AC motor, a pulse width modulation (PWM) converter having switches therein to control current flow and terminal voltages in the AC motor, and a control system connected to the PWM converter. The control system generates a command signal to cause the PWM converter to control an output of the AC motor drive corresponding to an input to the AC motor, selectively generates a modified command signal to cause the PWM converter to inject a DC signal into the output of the AC motor drive, and determines a stator winding resistance of the AC motor based on the DC signal of at least one of the voltage and current.

  16. Study of AC/RF properties of SRF ingot niobium

    Dhakal, Pashupati; Tsindlekht, Menachem I; Genkin, Valery M; Ciovati, Gianluigi; Myneni, Ganapati Rao

    2013-09-01

    In an attempt to correlate the performance of superconducting radiofrequency cavities made of niobium with the superconducting properties, we present the results of the magnetization and ac susceptibility of the niobium used in the superconducting radiofrequency cavity fabrication. The samples were subjected to buffer chemical polishing (BCP) surface and high temperature heat treatments, typically applied to the cavities fabrications. The analysis of the results show the different surface and bulk ac conductivity for the samples subjected to BCP and heat treatment. Furthermore, the RF surface impedance is measured on the sample using a TE011 microwave cavity for a comparison to the low frequency measurements.

  17. AC and Phase Sensing of Nanowires for Biosensing.

    Crescentini, Marco; Rossi, Michele; Ashburn, Peter; Lombardini, Marta; Sangiorgi, Enrico; Morgan, Hywel; Tartagni, Marco

    2016-04-19

    Silicon nanowires are label-free sensors that allow real-time measurements. They are economical and pave the road for point-of-care applications but require complex readout and skilled personnel. We propose a new model and technique for sensing nanowire sensors using alternating currents (AC) to capture both magnitude and phase information from the sensor. This approach combines the advantages of complex impedance spectroscopy with the noise reduction performances of lock-in techniques. Experimental results show how modifications of the sensors with different surface chemistries lead to the same direct-current (DC) response but can be discerned using the AC approach.

  18. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling. The vol......This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...

  19. Development of an AC Module System: Final Technical Report

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  20. Active Power Regulation based on Droop for AC Microgrid

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes......In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed...

  1. Power converters and AC electrical drives with linear neural networks

    Cirrincione, Maurizio

    2012-01-01

    The first book of its kind, Power Converters and AC Electrical Drives with Linear Neural Networks systematically explores the application of neural networks in the field of power electronics, with particular emphasis on the sensorless control of AC drives. It presents the classical theory based on space-vectors in identification, discusses control of electrical drives and power converters, and examines improvements that can be attained when using linear neural networks. The book integrates power electronics and electrical drives with artificial neural networks (ANN). Organized into four parts,

  2. What does "brief" mean? A theoretical critique of the concept of brief therapy from a psychoanalytic viewpoint.

    Migone, Paolo

    2014-08-01

    The concept of "brief therapy" contains internal contradictions. The techniques suggested by brief therapists are the same techniques that have been discussed historically in debates on theory of technique, both within and without psychoanalysis (e.g., the experiential factor at the center of the Freud-Ferenczi confrontation is also an important aspect of Gestalt therapy). A time limit is the only operational criterion that allows a rigorous definition of brief therapy; without this criterion it is impossible to discriminate between "brief" and simply "good" therapies (i.e., those in which patients are successfully treated in a short time). An important question is why, with a given patient, a therapist should decide, a priori, to terminate a treatment within a set time. Two clinical examples are presented, illustrating the usefulness of Eissler's concept of parameters as a heuristic framework to identify the potentially defensive nature of both "brief" and "long-term" therapy.

  3. Investigation of surface modifications in ethylene propylene diene monomer (EPDM) rubber due to tracking under a.c. and d.c. voltages

    R Sarathi; Uma Maheswar Rao

    2001-12-01

    In the present work, tracking phenomena has been studied with the ethylene propylene diene monomer (EPDM) material under the a.c. and d.c. voltages, with ammonium chloride/acid rain solution as the contaminant. It is noticed that the tracking time depends on the conductivity and flow rate of the contaminant. The physico-chemical analyses viz. wide angle X-ray diffraction (WAXD), thermo-gravimetric differential thermal analysis (TG-DTA) and the differential scanning calorimetry (DSC) studies, were carried out and it was concluded that the tracking process is a surface degradation process. The tracking time is different for a.c. and d.c. voltages.

  4. Multiphased (NaCl){sub x}(KCl){sub y-x}(KBr){sub 1-y} single crystals: ac conductivity activation energy versus bulk properties

    Katsika-Tsigourakou, Vassiliki, E-mail: vkatsik@phys.uoa.g [Department of Solid State Physics, Faculty of Physics, University of Athens, Panepistimiopolis, 157 84 Zografos (Greece)

    2009-11-01

    The ac electrical measurements have been just reported for alkali halide mixed crystals that were melt grown from NaCl, KCl and KBr starting materials. They showed a nonlinear variation of all the electrical parameters with the bulk composition. In this short paper, we show that these mixed systems, depending on their major constituent, are classified into three categories in each of which, the activation energy for the ac conductivity increases linearly with BOMEGA, where B is the isothermal bulk modulus and OMEGA the mean volume per atom. In addition, the resulting three straight lines are formed to have almost the same slope.

  5. A single-shot spatial chirp method for measuring initial AC conductivity evolution of femtosecond laser pulse excited warm dense matter

    Chen, Z.; Hering, P.; Brown, S. B.; Curry, C.; Tsui, Y. Y.; Glenzer, S. H.

    2016-11-01

    To study the rapid evolution of AC conductivity from ultrafast laser excited warm dense matter (WDM), a spatial chirp single-shot method is developed utilizing a crossing angle pump-probe configuration. The pump beam is shaped individually in two spatial dimensions so that it can provide both sufficient laser intensity to excite the material to warm dense matter state and a uniform time window of up to 1 ps with sub-100 fs FWHM temporal resolution. Temporal evolution of AC conductivity in laser excited warm dense gold was also measured.

  6. 升降式交流斩波器%Buck-Boost AC/AC Direct Converter

    孙刚; 洪峰

    2009-01-01

    介绍了一种新颖的Buck-Boost型交流斩波器.该交流斩波器将Buck-Boost型DC/DC变换器的开关管双向化,可实现单级降压或升压的AC/AC直接变换和能量双向流动.该变换器使用较少的功率器件实现了单级功率变换和能量双向流动,有利于提高变换器的功率密度和变换效率.详细研究了其工作模态和原理.分析了该变换器的两种PWM调制策略,并指出采用第2种调制策略可降低开关损耗.采用滞环电流控制的Buck/Boost型交流斩波器可对输入电压畸变进行有效抑制,保持了输出电压波形的高度正弦化.仿真和实验验证了分析的正确性.

  7. Impacts on Power Factor of AC Voltage Controllers Under Non-Sinusoidal Conditions

    Mukhtiar Ahmed Mahar

    2012-04-01

    Full Text Available AC-AC conversion is obtained with the help of Cyclo-converters, DC Link converters and AC Voltage Controllers. AC voltage controllers are also referred to as voltage regulators. Main issue concerned to these converters is that they generate harmonics due to periodic variable structure system. The generated harmonics create disturbances and degrade the performance of converter. The power factor of supply side is affected due to these harmonics. This paper focuses on source side power factor of ac voltage controllers under nonsinusoidal conditions. In order to observe the power factor, measurement tool of power factor and simulation model of ac voltage controller is also developed in MATLAB software.

  8. Electron-radiation effects on the ac and dc electrical properties and unpaired electron densities of three aerospace polymers

    Long, Sheila Ann T.; Long, Edward R., Jr.; Ries, Heidi R.; Harries, Wynford L.

    1986-01-01

    The effects of gigarad-level total absorbed doses from 1-MeV electrons on the post-irradiation alternating-current (ac) and direct-current (dc) electrical properties and the unpaired electron densities have been studied for Kapton, Ultem, and Mylar. The unpaired electron densities (determined from electron paramagnetic resonance spectroscopy) and the dc electrical conductivities of the irradiated materials were monitored as functions of time following the exposures to determine their decay characteristics at room temperature. The elevated-temperature ac electrical dissipations of the Ultem and Mylar were affected by the radiation. The dc conductivity of the Kapton increased by five orders of magnitude, while the dc conductivities of the Ultem and Mylar increased by less than an order of magnitude, due to the radiation. The observed radiation-generated changes in the ac electrical dissipations are explained in terms of known radiation-generated changes in the molecular structures of the three materials. A preliminary model relating the dc electrical conductivity and the unpaired electron density in the Kapton is proposed.

  9. Electron-radiation effects on the ac and dc electrical properties and unpaired electron densities of three aerospace polymers

    Long, Sheila Ann T.; Long, Edward R., Jr.; Ries, Heidi R.; Harries, Wynford L.

    1986-12-01

    The effects of gigarad-level total absorbed doses from 1-MeV electrons on the post-irradiation alternating-current (ac) and direct-current (dc) electrical properties and the unpaired electron densities have been studied for Kapton, Ultem, and Mylar. The unpaired electron densities (determined from electron paramagnetic resonance spectroscopy) and the dc electrical conductivities of the irradiated materials were monitored as functions of time following the exposures to determine their decay characteristics at room temperature. The elevated-temperature ac electrical dissipations of the Ultem and Mylar were affected by the radiation. The dc conductivity of the Kapton increased by five orders of magnitude, while the dc conductivities of the Ultem and Mylar increased by less than an order of magnitude, due to the radiation. The observed radiation-generated changes in the ac electrical dissipations are explained in terms of known radiation-generated changes in the molecular structures of the three materials. A preliminary model relating the dc electrical conductivity and the unpaired electron density in the Kapton is proposed.

  10. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  11. BOLD signal effects of transcranial alternating current stimulation (tACS) in the alpha range: A concurrent tACS-fMRI study.

    Vosskuhl, Johannes; Huster, René J; Herrmann, Christoph S

    2016-10-15

    Many studies have proven transcranial alternating current stimulation (tACS) to manipulate brain activity. Until now it is not known, however, how these manipulations in brain activity are represented in brain metabolism or how spatially specific these changes are. Alpha-tACS has been shown to enhance the amplitude of the individual alpha frequency (IAF) and a negative correlation between alpha amplitude and occipital BOLD signal was reported in numerous EEG/fMRI experiments. Thus, alpha-tACS was chosen to test the effects of tACS on the BOLD signal. A reduction thereof was expected during alpha-tACS which shows the spatial extent of tACS effects beyond modeling studies. Three groups of subjects were measured in an MRI scanner, receiving tACS at either their IAF (N=11), 1Hz (control; N=12) or sham (i.e., no stimulation - a second control; N=11) while responding to a visual vigilance task. Stimulation was administered in an interleaved pattern of tACS-on runs and tACS-free baseline periods. The BOLD signal was analyzed in response to tACS-onset during resting state and in response to seldom target stimuli. Alpha-tACS at 1.0mA reduced the task-related BOLD response to visual targets in the occipital cortex as compared to tACS-free baseline periods. The deactivation was strongest in an area where the BOLD signal was shown to correlate negatively with alpha amplitude. A direct effect of tACS on resting state BOLD signal levels could not be shown. Our findings suggest that tACS-related changes in BOLD activity occur only as a modulation of an existing BOLD response.

  12. Lowest of AC-DC power output for electrostrictive polymers energy harvesting systems

    Meddad, Mounir; Eddiai, Adil; Hajjaji, Abdelowahed; Guyomar, Daniel; Belkhiat, Saad; Boughaleb, Yahia; Chérif, Aida

    2013-11-01

    Advances in technology led to the development of electronic circuits and sensors with extremely low electricity consumption. At the same time, structural health monitoring, technology and intelligent integrated systems created a need for wireless sensors in hard to reach places in aerospace vehicles and large civil engineering structures. Powering sensors with energy harvesters eliminates the need to replace batteries on a regular basis. Scientists have been forced to search for new power source that are able to harvested energy from their surrounding environment (sunlight, temperature gradients etc.). Electrostrictive polymer belonging to the family of electro-active polymers, offer unique properties for the electromechanical transducer technology has been of particular interest over the last few years in order to replace conventional techniques such as those based on piezoelectric or electromagnetic, these materials are highly attractive for their low-density, with large strain capability that can be as high as two orders of magnitude greater than the striction-limited, rigid and fragile electroactive ceramics. Electrostrictive polymers sensors respond to vibration with an ac output signal, one of the most important objectives of the electronic interface is to realize the required AC-DC conversion. The goal of this paper is to design an active, high efficiency power doubler converter for electrostrictive polymers exclusively uses a fraction of the harvested energy to supply its active devices. The simulation results show that it is possible to obtain a maximum efficiency of the AC-DC converter equal to 80%. Premiliminary experimental measurements were performed and the results obtained are in good agreement with simulations.

  13. Modulation schemes with enhanced switch thermal distribution for single-phase AC-DC-AC reduced-switch converters

    Qin, Zian; Loh, Poh Chiang; Blaabjerg, Frede

    2015-01-01

    ulation schemes can significantly change the performance of a power converter in steady state, and they have been extensively studied, but mostly directed to three-phase topologies, where triplen offsets are added. Single-phase systems, including ac-dc-ac systems, are less widely pursued, even...... among their switches, while keeping their dc-link voltages low. Single points of failure are thus minimized, allowing the converters to have longer lifetimes. Simulation and experimental results have demonstrated the intended performances and hence verifying the idea....

  14. Impedance Spectroscopy Study of the AC Conductivity and Dielectric properties of 3, 5-Dimethylpyridine-Iodine Charge Transfer Complex

    Uttam Mohan

    2016-05-01

    Full Text Available Solid charge transfer complex of n-donor 3, 5-dimethylpyridine (3, 5-Lutidine with σ acceptor iodine was prepared and characterised by using elemental analysis, UV-Vis, FTIR, 1H NMR spectroscopy and powder XRD techniques. The electrical parameters of the prepared complex in the pellet form were studied at various temperatures and at wide frequency range by employing AC complex impedance spectroscopic technique. The Nyquist (cole-cole plots have been successfully explained by employing (RC(RC(RC equivalent circuit corresponding to grain , grain boundary and electrode contributions. The radii of the semicircular arc decrease with increase in temperature which suggests that the material exhibits negative temperature coefficient of resistance (NTCR behaviour like semiconductors. Dielectric constant, ɛ′ and dielectric loss, ɛ″ seems to decrease sharply with increase in frequency. The ac conductivity obeys the power law of frequency.

  15. Strongly nonlinear dynamics of electrolytes in large ac voltages

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...

  16. Recommended ACS Syllabus for Introductory Courses in Polymer Chemistry.

    Seymour, Raymond B.

    1982-01-01

    Provides syllabus for courses in introductory polymer chemistry (including major topics and recommended time allotments) and currently available textbooks and audio courses which may be used with the syllabus. Syllabus topics are congruent with those used in American Chemical Society (ACS) standardized examination in polymer chemistry. (Author/JN)

  17. Stretched exponential relaxation and ac universality in disordered dielectrics

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    are stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function...

  18. Current Control of Grid Converters Connected with Series AC Capacitor

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang;

    2015-01-01

    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...

  19. Study of ac electrical properties of aluminium-epoxy composites

    Elimat, Z M [Applied Science Department, Ajloun University College, Al-Balqa Applied University, Amman (Jordan); Zihlif, A M [Physics Department, University of Jordan, Amman (Jordan); Ragosta, G [Institute of Chemistry and Polymer Technology (ICTP), CNR-Possouli, Napoli (Italy)], E-mail: adzh@ju.edu.jo

    2008-08-21

    Ac electrical properties of aluminium flakes-epoxy composites were studied as a function of the composition, frequency and temperature. The dielectric constant increased smoothly with an increase in the concentration of aluminium. An increase in the dielectric constant was observed with the temperature as well as with a decrease in the frequency. The observed increase in the values of the dielectric constant with the aluminium concentration was attributed to interfacial polarization. It was found that ac electrical conductivity increases with increasing content of aluminium, temperature and frequency. The observed enhancement in ac conductivity is attributed to the increase in the number of conduction paths created by the aluminium flake contacts in the composite to give a higher electrical conductivity. Also, the activation energy of aluminium flakes-epoxy composites was determined, as well as the values of the dielectric constant. Compared with various theoretical models, Bruggman's formula gives a better fit. The universal power-law model of ac conductivity is observed in epoxy-aluminium composites. The calculated power exponent (about unity) is physically acceptable within this applied model.

  20. Soliton ratchetlike dynamics by ac forces with harmonic mixing

    Salerno, Mario; Zolotaryuk, Yaroslav

    2002-01-01

    The possibility of unidirectional motion of a kink (topological soliton) of a dissipative sine-Gordon equation in the presence of ac forces with harmonic mixing (at least biharmonic) and of zero mean, is presented. The dependence of the kink mean velocity on system parameters is investigated...