WorldWideScience

Sample records for ac backgrounder table

  1. Elementary Statistics Tables

    CERN Document Server

    Neave, Henry R

    2012-01-01

    This book, designed for students taking a basic introductory course in statistical analysis, is far more than just a book of tables. Each table is accompanied by a careful but concise explanation and useful worked examples. Requiring little mathematical background, Elementary Statistics Tables is thus not just a reference book but a positive and user-friendly teaching and learning aid. The new edition contains a new and comprehensive "teach-yourself" section on a simple but powerful approach, now well-known in parts of industry but less so in academia, to analysing and interpreting process dat

  2. AC-DC Power Processor, Type I.

    Science.gov (United States)

    1979-11-01

    output vol taqv S ice the out put rectifiers drop is a 1 arqe percentaote of the output voltate value. F i ure 24 Ows5 the out put impedance of the AC-I)C...65- TABLE XII- AC-DC POWER PROCESSOR TEMPERATURE PROFILE AT 83"F AMBIENT (COMPONENT AND UNIT TEMPERATURES AT END OF 72 HOUR TESI ) T.C. NO. LOCATION

  3. A Table! (At the Table).

    Science.gov (United States)

    Terry, Robert M.

    A review of French dining habits and table manners outlines: elements of the place setting, courtesies used at the table, serving conventions, restaurant tipping, the size and content of the different meals of the day, subtle differences in common foods, restaurant types, menu types, general wine and cheese choices, waiter-client communication,…

  4. Updated MDRIZTAB Parameters for ACS/WFC

    Science.gov (United States)

    Hoffman, S. L.; Avila, R. J.

    2017-03-01

    The Mikulski Archive for Space Telescopes (MAST) pipeline performs geometric distortion corrections, associated image combinations, and cosmic ray rejections with AstroDrizzle. The MDRIZTAB reference table contains a list of relevant parameters that controls this program. This document details our photometric analysis of Advanced Camera for Surveys Wide Field Channel (ACS/WFC) data processed by AstroDrizzle. Based on this analysis, we update the MDRIZTAB table to improve the quality of the drizzled products delivered by MAST.

  5. Scanning table

    CERN Multimedia

    1960-01-01

    Before the invention of wire chambers, particles tracks were analysed on scanning tables like this one. Today, the process is electronic and much faster. Bubble chamber film - currently available - (links can be found below) was used for this analysis of the particle tracks.

  6. TABLE COFFEE

    African Journals Online (AJOL)

    dextroamphetamine with amphetamine and dextroamphetamine are the best known drug treatment for ADHD. 1 However, these drugs are not available in our environment. Caffeine is a psychoactive substance available in table coffee. When consumed in a low to moderate doses, it leads to increased alertness, energy and.

  7. Mathematics Tables

    OpenAIRE

    1998-01-01

    Version 2.6 Initial typesetting: Carroll Wilde Graphics: David Canright Editing: Elle Zimmerman||Contributed for inclusion in Calhoun by Prof. Charles Therrien This booklet provides convenient access to formulas and other data that are frequently used in mathematics courses. If a more comprehensive reference is needed, see, for example, the STANDARD MATHEMATICAL TABLES published by the Chemical Rubber Company, Cleveland, Ohio.

  8. Optical table with embedded active vibration dampers (smart table)

    Science.gov (United States)

    Ryaboy, Vyacheslav M.; Kasturi, Prakash S.; Nastase, Adrian S.; Rigney, Thomas K.

    2005-05-01

    This paper describes the actively damped optical table developed and introduced as a standard product, ST series SmartTable(TM), by Newport Corporation. The active damping system is self-adjusting and robust with respect to changes in payload and vibration environment. It outperforms not only the broadband damped optical tables, but also the top-of-the-line tables equipped with tuned passive vibration absorbers. The maximum resonance vibration amplitudes are reduced about ten times. Additionally, the user has the benefit of being able to monitor and analyze vibration of the table by the conditioned low-noise signals from the embedded vibration sensors. Theoretical background, analysis, design rationale and experimental verification of the system are presented, with emphasis on sensor-actuator pairs architecture, signal processing and adaptive controls.

  9. California Condors AC2 and AC3

    African Journals Online (AJOL)

    AC8 4 Female of the Agua Blanca. Pair, taken into captivity on 6 June. 1986, released at Hopper Ranch on. 28 March 2000, shot by pig hunter on. Tejon Ranch in February 2003. SB#. 12. 4. AC9 - First chick ever seen hatched by the newly formed Condor Research. Center in 1980, captured for captive breeding on 19 April ...

  10. Background Opacities

    NARCIS (Netherlands)

    Kamp, I.; Monier, R.; Smalley, B.; Wahlgren, G.; Stee, Ph.

    2010-01-01

    In NLTE computations of trace elements in stellar atmospheres, background opacities are generally treated in LTE. It is thus important to assess the impact of different methods of including this background opacity on the statistical equilibrium of the trace element and its resulting NLTE abundance.

  11. Background Material

    DEFF Research Database (Denmark)

    Zandersen, Marianne; Hyytiäinen, Kari; Saraiva, Sofia

    This document serves as a background material to the BONUS Pilot Scenario Workshop, which aims to develop harmonised regional storylines of socio-ecological futures in the Baltic Sea region in a collaborative effort together with other BONUS projects and stakeholders.......This document serves as a background material to the BONUS Pilot Scenario Workshop, which aims to develop harmonised regional storylines of socio-ecological futures in the Baltic Sea region in a collaborative effort together with other BONUS projects and stakeholders....

  12. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  13. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  14. NNDSS - Table III. Tuberculosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table III. Tuberculosis - 2017.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  15. NNDSS - Table IV. Tuberculosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2014.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  16. Pension Insurance Data Tables

    Data.gov (United States)

    Pension Benefit Guaranty Corporation — Find out about retirement trends in PBGC's data tables. The tables include statistics on the people and pensions that PBGC protects, including how many Americans are...

  17. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  18. NNDSS - Table IV. Tuberculosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2015.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  19. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  20. NNDSS - Table IV. Tuberculosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2016.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  1. Tabled Execution in Scheme

    Energy Technology Data Exchange (ETDEWEB)

    Willcock, J J; Lumsdaine, A; Quinlan, D J

    2008-08-19

    Tabled execution is a generalization of memorization developed by the logic programming community. It not only saves results from tabled predicates, but also stores the set of currently active calls to them; tabled execution can thus provide meaningful semantics for programs that seemingly contain infinite recursions with the same arguments. In logic programming, tabled execution is used for many purposes, both for improving the efficiency of programs, and making tasks simpler and more direct to express than with normal logic programs. However, tabled execution is only infrequently applied in mainstream functional languages such as Scheme. We demonstrate an elegant implementation of tabled execution in Scheme, using a mix of continuation-passing style and mutable data. We also show the use of tabled execution in Scheme for a problem in formal language and automata theory, demonstrating that tabled execution can be a valuable tool for Scheme users.

  2. Periodic Table of Students.

    Science.gov (United States)

    Johnson, Mike

    1998-01-01

    Presents an exercise in which an eighth-grade science teacher decorated the classroom with a periodic table of students. Student photographs were arranged according to similarities into vertical columns. Students were each assigned an atomic number according to their placement in the table. The table is then used to teach students about…

  3. Table Tennis Club

    CERN Document Server

    Table Tennis Club

    2013-01-01

    Apparently table tennis plays an important role in physics, not so much because physicists are interested in the theory of table tennis ball scattering, but probably because it provides useful breaks from their deep intellectual occupation. It seems that many of the greatest physicists took table tennis very seriously. For instance, Heisenberg could not even bear to lose a game of table tennis, Otto Frisch played a lot of table tennis, and had a table set up in his library, and Niels Bohr apparently beat everybody at table tennis. Therefore, as the CERN Table Tennis Club advertises on a poster for the next CERN Table Tennis Tournament: “if you want to be a great physicist, perhaps you should play table tennis”. Outdoor table at restaurant n° 1 For this reason, and also as part of the campaign launched by the CERN medical service “Move! & Eat better”, to encourage everyone at CERN to take regular exercise, the CERN Table Tennis Club, with the supp...

  4. CERN Table Tennis Club

    CERN Multimedia

    CERN Table Tennis Club

    2014-01-01

    CERN Table Tennis Club Announcing CERN 60th Anniversary Table Tennis Tournament to take place at CERN, from July 1 to July 15, 2014   The CERN Table Tennis Club, reborn in 2008, is encouraging people at CERN to take more regular exercise. This is why the Club, thanks to the strong support of the CERN Staff Association, installed last season a first outdoor table on the terrace of restaurant # 1, and will install another one this season on the terrace of Restaurant # 2. Table tennis provides both physical exercise and friendly social interactions. The CERN Table Tennis club is happy to use the unique opportunity of the 60th CERN anniversary to promote table tennis at CERN, as it is a game that everybody can easily play, regardless of level. Table tennis is particularly well suited for CERN, as many great physicists play table tennis, as you might already know: “Heisenberg could not even bear to lose a game of table tennis”; “Otto Frisch played a lot of table tennis;...

  5. Mortality table construction

    Science.gov (United States)

    Sutawanir

    2015-12-01

    Mortality tables play important role in actuarial studies such as life annuities, premium determination, premium reserve, valuation pension plan, pension funding. Some known mortality tables are CSO mortality table, Indonesian Mortality Table, Bowers mortality table, Japan Mortality table. For actuary applications some tables are constructed with different environment such as single decrement, double decrement, and multiple decrement. There exist two approaches in mortality table construction : mathematics approach and statistical approach. Distribution model and estimation theory are the statistical concepts that are used in mortality table construction. This article aims to discuss the statistical approach in mortality table construction. The distributional assumptions are uniform death distribution (UDD) and constant force (exponential). Moment estimation and maximum likelihood are used to estimate the mortality parameter. Moment estimation methods are easier to manipulate compared to maximum likelihood estimation (mle). However, the complete mortality data are not used in moment estimation method. Maximum likelihood exploited all available information in mortality estimation. Some mle equations are complicated and solved using numerical methods. The article focus on single decrement estimation using moment and maximum likelihood estimation. Some extension to double decrement will introduced. Simple dataset will be used to illustrated the mortality estimation, and mortality table.

  6. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  7. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 5. Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. Research News Volume 5 Issue 5 May 2000 pp 95-100. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/005/05/0095-0100 ...

  8. TABLE TENNIS CLUB

    CERN Multimedia

    TABLE TENNIS CLUB

    2010-01-01

    2010 CERN Table Tennis Tournament The CERN Table Tennis Club organizes its traditional CERN Table Tennis Tournament, at the Meyrin club, 2 rue de livron, in Meyrin, Saturday August 21st, in the afternoon. The tournament is open to all CERN staff, users, visitors and families, including of course summer students. See below for details. In order to register, simply send an E-mail to Jean-Pierre Revol (jean-pierre.revol@cern.ch). You can also download the registration form from the Club Web page (http://www.cern.ch/tabletennis), and send it via internal mail. Photo taken on August 22, 2009 showing some of the participants in the 2nd CERN Table Tennis tournament. INFORMATION ON CERN TABLE TENNIS CLUB CERN used to have a tradition of table tennis activities at CERN. For some reason, at the beginning of the 1980’s, the CERN Table Tennis club merged with the Meyrin Table Tennis club, a member of the Association Genevoise de Tennis de Table (AGTT). Therefore, if you want to practice table tennis, you...

  9. AC/RF Superconductivity

    CERN Document Server

    Ciovati, G.

    2014-07-17

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  10. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  11. Standard Reference Tables -

    Data.gov (United States)

    Department of Transportation — The Standard Reference Tables (SRT) provide consistent reference data for the various applications that support Flight Standards Service (AFS) business processes and...

  12. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Slides

    Science.gov (United States)

    Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Steven P. Ferraro, U.S. Environmental Protection Agency, Newport, OR Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Her...

  13. The Living Periodic Table

    Science.gov (United States)

    Nahlik, Mary Schrodt

    2005-01-01

    To help make the abstract world of chemistry more concrete eighth-grade students, the author has them create a living periodic table that can be displayed in the classroom or hallway. This display includes information about the elements arranged in the traditional periodic table format, but also includes visual real-world representations of the…

  14. Table Tennis Club

    CERN Multimedia

    Table Tennis Club

    2011-01-01

    CERN Table Tennis Tournament Saturday 20th August 2011 at 13.30 at the CERN/Meyrin TT club (underneath the Piscine de Livron, rue de Livron 2, 1217 Meyrin) Details: http://cern.ch/club-TableTennis Registration: jean-pierre.revol@cern.ch Open to all CERN staff, visitors, summer students, and families

  15. Problem Posing with the Multiplication Table

    Science.gov (United States)

    Dickman, Benjamin

    2014-01-01

    Mathematical problem posing is an important skill for teachers of mathematics, and relates readily to mathematical creativity. This article gives a bit of background information on mathematical problem posing, lists further references to connect problem posing and creativity, and then provides 20 problems based on the multiplication table to be…

  16. Empirical yield tables for Wisconsin.

    Science.gov (United States)

    Jerold T. Hahn; Joan M. Stelman

    1989-01-01

    Describes the tables derived from the 1983 Forest Survey of Wisconsin and presents ways the tables can be used. These tables are broken down according to Wisconsin`s five Forest Survey Units and 14 forest types.

  17. Empirical yield tables for Michigan.

    Science.gov (United States)

    Jerold T. Hahn; Joan M. Stelman

    1984-01-01

    Describes the tables derived from the 1980 Forest Survey of Michigan and presents ways the tables can be used. These tables are broken down according to Michigan's four Forest Survey Units, 14 forest types, and 5 site-index classes.

  18. A periodic table of coiled-coil protein structures.

    Science.gov (United States)

    Moutevelis, Efrosini; Woolfson, Derek N

    2009-01-23

    Coiled coils are protein structure domains with two or more alpha-helices packed together via interlacing of side chains known as knob-into-hole packing. We analysed and classified a large set of coiled-coil structures using a combination of automated and manual methods. This led to a systematic classification that we termed a "periodic table of coiled coils," which we have made available at http://coiledcoils.chm.bris.ac.uk/ccplus/search/periodic_table. In this table, coiled-coil assemblies are arranged in columns with increasing numbers of alpha-helices and in rows of increased complexity. The table provides a framework for understanding possibilities in and limits on coiled-coil structures and a basis for future prediction, engineering and design studies.

  19. Decision table languages and systems

    CERN Document Server

    Metzner, John R

    1977-01-01

    ACM Monograph Series: Decision Table Languages and Systems focuses on linguistic examination of decision tables and survey of the features of existing decision table languages and systems. The book first offers information on semiotics, programming language features, and generalization. Discussions focus on semantic broadening, outer language enrichments, generalization of syntax, limitations, implementation improvements, syntactic and semantic features, decision table syntax, semantics of decision table languages, and decision table programming languages. The text then elaborates on design im

  20. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  1. Parallel ac-ac converters using master-slave control

    Science.gov (United States)

    Taufik

    The objective of this study is to develop a parallel ac-ac converter that can be implemented as a means of connecting ac generators in parallel. The most important goal of the parallel converter in this study is to obtain equal current sharing performance among the paralleled generators such that an economically optimal solution for production cost of electricity can be accomplished. At the same time, voltage regulation and stability of the parallel system upon changes of different sizes and load types are to be maintained. Use of the available parallel converter method and voltage inversion technique leads to the formulation of a new solution technique for parallel operation of ac generators. The proposed parallel ac-ac converter involves Sinusoidal Pulse Width Modulation inverter combined with a control scheme called the Stationary Master-Slave control that uses voltage feedback loop and designates one generator unit as the master. The study involves numerous computer simulations to verify the feasibility of the parallel ac-ac converters. In doing so, as many as five models are considered including Current Control Current Source model, PI model, PI-PWM model, PI-PWM model with MOSFETs, and PI-PWM model with real MOSFET model. The results of the simulations show that the parallel ac-ac converter not only successfully provides the current sharing property among the paralleled units but also maintains system stability during changes in load demand. Further research work is suggested to address extensions to parallel ac-dc and dc-ac systems, hardware setup of at least two turbogenerators to test and verify the proposed approach, dynamic analysis to ensure system stability, and implementations of other types of Master-Slave control schemes to improve redundancy.

  2. Tilt Table Test

    Science.gov (United States)

    ... pressure (the bottom number in a blood pressure reading), lowers peripheral vascular resistance, increases your heart rate ... mayoclinic.org/tests-procedures/tilt-table-test/basics/definition/PRC-20019879 . Mayo Clinic Footer Legal Conditions and ...

  3. The Periodic Table CD.

    Science.gov (United States)

    Banks, Alton J.; Holmes, Jon L.

    1995-01-01

    Describes the characteristics of the digitized version of The Periodic Table Videodisc. Provides details about the organization of information and access to the data via Macintosh and Windows computers. (DDR)

  4. Setting the Periodic Table.

    Science.gov (United States)

    Saturnelli, Annette

    1985-01-01

    Examines problems resulting from different forms of the periodic table, indicating that New York State schools use a form reflecting the International Union of Pure and Applied Chemistry's 1984 recommendations. Other formats used and reasons for standardization are discussed. (DH)

  5. Permit.LOA table

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This table includes the effective dates by vessel and permit number for each issued letter of authorization (LOA) by the Permit Office (APSD)

  6. VMS forms Output Tables

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These output tables contain parsed and format validated data from the various VMS forms that are sent from any given vessel, while at sea, from the VMS devices on...

  7. Single-Phase Direct Boost AC-AC Converter

    Directory of Open Access Journals (Sweden)

    URSARU, O.

    2017-11-01

    Full Text Available This paper introduces and studies a boost AC-AC converter circuit that can be used to supply power to the 220V receivers in the 110V grids or to increase and adjust voltage at the end of long lines. High frequency AC-AC converters have better specifications than alternative voltage phase control drives with thyristors or TRIACs. When frequency exceeds 20kHz, noise is eliminated, filters are smaller and efficiency is higher. The current waveform is much better, the output voltage can be higher than the input voltage and voltage control is more accurate.

  8. Les tables de multiplication

    OpenAIRE

    Ghys, Etienne

    2009-01-01

    International audience; Ah ! les tables de multiplication de notre enfance, quels mauvais souvenirs ! (en ce qui me concerne, c'est la table de 7 qui m'a posé des problèmes). Elles nous narguaient sur le dos des cahiers de brouillon... Y aurait-il encore aujourd'hui des mathématiciens qui tenteraient d'en simplifier l'usage ?

  9. AC Electrokinetics: Applications for Nanotechnology

    OpenAIRE

    Hughes, MP

    2000-01-01

    The phenomena of dielectrophoresis and electrorotation, collectively referred to as AC electrokinetics, have been used for many years to study, manipulate and separate particles on the nanotechnology, that is the precise manipulation of particles on the nanometre scale. In this paper we present the principles of AC electrokinetics for particle manipulation, review the current state of AC Electrokinetic techniques for the manipulation of particles on the nanometre scale, and consid...

  10. Empirical yield tables for Minnesota.

    Science.gov (United States)

    Jerold T. Hahn; Gerhard K. Raile

    1982-01-01

    Describes the tables derived from the 1977 Forest Survey of Minnesota and presents examples of how the tables can be used. These tables are broken down according to Minnesota's four Forest Survey Units, 14 forest types, and 5 site index classes. Presents 210 of the 350 possible tables that contained sufficient data to justify publication.

  11. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  12. A Comprehensive Assessment of the Effects of Transgenic Cry1Ac/Cry1Ab Rice Huahui 1 on Adult Micraspis discolor (Fabricius (Coleoptera: Coccinellidae.

    Directory of Open Access Journals (Sweden)

    Xia Zhou

    Full Text Available Micraspis discolor (Fabricius (Coleoptera: Coccinellidae is a widely distributed coleoptera predator in southern Asia in rice ecosystem, and adult M. discolor feed on both rice pollen and soft-bodied arthropods. Bitrophic bioassay and tritrophic bioassay were conducted to evaluate the potential impact of Cry1Ac/Cry1Ab-expressing rice Huahui 1 and its non-transgenic counterpart Minghui 63 on fitness parameters of adult M. discolor. The results showed that the survival, and fecundity of this beetle' adults were not different when they fed on Bt rice or non-Bt rice pollen or Nilaparvata lugens (Stål reared on Bt rice or non-Bt rice. Toxicity assessment to ensure M. discolor adults were not sensitive to Cry1Ab or Cry1Ac protein independent from the pollen background, M. discolor adults were fed with an artificial diet containing Cry1Ac, Cry1Ab or both protein approximately 10 times higher concentration than in Huahui 1 rice pollen. No difference was detected for any of the life-table parameters tested between Cry protein-containing and pure diet. Artificial diet containing E-64 (N-(trans-Epoxysuccinyl-L-leucine 4-guanidinobutylamide was included as a positive control. In contrast, the pre-oviposition and fecundity of M. discolor were significantly adversely affected by feeding on E-64-containing diet. In both bioassays, the uptakes of Cry protein by adult M. discolor were tested by ELISA measurements. These results indicated that adults of M. discolor are not affected by Cry1Ab- or Cry1Ac-expressing rice pollen and are not sensitive to Cry protein at concentrations exceeding the levels in rice pollen in Huahui1. This suggests that M. discolor adults would not be harmed by Cry1Ac/Cry1Ab rice if Bt rice Huahui 1 were commercialized.

  13. A Comprehensive Assessment of the Effects of Transgenic Cry1Ac/Cry1Ab Rice Huahui 1 on Adult Micraspis discolor (Fabricius) (Coleoptera: Coccinellidae).

    Science.gov (United States)

    Zhou, Xia; Guo, Yunling; Kong, Hua; Zuo, Jiao; Huang, Qixing; Jia, Ruizong; Guo, Anping; Xu, Lin

    2016-01-01

    Micraspis discolor (Fabricius) (Coleoptera: Coccinellidae) is a widely distributed coleoptera predator in southern Asia in rice ecosystem, and adult M. discolor feed on both rice pollen and soft-bodied arthropods. Bitrophic bioassay and tritrophic bioassay were conducted to evaluate the potential impact of Cry1Ac/Cry1Ab-expressing rice Huahui 1 and its non-transgenic counterpart Minghui 63 on fitness parameters of adult M. discolor. The results showed that the survival, and fecundity of this beetle' adults were not different when they fed on Bt rice or non-Bt rice pollen or Nilaparvata lugens (Stål) reared on Bt rice or non-Bt rice. Toxicity assessment to ensure M. discolor adults were not sensitive to Cry1Ab or Cry1Ac protein independent from the pollen background, M. discolor adults were fed with an artificial diet containing Cry1Ac, Cry1Ab or both protein approximately 10 times higher concentration than in Huahui 1 rice pollen. No difference was detected for any of the life-table parameters tested between Cry protein-containing and pure diet. Artificial diet containing E-64 (N-(trans-Epoxysuccinyl)-L-leucine 4-guanidinobutylamide) was included as a positive control. In contrast, the pre-oviposition and fecundity of M. discolor were significantly adversely affected by feeding on E-64-containing diet. In both bioassays, the uptakes of Cry protein by adult M. discolor were tested by ELISA measurements. These results indicated that adults of M. discolor are not affected by Cry1Ab- or Cry1Ac-expressing rice pollen and are not sensitive to Cry protein at concentrations exceeding the levels in rice pollen in Huahui1. This suggests that M. discolor adults would not be harmed by Cry1Ac/Cry1Ab rice if Bt rice Huahui 1 were commercialized.

  14. Electricity-AC versus DC

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  15. TABLE OF CONTENTS

    African Journals Online (AJOL)

    Mariana Ciacciariello

    Keywords: Broiler breeder, photostimulation, growth curve, sexual maturity, egg production. #Corresponding author. E-mail: gous@ukzn.ac.za. Introduction. Reproductive problems in broiler breeder females are often attributed to the intense selection pressure for weight and feed conversion, which has been carried out in ...

  16. Table Tennis Club

    CERN Multimedia

    Table Tennis Club

    2012-01-01

    The CERN Table Tennis club and the Meyrin CTT are organizing two Table Tennis workshops from 2 to 6 July and from 20 to 24 August 2012 inclusive in Meyrin. A professional would be with your children from 14.00 pm to 18.00 pm: an instructor J + S category A. Training courses with specific themes, individual courses would be given depending on the level of the child’s game, “discoveries –table tennis games” courses and games with the robot. Other activities (stretching, relaxation). Afternoons (from 18 to 20 children): 40 CHF per workshop and per child. Evenings (from 18 to 20 adults): 60 CHF per workshop and per adult. For further information, please contact Mr. Monteil : Mobile: (+33) 06 61 31 70 47 E-mail: wilfried.monteil@free.fr.

  17. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  18. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  19. The Dynamic Force Table

    Science.gov (United States)

    Geddes, John B.; Black, Kelly

    2008-01-01

    We examine an experimental apparatus that is used to motivate the connections between the basic properties of vectors, potential functions, systems of nonlinear equations, and Newton's method for nonlinear systems of equations. The apparatus is an adaptation of a force table where we remove the center-pin and allow the center-ring to move freely.…

  20. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  1. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  2. Differential expression of CD300a/c on human TH1 and TH17 cells

    Directory of Open Access Journals (Sweden)

    Borrego Francisco

    2011-11-01

    Full Text Available Abstract Background Human memory CD4+ T cells can be either CD300a/c+ or CD300a/c- and subsequent analyses showed that CD4+ effector memory T (TEM cells are mostly CD300a/c+, whereas CD4+ central memory T (TCM cells have similar frequencies of CD300a/c+ and CD300a/c- cells. Results Extensive phenotypical and functional characterization showed that in both TCM and TEM cells, the CD300a/c+ subset contained a higher number of TH1 (IFN-γ producing cells. Alternatively, TH17 (IL-17a producing cells tend to be CD300a/c-, especially in the TEM subset. Further characterization of the IL-17a+ cells showed that cells that produce only this cytokine are mostly CD300a/c-, while cells that produce IL-17a in combination with other cytokines, especially IFN-γ, are mostly CD300a/c+, indicating that the expression of this receptor is associated with cells that produce IFN-γ. Co-ligation of the TCR and CD300a/c in CD4+ T cells inhibited Ca2+ mobilization evoked by TCR ligation alone and modulated IFN-γ production on TH1 polarized cells. Conclusion We conclude that the CD300a/c receptors are differentially expressed on human TH1 and TH17 cells and that their ligation is capable of modulating TCR mediated signals.

  3. Are BVS suitable for ACS patients? Support from a large single center real live registry

    NARCIS (Netherlands)

    C. Felix (Cordula); Y. Onuma (Yoshinobu); J.M. Fam (Jiang Ming); R. Diletti (Roberto); Y. Ishibashi (Yuki); A. Karanasos (Antonios); B. Everaert (Bert); N.M. van Mieghem (Nicolas); J. Daemen (Joost); P.P.T. de Jaegere (Peter); F. Zijlstra (Felix); E.S. Regar (Eveline); R.J.M. van Geuns (Robert Jan)

    2016-01-01

    textabstractObjectives To investigate one-year outcomes after implantation of a bioresorbable vascular scaffold (BVS) in patients presenting with acute coronary syndrome (ACS) compared to stable angina patients. Background Robust data on the outcome of BVS in the setting of ACS is still scarce.

  4. Global Reference Tables Services Architecture

    Data.gov (United States)

    Social Security Administration — This database stores the reference and transactional data used to provide a data-driven service access method to certain Global Reference Table (GRT) service tables.

  5. A Parallel Compact Hash Table

    NARCIS (Netherlands)

    van der Vegt, Steven; Laarman, Alfons; Vojnar, Tomas

    2011-01-01

    We present the first parallel compact hash table algorithm. It delivers high performance and scalability due to its dynamic region-based locking scheme with only a fraction of the memory requirements of a regular hash table.

  6. Building Background Knowledge

    Science.gov (United States)

    Neuman, Susan B.; Kaefer, Tanya; Pinkham, Ashley

    2014-01-01

    This article make a case for the importance of background knowledge in children's comprehension. It suggests that differences in background knowledge may account for differences in understanding text for low- and middle-income children. It then describes strategies for building background knowledge in the age of common core standards.

  7. Empirical yield tables for Wisconsin.

    Science.gov (United States)

    Burton L. Essex; Jerold T. Hahn

    1976-01-01

    Describes the tables derived from the 1968 forest survey of Wisconsin. These tables are broken down according to Wisconsin's 5 Forest Survey Units, 12 forest types, and 5 site index classes. Presents 18 tables as examples of the more than 500 that can be ordered by using the order form enclosed in the publication.

  8. Table Tennis Club

    CERN Multimedia

    Table Tennis Club

    2012-01-01

    2012 CERN Table Tennis Tournament As the campaign launched by the CERN medical service “Move! & Eat better” is designed in particular to encourage people at CERN to take more regular exercise, the CERN Table Tennis Club, with its traditional CERN Table Tennis Tournament is providing an excellent opportunity to practice moving. The tournament will take place at the Meyrin CTT, 2 rue de Livron, Saturday August 25, 2012, in the afternoon (starting at 13:30). It is open to all CERN staff, users, visitors and families, including of course summer students, who are strongly encouraged to participate. In order to register, simply send an E-mail to Jean-Pierre Revol (jean-pierre.revol@cern.ch). You may also find useful information on the Club Web page http://www.cern.ch/tabletennis CERN 2011 champion Savitha Flaecher, between the finalist Bertrand Mouches on her left, the winner of the consolation draw on her right (Sudarshan Paramesvaran), and far left, Denis Moriaud (semi-finalist a...

  9. Pyrolysis of Table Sugar

    Directory of Open Access Journals (Sweden)

    Adnan Bulut

    2013-01-01

    Full Text Available Table sugars were pyrolyzed at different temperatures (300, 400, and 500°C in a fixed-bed reactor. The effect of pyrolysis temperature on yields of liquid, solid, and gaseous products was investigated. As expected the yield of liquid products gradually increased and the yield of solid products gradually decreased when the pyrolysis temperature was raised. The yield of liquid products was greatest (52 wt% at 500°C. The composition of bio-oils extracted with diethyl ether was identified by means of gas chromatography mass spectrometry (GC-MS, nuclear magnetic resonance (1H-NMR, and Fourier transform infrared spectroscopy (FTIR. The following compounds were observed in bio-oils produced from the pyrolysis of table sugar at 500°C: 1,4:3,6-dianhydro-α-d-glucopyranose, 5-(hydroxymethyl furfural, 5-acetoxymethyl-2-furaldehyde, and cyclotetradecane liquid product. The relative concentration of 5-(hydroxymethyl furfural was the highest in bio-oils obtained from pyrolysis of table sugars at 500°C.

  10. Kepler Certified False Positive Table

    Science.gov (United States)

    Bryson, Stephen T.; Batalha, Natalie Marie; Colon, Knicole Dawn; Coughlin, Jeffrey Langer; Haas, Michael R.; Henze, Chris; Huber, Daniel; Morton, Tim; Rowe, Jason Frank; Mullally, Susan Elizabeth; hide

    2017-01-01

    This document describes the Kepler Certied False Positive table hosted at the Exoplanet Archive1, herein referred to as the CFP table. This table is the result of detailed examination by the Kepler False Positive Working Group (FPWG) of declared false positives in the Kepler Object of Interest (KOI) tables (see, for example, Batalha et al. (2012); Burke et al.(2014); Rowe et al. (2015); Mullally et al. (2015); Coughlin et al. (2015b)) at the Exoplanet Archive. A KOI is considered a false positive if it is not due to a planet orbiting the KOI's target star. The CFP table contains all KOIs in the Exoplanet Archive cumulative KOI table. The purpose of the CFP table is to provide a list of certified false positive KOIs. A KOI is certified as a false positive when, in the judgement of the FPWG, there is no plausible planetary interpretation of the observational evidence, which we summarize by saying that the evidence for a false positive is compelling. This certification process involves detailed examination using all available data for each KOI, establishing a high-reliability ground truth set. The CFP table can be used to estimate the reliability of, for example, the KOI tables which are created using only Kepler photometric data, so the disposition of individual KOIs may differ in the KOI and CFP tables. Follow-up observers may find the CFP table useful to avoid observing false positives.

  11. VVCF AC-AC Converters Using Single Bridge Circuit

    Science.gov (United States)

    Neba, Yasuhiko; Matsumoto, Hirokazu; Itoh, Ryozo; Ishizaka, Kouichi

    Single-phase and three-phase voltage source converters with variable voltage and constant frequency ac-ac conversion are presented. These converters are a single bridge circuit of two legs for single-phase conversion and of three legs for three-phase, respectively. Both the power source and the load are connected to bridge legs. The normal PWM methods with the sinusoidal modulating and the triangular carrier waves are used for the converters. The experimental results confirm that the PWM converters can generate the sinusoidal input/output currents.

  12. Table 1 Experimental diets

    African Journals Online (AJOL)

    Francois Siebrits

    Cis fatty acids. 77.71. 70.63. Omega 3 fatty acids. 2.28. 2.12. Omega 6 fatty acids. 0.00. 0.00. C14 fatty acids. 0.11. 0.18. C16 fatty acids. 14.49. 15.17. C18 fatty acids. 82.29. 80.66. Table 2 Summary of fatty acids (% of total fatty acids) of sheep back fat (mean ± s.d.). Extracted SFOC. & lipoic acid. Extracted SFOC. Saponified.

  13. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  14. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  15. AcEST: BP920378 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Actin OS=Histriculus cavicola PE=3 SV=2 55 1e-07 sp|P26182|ACT_ACHBI Actin OS=Ac...V=1 55 1e-07 sp|P17128|ACT_KLULA Actin OS=Kluyveromyces lactis GN=ACT PE=3 SV=2 55 1e-07 sp|O00937|ACT_HISCA

  16. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  17. AcEST: BP921278 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ac... 30 2.9 sp|Q01042|IE68_SHV21 Immediate-early protein OS=Saimiriine herpe... 30 2.9 sp|Q8CFW7|C2D2A_MOUS...PSPAPSLEES---HRPGSQTSSHPSSSVSSSPSQMDHHSE 418 >sp|Q01042|IE68_SHV21 Immediate-earl

  18. Cadmium-induced ethylene production and responses in Arabidopsis thaliana rely on ACS2 and ACS6 gene expression

    Science.gov (United States)

    2014-01-01

    Background Anthropogenic activities cause metal pollution worldwide. Plants can absorb and accumulate these metals through their root system, inducing stress as a result of excess metal concentrations inside the plant. Ethylene is a regulator of multiple plant processes, and is affected by many biotic and abiotic stresses. Increased ethylene levels have been observed after exposure to excess metals but it remains unclear how the increased ethylene levels are achieved at the molecular level. In this study, the effects of cadmium (Cd) exposure on the production of ethylene and its precursor 1-aminocyclopropane-1-carboxylic acid (ACC), and on the expression of the ACC Synthase (ACS) and ACC Oxidase (ACO) multigene families were investigated in Arabidopsis thaliana. Results Increased ethylene release after Cd exposure was directly measurable in a system using rockwool-cultivated plants; enhanced levels of the ethylene precursor ACC together with higher mRNA levels of ethylene responsive genes: ACO2, ETR2 and ERF1 also indicated increased ethylene production in hydroponic culture. Regarding underlying mechanisms, it was found that the transcript levels of ACO2 and ACO4, the most abundantly expressed members of the ACO multigene family, were increased upon Cd exposure. ACC synthesis is the rate-limiting step in ethylene biosynthesis, and transcript levels of both ACS2 and ACS6 showed the highest increase and became the most abundant isoforms after Cd exposure, suggesting their importance in the Cd-induced increase of ethylene production. Conclusions Cadmium induced the biosynthesis of ACC and ethylene in Arabidopsis thaliana plants mainly via the increased expression of ACS2 and ACS6. This was confirmed in the acs2-1acs6-1 double knockout mutants, which showed a decreased ethylene production, positively affecting leaf biomass and resulting in a delayed induction of ethylene responsive gene expressions without significant differences in Cd contents between wild-type and

  19. Cosmogenic Backgrounds to 0{\

    CERN Document Server

    :,; Auty, D J; Barbeau, P S; Beck, D; Belov, V; Breidenbach, M; Brunner, T; Burenkov, A; Cao, G F; Chambers, C; Cleveland, B; Coon, M; Craycraft, A; Daniels, T; Danilov, M; Daugherty, S J; Davis, J; Delaquis, S; Der Mesrobian-Kabakian, A; DeVoe, R; Didberidze, T; Dilling, J; Dolgolenko, A; Dolinski, M J; Dunford, M; Fairbank, W; Farine, J; Feldmeier, W; Feyzbakhsh, S; Fierlinger, P; Fudenberg, D; Gornea, R; Graham, K; Gratta, G; Hall, C; Herrin, S; Hughes, M; Jewell, M J; Johnson, A; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krücken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Mong, B; Moore, D; Njoya, O; Nelson, R; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Prescott, C Y; Retière, F; Rowson, P C; Russell, J J; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Tsang, R; Twelker, K; Vuilleumier, J -L; Waite, A; Walton, J; Walton, T; Weber, M; Wen, L J; Wichoski, U; Wood, J; Yang, L; Yen, Y -R; Zeldovich, O Ya

    2015-01-01

    As neutrinoless double-beta decay experiments become more sensitive and intrinsic radioactivity in detector materials is reduced, previously minor contributions to the background must be understood and eliminated. With this in mind, cosmogenic backgrounds have been studied with the EXO-200 experiment. Using the EXO-200 TPC, the muon flux (through a flat horizontal surface) underground at the Waste Isolation Pilot Plant (WIPP) has been measured to be {\\Phi} = 4.07 $\\pm$ 0.14 (sys) $\\pm$ 0.03 (stat) $\\times$ $10^{-7}$cm$^{-2}$ s$^{-1}$, with a vertical intensity of $I_{v}$ = 2.97$^{+0.14}_{-0.13}$ (sys) $\\pm$ 0.02 (stat) $\\times$ $10^{-7}$cm$^{-2}$ s$^{-1}$ sr$^{-1}$. Simulations of muon-induced backgrounds identified several potential cosmogenic radionuclides, though only 137Xe is a significant background for the 136Xe 0{\

  20. The Cosmic Microwave Background

    Science.gov (United States)

    Pierpaoli, E.

    2011-03-01

    In these lectures I present the physical aspects of the Cosmic Microwave Background primary and secondary anisotropies; the characteristics of the CMB power spectra and their dependence on cosmological parameters. I also discuss the observational status and future perspectives.

  1. Zambia Country Background Report

    DEFF Research Database (Denmark)

    Hampwaye, Godfrey; Jeppesen, Søren; Kragelund, Peter

    This paper provides background data and general information for the Zambia studies focusing on local food processing sub­‐sector; and the local suppliers to the mines as part of the SAFIC project (Successful African Firms and Institutional Change).......This paper provides background data and general information for the Zambia studies focusing on local food processing sub­‐sector; and the local suppliers to the mines as part of the SAFIC project (Successful African Firms and Institutional Change)....

  2. Background Studies for EXIST

    Science.gov (United States)

    Wilson, Colleen A.; Pendleton, G. N.; Fishman, G. J.

    2004-01-01

    We present results from a study of the trapped proton and electron background for several orbital inclinations and altitudes. This study includes time dependent effects. In addition we describe a 3 component cosmic background model developed at the University of Southampton, UK. The three components are cosmic diffuse gamma rays, atmospheric albedo gamma rays, and cosmic ray protons. We present examples of how this model was applied to BATSE and discuss its application to EXIST.

  3. STIMULATION OF RENIN SECRETION BY CATECHOLAMINES IS DEPENDENT ON ADENYLYL CYCLASES AC5 AND AC6

    Science.gov (United States)

    Aldehni, Fadi; Tang, Tong; Madsen, Kirsten; Plattner, Michael; Schreiber, Andrea; Friis, Ulla G.; Hammond, H. Kirk; Han, Pyung Lim; Schweda, Frank

    2011-01-01

    The sympathetic nervous system stimulates renin release from juxtaglomerular cells via the ß-adrenoreceptor - cAMP pathway. Recent in vitro studies have suggested that the calcium-inhibited adenylyl cyclases AC5 and AC6 possess key roles in the control of renin exocytosis. In order to investigate the relative contribution of AC5 and AC6 to the regulation of renin release in vivo we performed experiments using AC5 and AC6 knockout mice. Male AC5−/− mice exhibited normal plasma renin concentrations (PRC), renal renin synthesis (mRNA and renin content), urinary volume and systolic blood pressure. In male AC6−/− mice, PRC (AC6−/−: 732 ± 119, AC6 +/+: 436 ± 78 ng angI/h*ml, p renin synthesis were stimulated associated with an increased excretion of dilute urine (1.55-fold, p renin release from isolated perfused kidneys were attenuated to a higher extent in AC6−/− (−51 to −98% vs. AC6+/+) than in AC5−/− (−31 to 46% vs. AC5+/+). In conclusion, both AC5 and AC6 are involved in the stimulation of renin secretion in vivo, and AC6 is the dominant isoforms in this process. PMID:21282557

  4. AcEST: DK955839 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Heat shock protein 70 OS=Cucumis sativus ... 320 3e-86 tr|Q8GSN4|Q8GSN4_CUCMA Non-cell-autonomous... MVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMR 174 >tr|Q8GSN3|Q8GSN3_CUCMA Non-cell-autonomous heat sho...3|Q8GSN3_CUCMA Non-cell-autonomous heat shock cognate pr... 324 3e-87 tr|Q67BD0|Q67BD0_TOBAC Heat shock prot...iva subs... 324 2e-87 tr|B8AC06|B8AC06_ORYSI Putative uncharacterized protein OS=Oryza... 324 2e-87 tr|Q8GSN

  5. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    The proposed DPFM can be used for AC low voltage (LV) autonomous microgrid systems with added advantages of remedying the dependency on voltage level and R/X ratio in the formulation itself. DPFM is applied on a 10 bus, low voltage, microgrid system giving a better voltage profile.. Keywords: Microgrid (MG) ...

  6. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  7. Exploring String Theory Backgrounds

    CERN Document Server

    Williams, B P

    2004-01-01

    This thesis examines phenomenological and theoretical questions by exploring string theoretic backgrounds. Part I focuses on cosmology. First we propose that the induced metric along a brane moving through a curved bulk may be interpreted as the cosmology of the brane universe, providing a resolution to the apparent cosmological singularity on the brane. We then look at various decay channels of the certain meta-stable de Sitter vacua and show that there exist NS5-brane meditated decays which are much faster than decays to decompactification. Part II discusses a new class of nongeometric vacua in string theory. These backgrounds may be described locally as T2 fibrations. By enlarging the monodromy group of the fiber to include perturbative stringy duality symmetries we are able to explicitly construct nongeometric backgrounds.

  8. Cosmic Tachyon Background Radiation

    CERN Document Server

    Tomaschitz, R

    1999-01-01

    The equilibrium statistical mechanics of a background radiation of superluminal particles is investigated, based on a vectorial wave equation for tachyons of the Proca type. The partition function, the spectral energy density, and the various thermodynamic variables of an ideal Bose gas of tachyons in an open Robertson-Walker cosmology are derived. The negative mass square in the wave equation changes the frequency scaling in the Rayleigh-Jeans law, and there are also significant changes in the low temperature regime as compared to the microwave background, in particular in the caloric and thermal equations of state.

  9. The Cosmic Background Explorer

    Science.gov (United States)

    Gulkis, Samuel; Lubin, Philip M.; Meyer, Stephan S.; Silverberg, Robert F.

    1990-01-01

    The Cosmic Background Explorer (CBE), NASA's cosmological satellite which will observe a radiative relic of the big bang, is discussed. The major questions connected to the big bang theory which may be clarified using the CBE are reviewed. The satellite instruments and experiments are described, including the Differential Microwave Radiometer, which measures the difference between microwave radiation emitted from two points on the sky, the Far-Infrared Absolute Spectrophotometer, which compares the spectrum of radiation from the sky at wavelengths from 100 microns to one cm with that from an internal blackbody, and the Diffuse Infrared Background Experiment, which searches for the radiation from the earliest generation of stars.

  10. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  11. Background neutron in the endcap and barrel regions of resistive ...

    Indian Academy of Sciences (India)

    Resistive plate chamber; background radiation; Monte Carlo simulation. PACS Nos 29.40. ... the RPC double-gap tri-dimensional geometry by means of GEANT4 Monte Carlo code. 378. Pramana – J. Phys. ..... [10] D E Cullen and S M Seltzer, Tables and graphs of electron interaction cross-sections from 10 eV to 100 GeV ...

  12. MCNPX Model/Table Comparison

    CERN Document Server

    Hendricks, J S

    2003-01-01

    MCNPX is a Monte Carlo N-Particle radiation transport code extending the capabilities of MCNP4C. As with MCNP, MCNPX uses nuclear data tables to transport neutrons, photons, and electrons. Unlike MCNP, MCNPX also uses (1) nuclear data tables to transport protons; (2) physics models to transport 30 additional particle types (deuterons, tritons, alphas, pions, muons, etc.); and (3) physics models to transport neutrons and protons when no tabular data are available or when the data are above the energy range (20 to 150 MeV) where the data tables end. MCNPX can mix and match data tables and physics models throughout a problem. For example, MCNPX can model neutron transport in a bismuth germinate (BGO) particle detector by using data tables for bismuth and oxygen and using physics models for germanium. Also, MCNPX can model neutron transport in UO sub 2 , making the best use of physics models and data tables: below 20 MeV, data tables are used; above 150 MeV, physics models are used; between 20 and 150 MeV, data t...

  13. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  14. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  15. Cosmic Microwave Background Anisotropies

    OpenAIRE

    Hu, Wayne; Dodelson,Scott

    2001-01-01

    Cosmic microwave background (CMB) temperature anisotropies have and will continue to revolutionize our understanding of cosmology. The recent discovery of the previously predicted acoustic peaks in the power spectrum has established a working cosmological model: a critical density universe consisting of mainly dark matter and dark energy, which formed its structure through gravitational instability from quantum fluctuations during an inflationary epoch. Future observations should test this mo...

  16. Sri Lanka; Background Papers

    OpenAIRE

    International Monetary Fund

    1995-01-01

    This Background Paper on Sri Lanka provides information on the economic developments during 1992–95. Developments in the domestic and external sectors are discussed. The deficiencies of the official consumer price index that resulted in a substantial understatement of inflation performance in 1994 and alternative estimates of underlying inflation are described. The structural rigidities in the labor market that perpetuate high unemployment and limit job growth are also described. The paper al...

  17. JDBC Driver for AIPS++ Tables

    Science.gov (United States)

    Ye, J.; Young, W. K.; Waters, B.

    2005-12-01

    Integrating Java with AIPS++ can provide many advantages that cannot be realized with AIPS++ alone. Beyond simplifying architecture and code, use of Java in astronomical processing is promising because of its standardized nature, widely available tool packages and its exceptional GUI rendering abilities. We have implemented a Java Database Connectivity (JDBC) driver for the AIPS++ table system. This allows us to use the Table Query Language (TaQL), which is similar to SQL, to query and manipulate the database from Java and provides a standard interface between the AIPS++ table system and future Java applications.

  18. The Periodic Table in Croatia

    Directory of Open Access Journals (Sweden)

    Raos, N.

    2011-12-01

    Full Text Available The Croatian (Yugoslav Academy of Sciences and Arts was the first academy to elect D. I. Mendeleev as its honorary member (1882, whereas the periodic table of the elements has been taught regularly at the Zagreb University since 1888. The early interest of Croatian chemists in the periodic table should be attributed primarily to their pan-Slavic attitude, particularly as proof that Slavic people were able to produce "their own Newtons" (M. V. Lomonosov and D. I. Mendeleev. Such enthusiastic views, however, did not help in analyzing the contribution of Mendeleev and other scientists to the discovery and development of the periodic table of the elements.

  19. AcEST: DK949342 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 31 ACYNCGESGHLARDCPSE 84 AC+NCGESGH A DCP++ Sbjct: 741 A...270 Score = 37.0 bits (84), Expect = 0.030 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame...= 36.6 bits (83), Expect = 0.040 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 34 CYNC... (79), Expect = 0.12 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 34 CYNCGESGHLARDCPS...6 (62%), Positives = 15/16 (93%) Frame = +1 Query: 34 CYNCGESGHLARDCPS 81 CY CG++GH++RDCP+ Sbjct: 170 CYKCGD

  20. The redoubtable ecological periodic table

    Science.gov (United States)

    Ecological periodic tables are repositories of reliable information on quantitative, predictably recurring (periodic) habitat–community patterns and their uncertainty, scaling and transferability. Their reliability derives from their grounding in sound ecological principle...

  1. The Table Mountain Field Site

    Data.gov (United States)

    Federal Laboratory Consortium — The Table Mountain Field Site, located north of Boulder, Colorado, is designated as an area where the magnitude of strong, external signals is restricted (by State...

  2. Table 1: Biofuels simulation scenarios

    Data.gov (United States)

    U.S. Environmental Protection Agency — A spreadsheet containing information used to generate Table 1. Agricultural Market sector results presented in the spreadsheet were generated elsewhere (non-EPA) and...

  3. Family Background and Entrepreneurship

    DEFF Research Database (Denmark)

    Lindquist, Matthew J.; Sol, Joeri; Van Praag, Mirjam

    Vast amounts of money are currently being spent on policies aimed at promoting entrepreneurship. The success of such policies, however, rests in part on the assumption that individuals are not ‘born entrepreneurs’. In this paper, we assess the importance of family background and neighborhood...... treatment within families by gender and birth order does little to further increase our estimates of the importance of family-wide factors. We then go on to show that neighborhood effects, sibling peer effects, and parental income and education explain very little of these correlations. Parental...

  4. Background and introduction

    DEFF Research Database (Denmark)

    Jensen, Per Anker; van der Voordt, Theo; Coenen, Christian

    2012-01-01

    Purpose: To explain the purpose and background of this book and introduce the three basic perspectives behind the research presented as well as the structure and editing process of the book. Methodology: The editors shared and discussed individual contributions to this chapter, based on their own...... behind the scenes of the making of this book and connects contributions from three different fields - FM, CREM, and B2B marketing - to shed more light on the concept of added value of FM. It serves as an introduction to the research presented in the other chapters in this book....

  5. Cosmic Background Radiation

    Science.gov (United States)

    Sidharth, B. G.; Valluri, S. R.

    2015-08-01

    It is shown that a collection of photons with nearly the same frequency exhibits a "condensation" type of phenomenon corresponding to a peak intensity. The observed cosmic background radiation can be explained from this standpoint. We have obtained analogous results by extremization of the occupation number for photons with the use of the Lambert W function. Some of the interesting applications of this function are briefly discussed in the context of graphene which exhibits an interesting two dimensional structure with several characteristic properties and diverse practical applications.

  6. Malaysia; Background Paper

    OpenAIRE

    International Monetary Fund

    1996-01-01

    This Background Paper on Malaysia examines developments and trends in the labor market since the mid-1980s. The paper describes the changes in the employment structure and the labor force. It reviews wages and productivity trends and their effects on unit labor cost. The paper highlights that Malaysia’s rapid growth, sustained since 1987, has had a major impact on the labor market. The paper outlines the major policy measures to address the labor constraints. It also analyzes Malaysia’s recen...

  7. A comprehensive assessment of the effects of Bt cotton on Coleomegilla maculata demonstrates no detrimental effects by Cry1Ac and Cry2Ab.

    Directory of Open Access Journals (Sweden)

    Yunhe Li

    Full Text Available The ladybird beetle, Coleomegilla maculata (DeGeer, is a common and abundant predator in many cropping systems. Its larvae and adults are predaceous, feeding on aphids, thrips, lepidopteran larvae and plant tissues, such as pollen. Therefore, this species is exposed to insecticidal proteins expressed in insect-resistant, genetically engineered cotton expressing Cry proteins derived from Bacillus thuringiensis (Bt. A tritrophic bioassay was conduced to evaluate the potential impact of Cry2Ab- and Cry1Ac-expressing cotton on fitness parameters of C. maculata using Bt-susceptible and -resistant larvae of Trichoplusia ni as prey. Coleomegilla maculata survival, development time, adult weight and fecundity were not different when they were fed with resistant T. ni larvae reared on either Bt or control cotton. To ensure that C. maculata were not sensitive to the tested Cry toxins independent from the plant background and to add certainty to the hazard assessment, C. maculata larvae were fed artificial diet incorporated with Cry2Ab, Cry1Ac or both at >10 times higher concentrations than in cotton tissue. Artificial diet containing E-64 was included as a positive control. No differences were detected in any life-table parameters between Cry protein-containing diet treatments and the control diet. In contrast, larvae of C. maculata fed the E-64 could not develop to the pupal stage and the 7-d larval weight was significantly negatively affected. In both feeding assays, the stability and bioactivity of Cry proteins in the food sources were confirmed by ELISA and sensitive-insect bioassays. Our results show that C. maculata is not affected by Bt cotton and is not sensitive to Cry2Ab and Cry1Ac at concentrations exceeding the levels in Bt cotton, thus demonstrating that Bt cotton will pose a negligible risk to C. maculata. More importantly, this study demonstrates a comprehensive system for assessing the risk of genetically modified plants on non

  8. Improving the Reading Comprehension Skills of Minority Adults from Educationally Disadvantaged Backgrounds

    Science.gov (United States)

    Paul, Gina; Verhulst, Steve

    2010-01-01

    This article presents a synergistic reading comprehension program to help minority adults from educationally disadvantaged backgrounds improve their reading skills in preparation for academics, standardized testing, and medical school. (Contains 3 tables and 1 figure.)

  9. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats

    Science.gov (United States)

    Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Hertzsprung-Russell diagram are iconic information organizing systems because they are simple, easy to understand, exceptionally useful, and they foster the expansion of sc...

  10. AC electrothermal technique in microchannels

    Science.gov (United States)

    Salari, Alinaghi; Navi, Maryam; Dalton, Colin

    2017-02-01

    Electrokinetic techniques have a wide range of applications in droplet, particle, and fluid manipulation systems. In general, they can be categorized into different subgroups including electroosmosis, electrothermal, electrophoresis, dielectrophoresis, etc. The AC electrothermal (ACET) technique has been shown to be very effective in applications which involve high conductivity fluids, such as blood, which are typically used in biomedical applications. In the past few years, the ACET effect has received considerable attention. Unlike AC electroosmosis (ACEO), the ACET effect shows plateaus in force in a wide frequency range. In other words, with electrothermal force, velocity is more steady and predictable at different frequencies, compared to ACEO and dielectrophoresis (DEP). Although electrothermal microflows form as a result of Joule heating in the fluid, due to high conduction of heat to the ambience, the temperature rise in the fluid is not so high as to threaten the nature of the biofluids. The average temperature rise resulting from the ACET effect is below 5 °K. In order to generate high strength AC electric fields, microfabricated electrode arrays are commonly used in microchannels. For pumping applications, it is essential to create asymmetry in the electric field, typically by having asymmetrical electrode pairs. There is no defined border between many electrokinetic techniques, and as such the point where electrothermal processes interferes with other electrokinetic techniques is not clear in the literature. In addition, there have been comprehensive reviews on micropumps, electrokinetics, and their subcategories, but the literature lacks a detailed up-to-date review on electrothermal microdevices. In this paper, a brief review is made specifically on electric fields in ACET devices, in order to provide an insight for the reader about the importance of this aspect of ACET devices and the improvements made to date.

  11. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  12. Holographic Hall conductivities from dyonic backgrounds

    Energy Technology Data Exchange (ETDEWEB)

    Lindgren, Jonathan [Theoretische Natuurkunde, Vrije Universiteit Brussel and International Solvay Institutes,Pleinlaan 2, B-1050 Brussels (Belgium); Physique Théorique et Mathématique, Université Libre de Bruxelles,Campus Plaine C.P. 231, B-1050 Bruxelles (Belgium); Papadimitriou, Ioannis [SISSA and INFN - Sezione di Trieste,Via Bonomea 265, I 34136 Trieste (Italy); Taliotis, Anastasios; Vanhoof, Joris [Theoretische Natuurkunde, Vrije Universiteit Brussel and International Solvay Institutes,Pleinlaan 2, B-1050 Brussels (Belgium)

    2015-07-20

    We develop a general framework for computing the holographic 2-point functions and the corresponding conductivities in asymptotically locally AdS backgrounds with an electric charge density, a constant magentic field, and possibly non-trivial scalar profiles, for a broad class of Einstein-Maxwell-Axion-Dilaton theories, including certain Chern-Simons terms. Holographic renormalization is carried out for any theory in this class and the computation of the renormalized AC conductivities at zero spatial momentum is reduced to solving a single decoupled first order Riccati equation. Moreover, we develop a first order fake supergravity formulalism for dyonic renormalization group flows in four dimensions, allowing us to construct analytically infinite families of such backgrounds by specifying a superpotential at will. These RG flows interpolate between AdS{sub 4} in the UV and a hyperscaling violating Lifshitz geometry in the IR with exponents 1background, both in the context of AdS/CMT and AdS/QCD.

  13. New table grapes in turkey

    Directory of Open Access Journals (Sweden)

    Atak A.

    2014-01-01

    Full Text Available Table grape consumption is increasing day by day all around the world. New varieties are derived from breeding programs in different countries around the world. Breeding programs in particular are shaped in accordance with the demands of consumers. Especially in recent years, the demands increased for cultivars of table grapes with large berry and maturation at different times, in Turkey as well as in the world market. Also, new cultivars which are tolerant to fungal diseases, late-season and can be stored for a long time had much demand in recent years. For this purpose, new table grapes with these characteristics have been developed by Yalova Atatürk from Central Horticultural Research Institute. Especially in the last few years, the numbers of new cultivars of a total of 12 varieties have been registered. Atak 77, Pembe 77, İsmetbey, Arifbey, Samancı çekirdeksizi, and Yalova Beyazıtable grapes cultivars have been registered in the last few years among the new cultivars. Each one of them is different from the standard cultivars and has been registered with superior properties. Most of these cultivars need less pesticide application in high humidity areas and can be grown successfully. These new cultivars were tested in different ecology and determined suitable regions. These new table grape varieties started to be grown in different part of Turkey nowadays.

  14. Genetical background of intelligence

    Directory of Open Access Journals (Sweden)

    Anna Junkiert-Czarnecka

    2016-06-01

    Full Text Available Intelligence as an ability to reason, think abstractly and adapt effectively to the environment is a subject of research in the field of psychology, neurobiology, and in the last twenty years genetics as well. Genetical testing of twins carried out from XX century indicated heritebility of intelligence, therefore confirmed an influence of genetic factor on cognitive processes. Studies on genetic background of intelligence focus on dopaminergic (DRD2, DRD4, COMT, SLC6A3, DAT1, CCKAR and adrenergic system (ADRB2, CHRM2 genes as well as, neutrofins (BDNF and oxidative stress genes (LTF, PRNP. Positive effect of investigated gene polymorphism was indicated by variation c.957C>T DRD2 gene (if in polymorphic site is thymine, polymorphism c.472G>A COMT gene (presence of adenine and also gene ADRB2 c.46A->G (guanine, CHRM2 (thymine in place c.1890A>T and BDNF (guanine in place c.472G>A Obtained results indicate that intelligence is a feature dependent not only on genetic but also an environmental factor.

  15. Genetical background of intelligence.

    Science.gov (United States)

    Junkiert-Czarnecka, Anna; Haus, Olga

    2016-06-13

    Intelligence as an ability to reason, think abstractly and adapt effectively to the environment is a subject of research in the field of psychology, neurobiology, and in the last twenty years genetics as well. Genetical testing of twins carried out from XX century indicated heritebility of intelligence, therefore confirmed an influence of genetic factor on cognitive processes. Studies on genetic background of intelligence focus on dopaminergic (DRD2, DRD4, COMT, SLC6A3, DAT1, CCKAR) and adrenergic system (ADRB2, CHRM2) genes as well as, neutrofins (BDNF) and oxidative stress genes (LTF, PRNP). Positive effect of investigated gene polymorphism was indicated by variation c.957C>T DRD2 gene (if in polymorphic site is thymine), polymorphism c.472G>A COMT gene (presence of adenine) and also gene ADRB2 c.46A->G (guanine), CHRM2 (thymine in place c.1890A>T) and BDNF (guanine in place c.472G>A) Obtained results indicate that intelligence is a feature dependent not only on genetic but also an environmental factor.

  16. New Data Reduction and Analysis Documentation for HST and ACS

    Science.gov (United States)

    Lucas, Ray A.; Grogin, Norman A.; STScI ACS Team, STScI Science Software Branch

    2017-06-01

    As a service to HST users, and as STScI moves from supporting an IRAF/PyRAF environment for HST data reduction and analysis to one involving more direct usage of Python for both HST and JWST, our documentation must follow suit. We are in the process of revising our documentation for both HST and ACS to reflect this new reality. Although many tasks needing to be done in data reduction and analysis remain the same except for now being accomplished more directly by Python scripts, etc., some preferred ways of doing things may also change in some cases, especially where new possibilities for improvements exist. Along with a greater reliance on often free, open source, community-based software routines and new methods for distributing and upgrading software, there are also more new tools for data visualization, and for presenting catalogs, tabular, and textual information in ways which allow for things like the interactive comparison of or integration of multiple datasets, and easier ways of selecting subsamples from tables and highlighting them in plots, interactively linking tables with graphical data, etc. in more forms. We will present some of our plans for the updated documentation and some of these features which are being explored for further use.

  17. Low background infrared (LBIR) facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Low background infrared (LBIR) facility was originally designed to calibrate user supplied blackbody sources and to characterize low-background IR detectors and...

  18. imulation Results of Single Stage AC- AC Converter for Induction Heating

    OpenAIRE

    S. ARUMUGAM; S.Rama Reddy

    2010-01-01

    This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBT...

  19. Influence of SDBD plasma aerodynamic actuation on flow control by AC power supply and AC-DC power supply

    Science.gov (United States)

    Hu, Xu; Gao, Chao; Hao, Jiangnan

    2018-01-01

    In this paper, the excitation effect of single dielectric barrier discharge plasma actuator (SDBD) is compared by using AC power supply and AC-DC power supply. AC-DC power supply is based on the AC power supply, just adding DC component. The flow measurement is carried out by PIV technique. Results show that the excitation effect of AC power supply and AC-DC power supply increases by the increase of voltage, the range of speed field excited by AC power is greater than that of AC-DC power supply. For x direction maximum speed, excited by AC power supply is close to AC-DC, and for y direction maximum speed, AC power supply is greater than AC-DC power supply. So the excitation effect of AC power supply is better than that of AC-DC power supply for SDBD.

  20. The Alfonsine tables of Toledo

    CERN Document Server

    Chabás, José

    2003-01-01

    The Alfonsine Tables of Toledo is for historians working in the fields of astronomy, science, the Middle Ages, Spanish and other Romance languages. It is also of interest to scholars interested in the history of Castile, in Castilian-French relations in the Middle Ages and in the history of patronage. It explores the Castilian canons of the Alfonsine Tables and offers a study of their context, language, astronomical content, and diffusion. The Alfonsine Tables of Toledo is unique in that it: includes an edition of a crucial text in history of science; provides an explanation of astronomy as it was practiced in the Middle Ages; presents abundant material on early scientific language in Castilian; presents new material on the diffusion of Alfonsine astronomy in Europe; describes the role of royal patronage of science in a medieval context.

  1. General purpose steam table library :

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, John H.; Belcourt, Kenneth Noel; Nourgaliev, Robert

    2013-08-01

    Completion of the CASL L3 milestone THM.CFD.P7.04 provides a general purpose tabular interpolation library for material properties to support, in particular, standardized models for steam properties. The software consists of three parts, implementations of analytic steam models, a code to generate tables from those models, and an interpolation package to interface the tables to CFD codes such as Hydra-TH. Verification of the standard model is maintained through the entire train of routines. The performance of interpolation package exceeds that of freely available analytic implementation of the steam properties by over an order of magnitude.

  2. Background information to the installers guide for small scale mains connected PV

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    This report contains background information used by BRE, EA Technology, Halcrows and Sundog when compiling guidance for the UK's New and Renewable Energy Programme on the installation of small-scale photovoltaics (PV) in buildings. The report considers: relevant standards; general safety issues; fire and safety issues, including the fire resistance of PV modules; PV module ratings such as maximum voltage and maximum current; DC cabling; the DC disconnect; the DC junction box; fault analysis; general and AC side earthing; DC earthing; lightning and surge suppression; inverters; AC modules; AC systems; getting connection; mounting options; and installation issues.

  3. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  4. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  5. Supplemental Table S4.xls

    Indian Academy of Sciences (India)

    A, B, C, D, E, F. 1, Supplementary table 4.73 putative orthorlogous gene groups between rice and Arabidopsis and their responses towards N starvation stress. Genes differentially ... S1_at, lectin receptor-type protein kinase, putative, expressed. 36, AT4G02410.1, 1880, D, -0.7, 255502_at, lectin protein kinase family protein.

  6. Sand and Water Table Play

    Science.gov (United States)

    Wallace, Ann H.; White, Mary J.; Stone, Ryan

    2010-01-01

    The authors observed preschoolers engaged at the sand and water table to determine if math could be found within their play. Wanting to understand how children interact with provided materials and what kinds of math ideas they explore during these interactions, the authors offer practical examples of how such play can promote mathematical…

  7. Analysis and Interpretation of Semantic HTML Tables

    Science.gov (United States)

    Yin, Wensheng; Guo, Feifei; Xu, Fan; Chen, Xiuguo

    Table is an effective manifestation of structural knowledge, on which the semantic analysis is a very important part in semantic document analysis. To interpret the structure and the semantic relations of the HTML documents, definitions of normalized table and tabular coordinate system are proposed according to database relation theory. This paper classifies cells into normalized cells and visual cells, indicates that row or column and its combined cell are the primary semantic expression forms of table and nested tables are the further expansion of a certain table cell. Finally, a table analyzing algorithm is given based on tabular coordinate system. Practice shows that the algorithm is simple, fast and having certain practical significance.

  8. JEM-X background models

    DEFF Research Database (Denmark)

    Huovelin, J.; Maisala, S.; Schultz, J.

    2003-01-01

    Background and determination of its components for the JEM-X X-ray telescope on INTEGRAL are discussed. A part of the first background observations by JEM-X are analysed and results are compared to predictions. The observations are based on extensive imaging of background near the Crab Nebula...... on revolution 41 of INTEGRAL. Total observing time used for the analysis was 216 502 s, with the average of 25 cps of background for each of the two JEM-X telescopes. JEM-X1 showed slightly higher average background intensity than JEM-X2. The detectors were stable during the long exposures, and weak orbital...... phase dependence in the background outside radiation belts was observed. The analysis yielded an average of 5 cps for the diffuse background, and 20 cps for the instrument background. The instrument background was found highly dependent on position, both for spectral shape and intensity. Diff use...

  9. Spectral clustering and biclustering learning large graphs and contingency tables

    CERN Document Server

    Bolla, Marianna

    2013-01-01

    Explores regular structures in graphs and contingency tables by spectral theory and statistical methods This book bridges the gap between graph theory and statistics by giving answers to the demanding questions which arise when statisticians are confronted with large weighted graphs or rectangular arrays. Classical and modern statistical methods applicable to biological, social, communication networks, or microarrays are presented together with the theoretical background and proofs. This book is suitable for a one-semester course for graduate students in data mining, mult

  10. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  11. Pancreatectomy risk calculator: an ACS-NSQIP resource

    Science.gov (United States)

    Parikh, Purvi; Shiloach, Mira; Cohen, Mark E; Bilimoria, Karl Y; Ko, Clifford Y; Hall, Bruce L; Pitt, Henry A

    2010-01-01

    Background The morbidity of pancreatoduodenectomy remains high and the mortality may be significantly increased in high-risk patients. However, a method to predict post-operative adverse outcomes based on readily available clinical data has not been available. Therefore, the objective was to create a ‘Pancreatectomy Risk Calculator’ using the American College of Surgeons-National Surgical Quality Improvement Program (ACS-NSQIP) database. Methods The 2005–2008 ACS-NSQIP data on 7571 patients undergoing proximal (n =4621), distal (n =2552) or total pancreatectomy (n =177) as well as enucleation (n =221) were analysed. Pre-operative variables (n =31) were assessed for prediction of post-operative mortality, serious morbidity and overall morbidity using a logistic regression model. Statistically significant variables were ranked and weighted to create a common set of predictors for risk models for all three outcomes. Results Twenty pre-operative variables were statistically significant predictors of post-operative mortality (2.5%), serious morbidity (21%) or overall morbidity (32%). Ten out of 20 significant pre-operative variables were employed to produce the three mortality and morbidity risk models. The risk factors included age, gender, obesity, sepsis, functional status, American Society of Anesthesiologists (ASA) class, coronary heart disease, dyspnoea, bleeding disorder and extent of surgery. Conclusion The ACS-NSQIP ‘Pancreatectomy Risk Calculator’ employs 10 easily assessable clinical parameters to assist patients and surgeons in making an informed decision regarding the risks and benefits of undergoing pancreatic resection. A risk calculator based on this prototype will become available in the future as on online ACS-NSQIP resource. PMID:20815858

  12. Exenatide: AC 2993, AC002993, AC2993A, exendin 4, LY2148568.

    Science.gov (United States)

    2004-01-01

    Exenatide [AC002993, AC2993A, AC 2993, LY2148568, exendin 4], a glucagon-like peptide-1 (GLP-1) agonist, is a synthetic exendin 4 compound under development with Amylin Pharmaceuticals for the treatment of type 2 diabetes. Both exendin 4 and its analogue, exendin 3, are 39-amino acid peptides isolated from Heloderma horridum lizard venom that have different amino acids at positions 2 and 3, respectively. Exendins are able to stimulate insulin secretion in response to rising blood glucose levels, and modulate gastric emptying to slow the entry of ingested sugars into the bloodstream. Amylin Pharmaceuticals acquired exclusive patent rights for the two exendin compounds (exendin 3 and exendin 4) from the originator, Dr John Eng (Bronx, NY, US). On 20 September 2002, Amylin and Eli Lilly signed a collaborative agreement for the development and commercialisation of exenatide for type 2 diabetes. Under the terms of the agreement, Eli Lilly has paid Amylin a licensing fee of 80 million US dollars and bought Amylin's stock worth 30 million US dollars at 18.69 US dollars a share. After the initial payment, Eli Lilly will pay Amylin up to 85 US dollars million upon reaching certain milestones and also make an additional payment of up to 130 million US dollars upon global commercialisation of exenatide. Both companies will share the US development and commercialisation costs, while Eli Lilly will pick up up to 80% of development costs and all commercialisation costs outside the US. Amylin and Eli Lilly will equally share profit from sales in the US, while Eli Lilly will get 80% of the profit outside the US and Amylin will get the rest. This agreement has also enabled Amylin to train its sales force to co-promote Lilly's human growth hormone Humatrope. Alkermes will receive research and development funding and milestone payments, and also a combination of royalty payments and manufacturing fees based on product sales. Alkermes undertakes the responsibility for the development

  13. AC Electrokinetic Phenomena Generated by Microelectrode Structures

    Science.gov (United States)

    Hart, Robert; Oh, Jonghyun; Capurro, Jorge; Noh, Hongseok (Moses)

    2008-01-01

    The field of AC electrokinetics is rapidly growing due to its ability to perform dynamic fluid and particle manipulation on the micro- and nano-scale, which is essential for Lab-on-a-Chip applications. AC electrokinetic phenomena use electric fields to generate forces that act on fluids or suspended particles (including those made of dielectric or biological material) and cause them to move in astonishing ways1, 2. Within a single channel, AC electrokinetics can accomplish many essential on-chip operations such as active micro-mixing, particle separation, particle positioning and micro-pattering. A single device may accomplish several of those operations by simply adjusting operating parameters such as frequency or amplitude of the applied voltage. Suitable electric fields can be readily created by micro-electrodes integrated into microchannels. It is clear from the tremendous growth in this field that AC electrokinetics will likely have a profound effect on healthcare diagnostics3-5, environmental monitoring6 and homeland security7. In general, there are three AC Electrokinetic phenomena (AC electroosmosis, dielectrophoresis and AC electrothermal effect) each with unique dependencies on the operating parameters. A change in these operating parameters can cause one phenomena to become dominant over another, thus changing the particle or fluid behavior. It is difficult to predict the behavior of particles and fluids due to the complicated physics that underlie AC electrokinetics. It is the goal of this publication to explain the physics and elucidate particle and fluid behavior. Our analysis also covers how to fabricate the electrode structures that generate them, and how to interpret a wide number of experimental observations using several popular device designs. This video article will help scientists and engineers understand these phenomena and may encourage them to start using AC Electrokinetics in their research. PMID:19066515

  14. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals...

  15. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  16. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2014In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  17. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  18. Stream Tables and Watershed Geomorphology Education.

    Science.gov (United States)

    Lillquist, Karl D.; Kinner, Patricia W.

    2002-01-01

    Reviews copious stream tables and provides a watershed approach to stream table exercises. Results suggest that this approach to learning the concepts of fluvial geomorphology is effective. (Contains 39 references.) (DDR)

  19. NNDSS - Table II. Meningococcal disease to Pertussis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal disease to Pertussis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  20. NNDSS - Table II. Salmonellosis to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  1. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2014.In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  2. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2018. In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  3. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2015. In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  4. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  5. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  6. NNDSS - Table II. Hepatitis (viral, acute) C

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) C - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  7. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  8. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2017. In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  9. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2016. In this Table, provisional* cases of selected†infrequently reported notifiable diseases...

  10. NNDSS - Table II. West Nile to Zika

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile to Zika - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  11. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  12. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  13. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  14. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  15. The origins of Ptolemy's astronomical tables.

    Science.gov (United States)

    Newton, R. R.

    Following the line set by his earlier book 'The crime of Claudius Ptolemy' the author discusses here the numerous astronomical tables in Ptolemy's work that have been calculated with the aid of trigonometric tables, as well as a few that are nonlinear but that do not involve trigonometry. The purpose in this study is to determine, if possible, whether Ptolemy calculated these tables or whether he copied them from now-lost original works. The conclusion isthat Ptolemy made few if any original contributions to astronomy, either observational or computational.Contents: 1. Introduction; thetable of chords. 2. The tables of the latitude and of gnomon shadows.3. Tables of the Sun. 4. Astronomical geography. 5. The tables of theMoon. 6. Eclipse tables. 7. Tables of the planets. 8. The empirical basis for Hipparchus's mean motions of the Moon. 9. Summary and conclusions.

  16. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  17. NNDSS - Table II. Salmonellosis to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  18. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  19. NNDSS - Table II. Ehrlichiosis and Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis and Anaplasmosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  20. NNDSS - Table II. Meningococcal to Pertussis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal to Pertussis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  1. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  2. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  3. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  4. NNDSS - Table II. Tetanus to Varicella

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  5. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  6. Global Reference Tables for Management Information Systems

    Data.gov (United States)

    Social Security Administration — This database is a collection of reference tables that store common information used throughout SSA. These tables standardize code structures and code usage of SSA...

  7. Global Reference Tables for Production Systems

    Data.gov (United States)

    Social Security Administration — This database is a collection of reference tables that store common information used throughout SSA. These tables standardized code structures and code usage of SSA...

  8. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  9. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during...

  10. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000...

  11. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  12. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  13. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  14. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  15. Water-table contours of Nevada

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set consists of water-table contours for Nevada. These data were created as part of an effort to provide statewide information on water table and depth to...

  16. NNDSS - Table II. Rubella to Salmonellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  17. NNDSS - Table II. Babesiosis to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Coccidioidomycosis - 2014.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  18. NNDSS - Table II. Tetanus to Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  19. NNDSS - Table II. Tetanus to Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  20. NNDSS - Table II. Rubella to Salmonellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  1. NNDSS - Table II. Legionellosis to Malaria

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  2. NNDSS - Table II. Legionellosis to Malaria

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  3. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  4. Solar cell efficiency tables (version 50)

    Energy Technology Data Exchange (ETDEWEB)

    Green, Martin A. [Australian Centre for Advanced Photovoltaics, University of New South Wales, Sydney 2052 Australia; Hishikawa, Yoshihiro [National Institute of Advanced Industrial Science and Technology (AIST), Research Center for Photovoltaics (RCPV), Central 2, Umezono 1-1-1, Ibaraki Tsukuba 305-8568 Japan; Warta, Wilhelm [Department: Characterisation and Simulation/CalLab Cells, Fraunhofer-Institute for Solar Energy Systems, Heidenhofstr. 2 Freiburg D-79110 Germany; Dunlop, Ewan D. [European Commission-Joint Research Centre, Directorate C-Energy, Transport and Climate, Via E. Fermi 2749 Ispra IT-21027 VA Italy; Levi, Dean H. [National Renewable Energy Laboratory, 15013 Denver West Parkway Golden CO 80401 USA; Hohl-Ebinger, Jochen [Department: Characterisation and Simulation/CalLab Cells, Fraunhofer-Institute for Solar Energy Systems, Heidenhofstr. 2 Freiburg D-79110 Germany; Ho-Baillie, Anita W. H. [Australian Centre for Advanced Photovoltaics, University of New South Wales, Sydney 2052 Australia

    2017-06-21

    Consolidated tables showing an extensive listing of the highest independently confirmed efficiencies for solar cells and modules are presented. Guidelines for inclusion of results into these tables are outlined, and new entries since January 2017 are reviewed.

  5. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  6. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  7. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  8. NNDSS - Table II. Shiga toxin to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  9. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  10. NNDSS - Table II. Shiga toxin to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2015. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  11. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  12. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  13. NNDSS - Table II. Tetanus to Varicella

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  14. Beam induced backgrounds: CDF experience

    Energy Technology Data Exchange (ETDEWEB)

    Tesarek, R.J.; /Fermilab

    2008-05-01

    We summarize the experiences of the Collider Detector at Fermilab (CDF) experiment in the presence of backgrounds originating from the counter circulating beams in the Fermilab Tevatron. These backgrounds are measured and their sources identified. Finally, we outline the strategies employed to reduce the effects of these backgrounds on the experiment.

  15. On Importance of Rows for Decision Tables

    KAUST Repository

    AbouEisha, Hassan M.

    2017-06-21

    In this paper, we propose a method for the evaluation of importance of rows for decision tables. It is based on indirect information about changes in the set of reducts after removing the considered row from the table. We also discuss results of computer experiments with decision tables from UCI Machine Learning Repository.

  16. 21 CFR 890.3750 - Mechanical table.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mechanical table. 890.3750 Section 890.3750 Food... DEVICES PHYSICAL MEDICINE DEVICES Physical Medicine Prosthetic Devices § 890.3750 Mechanical table. (a) Identification. A mechanical table is a device intended for medical purposes that has a flat surface that can be...

  17. Modal Characterization of a Piezoelectric Shaker Table

    Science.gov (United States)

    2015-06-01

    MODAL CHARACTERIZATION OF A PIEZOELECTRIC SHAKER TABLE THESIS MARCH 2015 Randall J. Hodkin Jr...15-J-001 MODAL CHARACTERIZATION OF A PIEZOELECTRIC SHAKER TABLE THESIS Presented to the Faculty Department of Aeronautics and... PIEZOELECTRIC SHAKER TABLE Randall J. Hodkin Jr., BS Captain, USAF Committee Membership: Dr. A. N. Palazotto Chair Dr. M. B. Ruggles-Wrenn

  18. The Different Periodic Tables of Dmitrii Mendeleev

    Science.gov (United States)

    Laing, Michael

    2008-01-01

    Between 1869 and 1905 the Russian chemist Dmitrii Mendeleev published several tables with different arrangements of the chemical elements. Four of these are compared with periodic tables by Russian scientists from 1934 and 1969. The difficulties caused by the lanthanoid elements are clearly seen in the table of 1905, which satisfactorily includes…

  19. Managing Restaurant Tables using Constraints

    Science.gov (United States)

    Vidotto, Alfio; Brown, Kenneth N.; Beck, J. Christopher

    Restaurant table management can have significant impact on both profitability and the customer experience. The core of the issue is a complex dynamic combinatorial problem. We show how to model the problem as constraint satisfaction, with extensions which generate flexible seating plans and which maintain stability when changes occur. We describe an implemented system which provides advice to users in real time. The system is currently being evaluated in a restaurant environment.

  20. Supplemental Table S5.xls

    Indian Academy of Sciences (India)

    Weibo Xie

    1, Supplementary table 5B. Target genes of osa-miR399 and osa-miR530. The potential targets were predicted by the program of miRU: Plant microRNA Potential Target Finder at http://bioinfo3.noble.org/miRNA/miRU.htm. 2. 3, Target genes of osa-miR399i. 4. 5, ID, Target Site Alignment, Site, Score, Mismatch, Annotation.

  1. WWW Table of Radioactive Isotopes

    Science.gov (United States)

    Firestone, R. B.; Ekstrom, L. P.; Chu, S. Y. F.

    1999-10-01

    An electronic sequel to the Table of Radioactive Isotopes (John Wiley, 1986) is being developed for use on the WWW. Updated adopted and decay data from the Evaluated Nuclear Structure Decay File (ENSDF) and other sources have been combined and edited. Decay scheme normalizations are revised when necessary. Gamma-ray and alpha-particle energies can be searched interactively by energy or parent half-life, mass, and atomic or neutron number. Summary data including half-lives, Q-values, production mode(s), genetic feedings, and a list of references published since the last full evaluation are available. Users can display energy or intensity ordered tables of gamma-rays, K and L x-rays, alpha-particles, and beta endpoints. Spectra of betas and bremsstrahlung, and Auger/conversion electrons can be viewed with an interactive JAVA applet. Decay schemes can be displayed with the JAVA version of Isotope Explorer 3.0. The URL for the Table of Radioactive Isotopes is http://nucleardata.nuclear.lu.se/nucleardata/toi/.

  2. Backgrounder

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Researchers from Costa Rica's Facultad Latinoamericana de Ciencias Sociales will examine why urban communities with similar conditions of social exclusion experience different levels of violence. The study will compare six cities of different sizes in Costa Rica and El Salvador. • The Centro de Estudios en Seguridad ...

  3. BACKGROUNDER

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Through this initiative, four consortia will conduct research in three “hot spots” – regions where demographic trends, socio-economic development pathways, and strong climate signals put large numbers of people and their livelihoods at risk: semi-arid regions, deltas, and Himalayan river basins. The initiative brings ...

  4. BACKGROUNDER

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Through this initiative, four consortia will conduct research in three types of “hot spots” – regions where demographic trends and strong climate signals put large numbers of people and their livelihoods at risk: semi-arid regions, deltas, and Himalayan river basins. The initiative brings together experts from a variety of ...

  5. BACKGROUNDER

    International Development Research Centre (IDRC) Digital Library (Canada)

    Corey Piccioni

    Poor water availability, access, and management are constraining food output. Many small‐scale farmers operate with dryland farming systems and experience limited and uncertain rainfall. Major new dams do not provide feasible opons for most of these farmers. Instead they rely on shallow groundwater, rivers, lakes, and ...

  6. Backgrounder

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Agua Sustentable, Bolivia: $1,077,600 to strengthen local ability to cope and adapt to climate change in the. Bolivian Altiplano. • Centro de Cambio Global, Pontificia Universidad Católica de Chile, Chile: $1,298,000 for research on vulnerability and adaptation to climate change and variability in the Maipo Basin of central ...

  7. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  8. Finding Atmospheric Composition (AC) Metadata

    Science.gov (United States)

    Strub, Richard F..; Falke, Stefan; Fiakowski, Ed; Kempler, Steve; Lynnes, Chris; Goussev, Oleg

    2015-01-01

    The Atmospheric Composition Portal (ACP) is an aggregator and curator of information related to remotely sensed atmospheric composition data and analysis. It uses existing tools and technologies and, where needed, enhances those capabilities to provide interoperable access, tools, and contextual guidance for scientists and value-adding organizations using remotely sensed atmospheric composition data. The initial focus is on Essential Climate Variables identified by the Global Climate Observing System CH4, CO, CO2, NO2, O3, SO2 and aerosols. This poster addresses our efforts in building the ACP Data Table, an interface to help discover and understand remotely sensed data that are related to atmospheric composition science and applications. We harvested GCMD, CWIC, GEOSS metadata catalogs using machine to machine technologies - OpenSearch, Web Services. We also manually investigated the plethora of CEOS data providers portals and other catalogs where that data might be aggregated. This poster is our experience of the excellence, variety, and challenges we encountered.Conclusions:1.The significant benefits that the major catalogs provide are their machine to machine tools like OpenSearch and Web Services rather than any GUI usability improvements due to the large amount of data in their catalog.2.There is a trend at the large catalogs towards simulating small data provider portals through advanced services. 3.Populating metadata catalogs using ISO19115 is too complex for users to do in a consistent way, difficult to parse visually or with XML libraries, and too complex for Java XML binders like CASTOR.4.The ability to search for Ids first and then for data (GCMD and ECHO) is better for machine to machine operations rather than the timeouts experienced when returning the entire metadata entry at once. 5.Metadata harvest and export activities between the major catalogs has led to a significant amount of duplication. (This is currently being addressed) 6.Most (if not all

  9. Guide to mathematical tables supplement no 1

    CERN Document Server

    Burunova, N M; Fedorova, R M

    1960-01-01

    A Guide to Mathematical Tables is a supplement to the Guide to Mathematical Tables published by the U.S.S.R. Academy of Sciences in 1956. The tables contain information on subjects such as powers, rational and algebraic functions, and trigonometric functions, as well as logarithms and polynomials and Legendre functions. An index listing all functions included in both the Guide and the Supplement is included.Comprised of 15 chapters, this supplement first describes mathematical tables in the following order: the accuracy of the table (that is, the number of decimal places or significant

  10. Microtubule alignment and manipulation using AC electrokinetics.

    Science.gov (United States)

    Uppalapati, Maruti; Huang, Ying-Ming; Jackson, Thomas N; Hancock, William O

    2008-09-01

    The kinesin-microtubule system plays an important role in intracellular transport and is a model system for integrating biomotor-driven transport into microengineered devices. AC electrokinetics provides a novel tool for manipulating and organizing microtubules in solution, enabling new experimental geometries for investigating and controlling the interactions of microtubules and microtubule motors in vitro. By fabricating microelectrodes on glass substrates and generating AC electric fields across solutions of microtubules in low-ionic-strength buffers, bundles of microtubules are collected and aligned and the electrical properties of microtubules in solution are measured. The AC electric fields result in electro-osmotic flow, electrothermal flow, and dielectrophoresis of microtubules, which can be controlled by varying the solution conductivity, AC frequency, and electrode geometry. By mapping the solution conductivity and AC frequency over which positive dielectrophoresis occurs, the apparent conductivity of taxol-stabilized bovine-brain microtubules in PIPES buffer is measured to be 250 mS m(-1). By maximizing dielectrophoretic forces and minimizing electro-osmotic and electrothermal flow, microtubules are assembled into opposed asters. These experiments demonstrate that AC electrokinetics provides a powerful new tool for kinesin-driven transport applications and for investigating the role of microtubule motors in development and maintenance of the mitotic spindle.

  11. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  12. The exenatide analogue AC3174 attenuates hypertension, insulin resistance, and renal dysfunction in Dahl salt-sensitive rats

    Directory of Open Access Journals (Sweden)

    Fernandez Rayne

    2010-08-01

    Full Text Available Abstract Background Activation of glucagon-like peptide-1 (GLP-1 receptors improves insulin sensitivity and induces vasodilatation and diuresis. AC3174 is a peptide analogue with pharmacologic properties similar to the GLP-1 receptor agonist, exenatide. Hypothetically, chronic AC3174 treatment could attenuate salt-induced hypertension, cardiac morbidity, insulin resistance, and renal dysfunction in Dahl salt-sensitive (DSS rats. Methods DSS rats were fed low salt (LS, 0.3% NaCl or high salt (HS, 8% NaCl diets. HS rats were treated with vehicle, AC3174 (1.7 pmol/kg/min, or GLP-1 (25 pmol/kg/min for 4 weeks via subcutaneous infusion. Other HS rats received captopril (150 mg/kg/day or AC3174 plus captopril. Results HS rat survival was improved by all treatments except GLP-1. Systolic blood pressure (SBP was lower in LS rats and in GLP-1, AC3174, captopril, or AC3174 plus captopril HS rats than in vehicle HS rats (p Conclusions Thus, AC3174 had antihypertensive, cardioprotective, insulin-sensitizing, and renoprotective effects in the DSS hypertensive rat model. Furthermore, AC3174 improved animal survival, an effect not observed with GLP-1.

  13. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  14. Background subtraction theory and practice

    CERN Document Server

    Elgammal, Ahmed

    2014-01-01

    Background subtraction is a widely used concept for detection of moving objects in videos. In the last two decades there has been a lot of development in designing algorithms for background subtraction, as well as wide use of these algorithms in various important applications, such as visual surveillance, sports video analysis, motion capture, etc. Various statistical approaches have been proposed to model scene backgrounds. The concept of background subtraction also has been extended to detect objects from videos captured from moving cameras. This book reviews the concept and practice of back

  15. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing wireless...

  16. INTRODUCTION Outline of Round Tables Outline of Round Tables

    Science.gov (United States)

    Abarzhi, Snezhana I.; Sreenivasan, Katepalli R.

    2010-12-01

    The Second International Conference and Advanced School 'Turbulent Mixing and Beyond', TMB-2009, was held at the Abdus Salam International Centre for Theoretical Physics, (ICTP), Trieste, Italy on 27 July-7 August 2009. TMB-2009 united over 180 participants ranging from students to members of the National Academies of Sciences and Engineering, and including researchers at experienced and early stages of their carriers from leading scientific institutions in academia, national laboratories, corporations and industry worldwide. Responding to the community's inquiry and reaffirming the practices established at TMB-2007, two Round Tables were organized for the participants of TMB-2009 on 30 July 2009 and 6 August 2009 in the Oppenheimer Room at the Centre. The goals of the Round Tables were to encourage the information exchange among the members of the interdisciplinary and international TMB community, promote discussions regarding the state-of-the-art in TMB-related scientific areas, identify directions for frontier research, and articulate recommendations for future developments. This article is a summary of the collective work of the Round Table participants (listed alphabetically below by their last names), whose contributions form its substance and, as such, are greatly appreciated. Abarzhi, Snezhana I (University of Chicago, USA) Andrews, Malcolm (Los Alamos National Laboratory, USA) Belotserkovskii, Oleg (Institute for Computer Aided Design of the Russian Academy of Sciences, Russia) Bershadskii, Alexander (ICAR, Israel) Brandenburg, Axel (Nordita, Denmark) Chumakov, Sergei (Stanford University, USA) Desai, Tara (University of Milano-Bicocca, Italy) Galperin, Boris (University of South Florida, USA) Gauthier, Serge (Commissariat à l'Energie Atomique, France) Gekelman, Walter (University of California at Los Angeles, USA) Gibson, Carl (University of California at San Diego, USA) Goddard III, William A (California Institute of Technology, USA) Grinstein, Fernando

  17. Table-top job analysis

    Energy Technology Data Exchange (ETDEWEB)

    1994-12-01

    The purpose of this Handbook is to establish general training program guidelines for training personnel in developing training for operation, maintenance, and technical support personnel at Department of Energy (DOE) nuclear facilities. TTJA is not the only method of job analysis; however, when conducted properly TTJA can be cost effective, efficient, and self-validating, and represents an effective method of defining job requirements. The table-top job analysis is suggested in the DOE Training Accreditation Program manuals as an acceptable alternative to traditional methods of analyzing job requirements. DOE 5480-20A strongly endorses and recommends it as the preferred method for analyzing jobs for positions addressed by the Order.

  18. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift

  19. A table-top LHC

    CERN Multimedia

    Barbara Warmbein

    2011-01-01

    Many years ago, when ATLAS was no more than a huge empty underground cavern and Russian artillery shell casings were being melted down to become part of the CMS calorimetry system, science photographer Peter Ginter started documenting the LHC’s progress. He was there when special convoys of equipment crossed the Jura at night, when cranes were lowering down detector slices and magnet coils were being wound in workshops. Some 18 years of LHC history have been documented by Ginter, and the result has just come out as a massive coffee table book full of double-page spreads of Ginter’s impressive images.   The new coffee table book, LHC: the Large Hadron Collider. Published by the Austrian publisher Edition Lammerhuber in cooperation with CERN and UNESCO Publishing, LHC: the Large Hadron Collider is an unusual piece in the company’s portfolio. As the publisher’s first science book, LHC: the Large Hadron Collider weighs close to five kilos and comes in a s...

  20. Heart-type Fatty acid-binding protein in Acute Myocardial infarction Evaluation (FAME) : Background and design of a diagnostic study in primary care

    NARCIS (Netherlands)

    Slot, Madeleine H. E. Bruins; van der Heijden, Geert J. M. G.; Rutten, Frans H.; van der Spoel, Onno P.; Mast, E. Gijs; Bredero, Ad C.; Doevendans, Pieter A.; Glatz, Jan F. C.; Hoes, Arno W.

    2008-01-01

    Background: Currently used biomarkers for cardiac ischemia are elevated in blood plasma after a delay of several hours and therefore unable to detect acute coronary syndrome (ACS) in a very early stage. General practitioners (GPs), however, are often confronted with patients suspected of ACS within

  1. Eddy Current Rail Inspection Using AC Bridge Techniques.

    Science.gov (United States)

    Liu, Ze; Koffman, Andrew D; Waltrip, Bryan C; Wang, Yicheng

    2013-01-01

    AC bridge techniques commonly used for precision impedance measurements have been adapted to develop an eddy current sensor for rail defect detection. By using two detection coils instead of just one as in a conventional sensor, we can balance out the large baseline signals corresponding to a normal rail. We have significantly enhanced the detection sensitivity of the eddy current method by detecting and demodulating the differential signal of the two coils induced by rail defects, using a digital lock-in amplifier algorithm. We have also explored compensating for the lift-off effect of the eddy current sensor due to vibrations by using the summing signal of the detection coils to measure the lift-off distance. The dominant component of the summing signal is a constant resulting from direct coupling from the excitation coil, which can be experimentally determined. The remainder of the summing signal, which decreases as the lift-off distance increases, is induced by the secondary eddy current. This dependence on the lift-off distance is used to calibrate the differential signal, allowing for a more accurate characterization of the defects. Simulated experiments on a sample rail have been performed using a computer controlled X-Y moving table with the X-axis mimicking the train's motion and the Y-axis mimicking the train's vibrational bumping. Experimental results demonstrate the effectiveness of the new detection method.

  2. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  3. ACS Data Handbook v.6.0

    Science.gov (United States)

    Gonzaga, S.; et al.

    2011-03-01

    ACS was designed to provide a deep, wide-field survey capability from the visible to near-IR using the Wide Field Camera (WFC), high resolution imaging from the near-UV to near-IR with the now-defunct High Resolution Camera (HRC), and solar-blind far-UV imaging using the Solar Blind Camera (SBC). The discovery efficiency of ACS's Wide Field Channel (i.e., the product of WFC's field of view and throughput) is 10 times greater than that of WFPC2. The failure of ACS's CCD electronics in January 2007 brought a temporary halt to CCD imaging until Servicing Mission 4 in May 2009, when WFC functionality was restored. Unfortunately, the high-resolution optical imaging capability of HRC was not recovered.

  4. Assessment and risk reduction of infectious pathogens on chiropractic treatment tables

    Directory of Open Access Journals (Sweden)

    Husbands Chris

    2007-06-01

    Full Text Available Abstract Background To investigate the presence of pathogenic microbes on chiropractic treatment tables in one outpatient teaching clinic. Additional aims were to test inexpensive disinfectants on tables that may kill microbes and suggest infection control measures for chiropractic offices, clinics and classrooms. The aim of the study was to assess the presence of pathogenic microbes on treatment tables in one outpatient teaching clinic and determine a simple behavioral model for infection control including table disinfection and accepted hand washing and sanitizing protocols. Methods 10 treatment tables were selected and sampled for possible microbial flora on face and hand pieces. Samples were cultured on MacConky's agar and mannitol salt agar, labeled and incubated for up to 48 hours. Confirmatory testing of microbes to determine if drug resistant flora were present was performed. Among tables tested, 5 were selected to test disinfectants. One-half of the face piece and 1 hand piece were treated with two different wipes and then post-tested for microbes. Results Pathogenic microbes were present on chiropractic treatment tables including methicillin-resistant Staph aureus. Simple disinfectants neutralized the pathogens. A rudimentary disinfection procedure and infection control measures are suggested based on the findings. Conclusion Pathogenic microbes may be present on chiropractic treatment tables and can be effectively killed with proper disinfecting. Hand washing/sanitizing is an important measure in infection control as is table disinfecting. Rudimentary behavioral changes to improve chiropractic clinic infection control are needed. More comprehensive behavioral models are needed. All teaching clinics and private chiropractic offices should adopt infection control practices including routine table disinfecting and hand sanitizing. Effective measures can be put in place at minimal costs. Accrediting bodies of chiropractic institutions

  5. Environmental Regulatory Update Table, December 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1992-01-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  6. Environmental Regulatory Update Table, November 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-12-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  7. Thermodynamic tables to accompany Modern engineering thermodynamics

    CERN Document Server

    Balmer, Robert T

    2011-01-01

    This booklet is provided at no extra charge with new copies of Balmer's Modern Engineering Thermodynamics. It contains two appendices. Appendix C contains 40 thermodynamic tables, and Appendix D consists of 6 thermodynamic charts. These charts and tables are provided in a separate booklet to give instructors the flexibility of allowing students to bring the tables into exams. The booklet may be purchased separately if needed.

  8. Environmental Regulatory Update Table, December 1989

    Energy Technology Data Exchange (ETDEWEB)

    Houlbert, L.M.; Langston, M.E. (Tennessee Univ., Knoxville, TN (USA)); Nikbakht, A.; Salk, M.S. (Oak Ridge National Lab., TN (USA))

    1990-01-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  9. Environmental Regulatory Update Table, October 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-11-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  10. Environmental Regulatory Update Table, August 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M., Hawkins, G.T.; Salk, M.S.

    1991-09-01

    This Environmental Regulatory Update Table (August 1991) provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  11. Environmental regulatory update table, March 1989

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.; Langston, M.E.; Nikbakht, A.; Salk, M.S.

    1989-04-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  12. Environmental Regulatory Update Table, September 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-10-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  13. Environmental regulatory update table, July 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-08-01

    This Environmental Regulatory Update Table (July 1991) provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  14. An alternative to the orthopaedic traction table (fracture table: A prototype of low cost, easy reproduction and good applicability

    Directory of Open Access Journals (Sweden)

    Diego Ariel de Lima

    2017-03-01

    Full Text Available Abstract Background: Orthopaedic traction tables are used as an aid in numerous surgical procedures. The present paper aims to present a prototype of an external device of lower limb traction, which is portable, of simple construction, and can be installed on any operating table, with possible application in surgical and teaching practices. We will compare the quality of radiographic images obtained with the help of this prototype (PT to those images obtained with the aid of the conventional traction table (CT. Materials and methods: Cross-sectional, observational, and double blind study, approved by the Research Ethics Committee. On two occasions 36 randomly selected radiographs of the lower limbs, 18 of which obtained on the CT and the remaining on the PT, were evaluated by nine physicians. These radiographs were obtained from three volunteer and none of them presented musculoskeletal system disorders previously diagnosed in the study. Examiners rated each picture from 1 to 5, according to the quality of the image obtained. The responses were submitted to statistical analysis by SPSS ®, v23. Comparisons were considered significant when p <0.05, with a 95% confidence interval. Results: The average ratings were similar and all significance tests between the averages were higher than 0.9. The intra-observer agreement was 76.13% for the PT and 82.69% for the CT. The inter-observer agreement was low for both models. Due to its lower weight and smaller size compared to the CT and the material used for prototyping, the production cost of the PT is quite affordable. Conclusions: The PT presented in this paper is a good alternative to CT.   Keywords: Traction table, Fracture table, Orthopaedic surgery, Orthopaedic prototype, Lower limbs.

  15. TACO: Visualizing Changes in Tables Over Time.

    Science.gov (United States)

    Niederer, Christina; Stitz, Holger; Hourieh, Reem; Grassinger, Florian; Aigner, Wolfgang; Streit, Marc

    2017-08-29

    Multivariate, tabular data is one of the most common data structures used in many different domains. Over time, tables can undergo changes in both structure and content, which results in multiple versions of the same table. A challenging task when working with such derived tables is to understand what exactly has changed between versions in terms of additions/deletions, reorder, merge/split, and content changes. For textual data, a variety of commonplace "diff" tools exist that support the task of investigating changes between revisions of a text. Although there are some comparison tools which assist users in inspecting differences between multiple table instances, the resulting visualizations are often difficult to interpret or do not scale to large tables with thousands of rows and columns. To address these challenges, we developed TACO, an interactive comparison tool that visualizes the differences between multiple tables at various levels of detail. With TACO we show (1) the aggregated differences between multiple table versions over time, (2) the aggregated changes between two selected table versions, and (3) detailed changes between the selected tables. To demonstrate the effectiveness of our approach, we show its application by means of two usage scenarios.

  16. CRC standard mathematical tables and formulae

    CERN Document Server

    Zwillinger, Daniel

    2002-01-01

    New in the 31st edition:Game theory and voting powerHeuristic search techniquesQuadratic fieldsReliabilityRisk analysis and decision rulesA table of solutions to Pell's equationA table of irreducible polynomials in Z2[x]An interpretation of powers of 10A collection of ""proofs without words""Representations of groups of small orderCounting principlesTesselations and tilings…and much more!An indispensable, up-to-date resource, CRC Standard Mathematical Tables and Formulae, 31st Edition makes it effortless to find the equations, tables, and formulae you need most often.

  17. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

  18. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  19. Berkeley Low Background Counting Facility

    Data.gov (United States)

    Federal Laboratory Consortium — Sensitive low background assay detectors and sample analysis are available for non-destructive direct gamma-ray assay of samples. Neutron activation analysis is also...

  20. Backgrounds in AFP Detector Estimation

    CERN Document Server

    Huang, Yicong

    2016-01-01

    The ATLAS Forward Proton (AFP) detectors aim to measure protons that are scattered in the ATLAS interaction point under very small angles ($90-160 \\mu rad$). The diffractive protons detected by the AFP may be accompanied by beam halo. This report presents an estimation of the beam halo backgrounds in the AFP using low pile-up data, and position distributions of the backgrounds in the AFP.

  1. Cosmic microwave background, where next?

    CERN Multimedia

    CERN. Geneva

    2009-01-01

    Ground-based, balloon-borne and space-based experiments will observe the Cosmic Microwave Background in greater details to address open questions about the origin and the evolution of the Universe. In particular, detailed observations the polarization pattern of the Cosmic Microwave Background radiation have the potential to directly probe physics at the GUT scale and illuminate aspects of the physics of the very early Universe.

  2. Solar cell efficiency tables (version 48): Solar cell efficiency tables (version 48)

    Energy Technology Data Exchange (ETDEWEB)

    Green, Martin A. [Australian Centre for Advanced Photovoltaics, University of New South Wales, Sydney New South Wales 2052 Australia; Emery, Keith [National Renewable Energy Laboratory, 15013 Denver West Parkway Golden CO 80401 USA; Hishikawa, Yoshihiro [Research Center for Photovoltaics (RCPV), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, Umezono 1-1-1 Tsukuba Ibaraki 305-8568 Japan; Warta, Wilhelm [Characterisation and Simulation/CalLab Cells, Fraunhofer Institute for Solar Energy Systems, Heidenhofstr. 2 D-79110 Freiburg Germany; Dunlop, Ewan D. [European Commission - Joint Research Centre, Renewable Energy Unit, Institute for Energy, Via E. Fermi 2749 IT-21027 Ispra VA Italy

    2016-06-17

    Consolidated tables showing an extensive listing of the highest independently confirmed efficiencies for solar cells and modules are presented. Guidelines for inclusion of results into these tables are outlined, and new entries since January 2016 are reviewed.

  3. Late gadolinium enhanced cardiovascular magnetic resonance of lamin A/C gene mutation related dilated cardiomyopathy

    Directory of Open Access Journals (Sweden)

    Peuhkurinen Keijo

    2011-06-01

    Full Text Available Abstract Background The purpose of this study was to identify early features of lamin A/C gene mutation related dilated cardiomyopathy (DCM with cardiovascular magnetic resonance (CMR. We characterise myocardial and functional findings in carriers of lamin A/C mutation to facilitate the recognition of these patients using this method. We also investigated the connection between myocardial fibrosis and conduction abnormalities. Methods Seventeen lamin A/C mutation carriers underwent CMR. Late gadolinium enhancement (LGE and cine images were performed to evaluate myocardial fibrosis, regional wall motion, longitudinal myocardial function, global function and volumetry of both ventricles. The location, pattern and extent of enhancement in the left ventricle (LV myocardium were visually estimated. Results Patients had LV myocardial fibrosis in 88% of cases. Segmental wall motion abnormalities correlated strongly with the degree of enhancement. Myocardial enhancement was associated with conduction abnormalities. Sixty-nine percent of our asymptomatic or mildly symptomatic patients showed mild ventricular dilatation, systolic failure or both in global ventricular analysis. Decreased longitudinal systolic LV function was observed in 53% of patients. Conclusions Cardiac conduction abnormalities, mildly dilated LV and depressed systolic dysfunction are common in DCM caused by a lamin A/C gene mutation. However, other cardiac diseases may produce similar symptoms. CMR is an accurate tool to determine the typical cardiac involvement in lamin A/C cardiomyopathy and may help to initiate early treatment in this malignant familiar form of DCM.

  4. Setting Places at the Table

    Directory of Open Access Journals (Sweden)

    James R. Briscoe

    2016-12-01

    Full Text Available A recent survey by the National Endowment for the Arts found that only 2% of Americans listen to “Classical” music with regularity, and fewer practice or play art or historic music even once in a year. The rotating kaleidoscope of new technologies, repertories, interpretation, and cultural values can become not an ultimate bewilderment, a nail in the coffin of art and historic music, but a powerful tool for revitalizing how it engages persons of all age groups and how it can broaden its understanding. The table of musical places we set can respond to the narrative we carefully conceive for any condition at hand, for the student or scholar or layperson we address, for an intentional kaleidoscope of presentations. Such an attitude might let the other 98% discover art and historic music and see their lives mirrored and bettered.

  5. A periodic table for cancer.

    Science.gov (United States)

    Epstein, Richard J

    2015-01-01

    Cancers exhibit differences in metastatic behavior and drug sensitivity that correlate with certain tumor-specific variables such as differentiation grade, growth rate/extent and molecular regulatory aberrations. In practice, patient management is based on the past results of clinical trials adjusted for these biomarkers. Here, it is proposed that treatment strategies could be fine-tuned upfront simply by quantifying tumorigenic spatial (cell growth) and temporal (genetic stability) control losses, as predicted by genetic defects of cell-cycle-regulatory gatekeeper and genome-stabilizing caretaker tumor suppressor genes, respectively. These differential quantifications of tumor dysfunction may in turn be used to create a tumor-specific 'periodic table' that guides rational formulation of survival-enhancing anticancer treatment strategies.

  6. The periodic table in Flatland

    Energy Technology Data Exchange (ETDEWEB)

    Negadi, T. [Universite d`Oran, Es-Senia (Algeria); Kibler, M. [Universite Claude Bernard, Villeurbanne (France)

    1996-01-05

    The D-dimensional Coulomb system serves as a starting point for generating generalized atomic shells. These shells are ordered according to a generalized Madelung rule in D dimensions. This rule together with an Aujbau Prinzip is applied to produce a D-dimensional periodic table. A model is developed to rationalize the ordering of the shells predicted by the generalized Madelung rule. This model is based on the introduction of a Hamiltonian, invariant under the q-deformed algebra U{sub q}(so(D)), that breaks down the SO(D + 1) dynamical symmetry of the hydrogen atom in D dimensions. The D = 2 case (Flatland) is investigated in some detail. It is shown that the neutral atoms and the (moderately) positive ions correspond to the values q = 0.8 and q = 1, respectively, of the deformation parameter q. 55 refs.

  7. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  8. TableMaker: An Excel Macro for Publication-Quality Tables

    OpenAIRE

    Marek Hlavac

    2016-01-01

    This article introduces TableMaker, a Microsoft Excel macro that produces publicationquality tables and includes them as new sheets in workbooks. The macro provides an intuitive graphical user interface that allows for the full customization of all table features. It also allows users to save and load table templates, and thus allows layouts to be both reproducible and transferable. It is distributed in a single computer file. As such, the macro is easy to share, as well as accessible to even...

  9. Early Poststroke Rehabilitation Using a Robotic Tilt-Table Stepper and Functional Electrical Stimulation

    Directory of Open Access Journals (Sweden)

    Alexey N. Kuznetsov

    2013-01-01

    Full Text Available Background. Stroke frequently leaves survivors with hemiparesis. To prevent persistent deficits, rehabilitation may be more effective if started early. Early training is often limited because of orthostatic reactions. Tilt-table stepping robots and functional electrical stimulation (FES may prevent these reactions. Objective. This controlled convenience sample study compares safety and feasibility of robotic tilt-table training plus FES (ROBO-FES and robotic tilt-table training (ROBO against tilt-table training alone (control. A preliminary assessment of efficacy is performed. Methods. Hemiparetic ischemic stroke survivors (age years, days after stroke were assigned to 30 days of ROBO-FES (, ROBO (, or control ( in addition to conventional physical therapy. Impedance cardiography and transcranial doppler sonography were performed before, during, and after training. Hemiparesis was assessed using the British Medical Research Council (MRC strength scale. Results. No serious adverse events occurred; 8 patients in the tilt-table group prematurely quit the study because of orthostatic reactions. Blood pressure and CBFV dipped % during robot training. In 52% of controls mean arterial pressure decreased by %. ROBO-FES increased leg strength by points, ROBO by more than control (, . CBFV increased in both robotic groups more than in controls (. Conclusions. Robotic tilt-table exercise with or without FES is safe and may be more effective in improving leg strength and cerebral blood flow than tilt table alone.

  10. Exothermic reaction in zeolite hemostatic dressings: QuikClot ACS and ACS+.

    Science.gov (United States)

    Arnaud, Françoise; Tomori, Toshiki; Carr, Walter; McKeague, Anne; Teranishi, Kohsuke; Prusaczyk, Keith; McCarron, Richard

    2008-10-01

    Zeolites have hemostatic properties used to stop bleeding in severe hemorrhage. Manufactured QuikClot is an approved zeolite-based hemostatic agent for battlefield use. The exothermic reaction associated with QuikClot as loose granules or as granules packaged in a mesh bag has potential burn effects; this led to the development of a formulation of "cooler" non-exothermic QuikClot. The goal of this study was to compare the elevation of temperature of these formulations upon contact with blood. Following full transection of the femoral vasculature, anesthetized Yorkshire pigs (n = 15) (28.8 +/- 1.5 kg) were hemorrhaged for 2 min and treated with 100 g of bagged QuikClot (Advanced Clotting Sponge (ACS) (n = 4)) or a modified non-exothermic formulation (ACS+ (n = 11)). Vital signs and temperature at the dressing/tissue interface were continuously recorded for 3 h. Additional procedures were used to examine effects of different ratios of blood to zeolite on temperature elevation. Total post-treatment blood loss was comparable for ACS+_E and ACS_E groups (overall average: 18.6 +/- 10.5% EBV). Temperature recorded at the dressing/tissue interface was significantly lower with ACS+ vs. ACS (40.3 +/- 1.8 vs. 61.4 +/- 10.7 degrees C, respectively, p < 0.01) and was 3.2 +/- 2.6 degrees C higher than rectal temperature (38.0 +/- 0.7 degrees C, p < 0.01). Survival at endpoint (7/11 vs. 4/4) and average survival time (134 +/- 64 vs. 180 min) were greater for both ACS+ and ACS in comparison to Standard Dressing. The wound temperature with ACS was reduced with greater blood to product ratios and this pattern was paralleled with in vitro measurements. The lower heat release with ACS+ compared to ACS was confirmed in an animal model and ACS+ had similar efficacy in arresting bleeding when compared to Standard Dressing.

  11. Petrov D vacuum spaces revisited: Complete tables and invariant classification by GHP analysis

    Energy Technology Data Exchange (ETDEWEB)

    Edgar, S Brian; Gomez-Lobo, Alfonso Garcia-Parrado; Martin-Garcia, Jose M, E-mail: bredg@mai.liu.s, E-mail: alfonso@math.uminho.p, E-mail: Jose.Hartin-Garcia@obspm.f [Matematiska institutionen, Linkoepings Universitet, SE-581 83 Linkoping (Sweden)

    2010-05-01

    The efficiency of the GHP formalism combined with the power of the computer system xAcT enables an exhaustive systematic analysis to be made of Petrov D vacuum spaces. This gives a complete involutive set of tables for the four GHP derivatives on each of the four GHP spin coefficients and the one Weyl tensor component. It follows directly from these results that the theoretical upper bound on the order of covariant differentiation of the Riemann tensor required for a Karlhede invariant classification of these spaces is reduced to two.

  12. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    2012-01-01

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  13. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele...

  14. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    deficiency, but to boorishness or ill-will. While grammatical error may reveal a speaker to be a less than proficient language- http://spilplus.journals.ac.za/ .... problems of meanlng, language use and the various linguistic aspects of interaction... contrastive analysis without a pragmalinguistic dimension is inadequate.".

  15. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  16. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  17. Total synthesis of chaetoquadrins A-C.

    Science.gov (United States)

    Kim, U Bin; Furkert, Daniel P; Brimble, Margaret A

    2013-02-01

    The first total synthesis of the monoamine oxidase inhibitors chaetoquadrins A-C has been accomplished. Key steps in the synthesis include an aromatic Claisen rearrangement, asymmetric boron aldol reaction and acid-mediated spiroketalization. Comparison of spectral data for the synthetic spiroketals confirmed the proposed structure for these natural products.

  18. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  19. Organic magnetoresistance under resonant ac drive

    Science.gov (United States)

    Roundy, R. C.; Raikh, M. E.

    2013-09-01

    Motivated by a recent experiment, we develop a theory of organic magnetoresistance (OMAR) in the presence of a resonant ac drive. To this end, we perform a thorough analysis of the dynamics of ac-driven electron-hole polaron pair in magnetic field, which is a sum of external and random hyperfine fields. Resonant ac drive affects the OMAR by modifying the singlet content of the eigenmodes. This, in turn, leads to the change of recombination rate, and ultimately, to the change of the spin-blocking that controls the current. Our analysis demonstrates that, upon increasing the drive amplitude, the blocking eigenmodes of the triplet type acquire a singlet admixture and become unblocking. Most surprisingly, the opposite process goes in parallel: new blocking modes emerge from nonblocking precursors as the drive increases. These emergent blocking modes are similar to subradiant modes in the Dicke effect. A nontrivial evolution of eigenmodes translates into a nontrivial behavior of OMAR with the amplitude of the ac drive: it is initially linear, then passes through a maximum, drops, and finally saturates.

  20. Nuttall Oak Volume and Weight Tables

    Science.gov (United States)

    Bryce E. Schlaegel; Regan B. Willson

    1983-01-01

    Volume and weight tables were constructed from a 62-tree sample of Nuttall oak (Quercus nuttallii Palmer) taken in the Mississippi Delta. The tables present volume, green weight, and dry weight of bole wood, bole wood plus bark, and total tree above a one-foot stump as predicted from the nonlinear model Y = 0Db

  1. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  2. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  3. Relating Functional Groups to the Periodic Table

    Science.gov (United States)

    Struyf, Jef

    2009-01-01

    An introduction to organic chemistry functional groups and their ionic variants is presented. Functional groups are ordered by the position of their specific (hetero) atom in the periodic table. Lewis structures are compared with their corresponding condensed formulas. (Contains 5 tables.)

  4. Solar Cell Efficiency Tables (Version 51)

    Energy Technology Data Exchange (ETDEWEB)

    Levi, Dean H [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Green, Martin A. [University of New South Wales; Hishikawa, Yoshihiro [National Institute of Advanced Industrial Science and Technology (AIST); Dunlop, Ewan D. [European Commission-Joint Research Centre; Hohl-Ebinger, Jochen [Fraunhofer Institute for Solar Energy Systems; Ho-Baillie, Anita W. Y. [University of New South Wales

    2017-12-14

    Consolidated tables showing an extensive listing of the highest independently confirmed efficiencies for solar cells and modules are presented. Guidelines for inclusion of results into these tables are outlined and new entries since July 2017 are reviewed, together with progress over the last 25 years. Appendices are included documenting area definitions and also listing recognised test centres.

  5. Online Periodic Table: A Cautionary Note

    Science.gov (United States)

    Izci, Kemal; Barrow, Lloyd H.; Thornhill, Erica

    2013-01-01

    The purpose of this study was (a) to evaluate ten online periodic table sources for their accuracy and (b) to compare the types of information and links provided to users. Limited studies have been reported on online periodic table (Diener and Moore 2011; Slocum and Moore in "J Chem Educ" 86(10):1167, 2009). Chemistry students'…

  6. 29 CFR 1915.118 - Tables.

    Science.gov (United States)

    2010-07-01

    ... shipbreaking. Table E-1—Dimensions and Spacing of Wood Independent-Pole Scaffold Members Structural members...-3—Specifications for the Construction of Horses Structural members Height in feet ≤10 >10≤16 16≤20... Swaged Terminal attachment. (B)—Mechanical Sleeve attachment. (C)—Hand Tucked Splice attachment. Table G...

  7. Scenario-based table top simulations

    DEFF Research Database (Denmark)

    Broberg, Ole; Edwards, Kasper; Nielsen, J.

    2012-01-01

    This study developed and tested a scenario-based table top simulation method in a user-driven innovation setting. A team of researchers worked together with a user group of five medical staff members from the existing clinic. Table top simulations of a new clinic were carried out in a simple model...

  8. ‘Valley Pearl’ table grape

    Science.gov (United States)

    ‘Valley Pearl’ is an early to mid-season, white seedless table grape (Vitis vinifera L.) suitable for commercial table grape production where V. vinifera can be grown. Significant characteristics of ‘Valley Pearl’ are its high and consistent fruit production on spur pruned vines and large round berr...

  9. Neutron background estimates in GESA

    Directory of Open Access Journals (Sweden)

    Fernandes A.C.

    2014-01-01

    Full Text Available The SIMPLE project looks for nuclear recoil events generated by rare dark matter scattering interactions. Nuclear recoils are also produced by more prevalent cosmogenic neutron interactions. While the rock overburden shields against (μ,n neutrons to below 10−8 cm−2 s−1, it itself contributes via radio-impurities. Additional shielding of these is similar, both suppressing and contributing neutrons. We report on the Monte Carlo (MCNP estimation of the on-detector neutron backgrounds for the SIMPLE experiment located in the GESA facility of the Laboratoire Souterrain à Bas Bruit, and its use in defining additional shielding for measurements which have led to a reduction in the extrinsic neutron background to ∼ 5 × 10−3 evts/kgd. The calculated event rate induced by the neutron background is ∼ 0,3 evts/kgd, with a dominant contribution from the detector container.

  10. Background music and cognitive performance.

    Science.gov (United States)

    Angel, Leslie A; Polzella, Donald J; Elvers, Greg C

    2010-06-01

    The present experiment employed standardized test batteries to assess the effects of fast-tempo music on cognitive performance among 56 male and female university students. A linguistic processing task and a spatial processing task were selected from the Criterion Task Set developed to assess verbal and nonverbal performance. Ten excerpts from Mozart's music matched for tempo were selected. Background music increased the speed of spatial processing and the accuracy of linguistic processing. The findings suggest that background music can have predictable effects on cognitive performance.

  11. Generative electronic background music system

    Energy Technology Data Exchange (ETDEWEB)

    Mazurowski, Lukasz [Faculty of Computer Science, West Pomeranian University of Technology in Szczecin, Zolnierska Street 49, Szczecin, PL (Poland)

    2015-03-10

    In this short paper-extended abstract the new approach to generation of electronic background music has been presented. The Generative Electronic Background Music System (GEBMS) has been located between other related approaches within the musical algorithm positioning framework proposed by Woller et al. The music composition process is performed by a number of mini-models parameterized by further described properties. The mini-models generate fragments of musical patterns used in output composition. Musical pattern and output generation are controlled by container for the mini-models - a host-model. General mechanism has been presented including the example of the synthesized output compositions.

  12. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  13. Some Reflections on the Periodic Table and Its Use.

    Science.gov (United States)

    Fernelius, W. Conard

    1986-01-01

    Discusses early periodic tables; effect on the periodic table of atomic numbers; the periodic table in relation to electron distribution in the atoms of elements; terms and concepts related to the table; and the modern basis of the periodic table. Additional comments about these and other topics are included. (JN)

  14. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  15. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    OpenAIRE

    S. Arumugam S. Ramareddy M. Sridhar

    2011-01-01

    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  16. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  17. Usefulness of PKH fluorescent labelling to study leukemic cell proliferation with various cytostatic drugs or acetyl tetrapeptide – AcSDKP

    Directory of Open Access Journals (Sweden)

    Thierry Josiane

    2005-09-01

    Full Text Available Abstract Background PKH67 labelling was compared for classical proliferation assessment (using S phase evaluation to analyse the cell proliferation of 29 AML patients treated or not with various drugs. Among these drugs, the effect of tetrapeptide AcSDKP or AcSDKP-NH2 on AML cells, stimulated or not by cytokines, was also evaluated in order to determine (i if AcSDKP was able to inhibit blast cell proliferation as it inhibits haematopoietic progenitors (ii if AcSDKP-NH2 was more stable than AcSDKP with FBS. Methods For PKH labeling, cells were suspended in Diluent C, and rapidly admixed with PKH67 solution at 20 μM PKH67. Staining was stopped by addition of FBS. Results A good correlation between PKH67 labelling and bromodeoxyuridine incorporation was obtained first with 6/9 patients for control cells, then for 11/17 AML patients treated with classical antileukemic drugs (among whom 4 were also treated with AcSDKP. The effect of AcSDKP was also studied on 7 patients. The discrepancy between both methods was essentially due to an accumulation of cells into different cycle phases measured by BrdUrd incorporation secondary to drug action and PKH67 labelling which measured the dynamic proliferation. This last method allows identifying resistant cells which still proliferate. AcSDKP or AcSDKP-NH2 induced a decrease of leukemic cell proliferation in 5/7 patients when cytokines were added (in order to stimulate proliferation one day after tetrapeptide AcSDKP or AcSDKP-NH2. No effect on proliferation was noted when cytokines were added to AcSDKP-NH2. Conclusion PKH67 labelling method is a powerful tool for cell proliferation assessment in patients with AML, even in cells treated by various drugs.

  18. Cultural Backgrounds and Textual Appropriation

    Science.gov (United States)

    Shi, Ling

    2006-01-01

    This study examines interviews with 46 undergraduates to explore if participants with differing language and cultural backgrounds view plagiarism or textual appropriation primarily as a) a language problem because of a lack of words of one's own, or b) a cultural challenge as a result of either some first language (L1) cultural training to…

  19. Family Background and Educational Choices

    DEFF Research Database (Denmark)

    McIntosh, James; D. Munk, Martin

    enrollments, especially for females. Not only did the educational opportunities for individuals with disadvantaged backgrounds improve absolutely, but their relative position also improved. A similarly dramatic increase in attendance at university for the period 1985-2005 was found for these cohorts when...

  20. Low Background Micromegas in CAST

    CERN Document Server

    Garza, J.G.; Aznar, F.; Calvet, D.; Castel, J.F.; Christensen, F.E.; Dafni, T.; Davenport, M.; Decker, T.; Ferrer-Ribas, E.; Galán, J.; García, J.A.; Giomataris, I.; Hill, R.M.; Iguaz, F.J.; Irastorza, I.G.; Jakobsen, A.C.; Jourde, D.; Mirallas, H.; Ortega, I.; Papaevangelou, T.; Pivovaroff, M.J.; Ruz, J.; Tomás, A.; Vafeiadis, T.; Vogel, J.K.

    2015-11-16

    Solar axions could be converted into x-rays inside the strong magnetic field of an axion helioscope, triggering the detection of this elusive particle. Low background x-ray detectors are an essential component for the sensitivity of these searches. We report on the latest developments of the Micromegas detectors for the CERN Axion Solar Telescope (CAST), including technological pathfinder activities for the future International Axion Observatory (IAXO). The use of low background techniques and the application of discrimination algorithms based on the high granularity of the readout have led to background levels below 10$^{-6}$ counts/keV/cm$^2$/s, more than a factor 100 lower than the first generation of Micromegas detectors. The best levels achieved at the Canfranc Underground Laboratory (LSC) are as low as 10$^{-7}$ counts/keV/cm$^2$/s, showing good prospects for the application of this technology in IAXO. The current background model, based on underground and surface measurements, is presented, as well as ...

  1. Low Background Micromegas in CAST

    DEFF Research Database (Denmark)

    Garza, J G; Aune, S.; Aznar, F.

    2014-01-01

    of the Micromegas detectors for the CERN Axion Solar Telescope (CAST), including technological pathfinder activities for the future International Axion Observatory (IAXO). The use of low background techniques and the application of discrimination algorithms based on the high granularity of the readout have led...

  2. Teaching about Natural Background Radiation

    Science.gov (United States)

    Al-Azmi, Darwish; Karunakara, N.; Mustapha, Amidu O.

    2013-01-01

    Ambient gamma dose rates in air were measured at different locations (indoors and outdoors) to demonstrate the ubiquitous nature of natural background radiation in the environment and to show that levels vary from one location to another, depending on the underlying geology. The effect of a lead shield on a gamma radiation field was also…

  3. Cultural Change. Teacher Background Material.

    Science.gov (United States)

    Georgia Univ., Athens. Anthropology Curriculum Project.

    This essay on cultural change is intended to provide background reading material for teachers using "The Changing World Today" or "Cultural Change in Mexico and the United States," two textbooks from the Anthropology Curriculum Project. The essay can also be used, however, as a high school semester course in anthropology or as…

  4. Low background techniques in CANDLES

    Energy Technology Data Exchange (ETDEWEB)

    Nakajima, K., E-mail: kyohei@rcnp.osaka-u.ac.jp, E-mail: nkyohei@u-fukui.ac.jp [Research Center for Nuclear Physics, Osaka University, Ibaraki, Osaka 567-0047 (Japan); Graduate School of Engineering, University of Fukui, Fukui 910-8507 (Japan); Iida, T.; Matsuoka, K.; Nomachi, M.; Umehara, S. [Research Center for Nuclear Physics, Osaka University, Ibaraki, Osaka 567-0047 (Japan); Kishimoto, T. [Research Center for Nuclear Physics, Osaka University, Ibaraki, Osaka 567-0047 (Japan); Graduate School of Science, Osaka University, Toyonaka, Osaka 560-0043 (Japan); Chan, W. M.; Kakubata, H.; Li, X.; Maeda, T.; Ohata, T.; Temuge, B.; Tetsuno, K.; Trang, V. T. T.; Uehara, T.; Yoshida, S. [Graduate School of Science, Osaka University, Toyonaka, Osaka 560-0043 (Japan); Morishita, K.; Ogawa, I.; Sakamoto, K.; Tamagawa, Y. [Graduate School of Engineering, University of Fukui, Fukui 910-8507 (Japan); and others

    2015-08-17

    CANDLES is a double beta decay experiment using {sup 48}Ca in CaF{sub 2} crystals. The measurement is being performed with prototype detector (CANDLES III) for high sensitive measurement in the future. Recent status of detector improvements and background reduction techniques are described in this paper.

  5. UARS PEM Level 2 VMAG AC V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  6. Des tables pascales aux tables astronomiques et retour.

    Directory of Open Access Journals (Sweden)

    Max Lejbowicz

    2006-05-01

    Full Text Available L’article étudie la naissance et le développement du calendrier ecclésiastique chrétien, i. e. le comput, depuis les premiers témoignages de la célébration annuelle de la résurrection de Jésus jusqu’aux traductions des tables astronomiques arabes au xiie siècle. Il privilégie les procédures qui aboutissent à la détermination des dates pascales et à leur mise en forme tabulaire. Les analyses sont conduites à partir d’un double point de vue. L’un est scientifique. Il s’appuie sur les données astronomiques retenues par Ptolémée et sur l’apport de la tradition mathématique grecque au calcul par approximations. Les cycles soli-lunaires sont posés à partir des fractions continues et le cycle soli-hebdomadaire à partir du plus petit commun multiple. Le second point de vue est social : l’unification du comput participe à celle de la chrétienté comprise comme une configuration politico-religieuse. Deux conclusions s’imposent. Quelle que soit l’importance que la civilisation médiévale a attribuée au comput, il reste que : 1 / les Pâques sont porteuses de significations irréductibles aux techniques chronométriques qui inscrivent cette fête dans le déroulement de l’année ; 2 / ces techniques ont toutefois marqué profondément les curiosités intellectuelles des Latins et les ont préparé à accueillir avec ferveur les zīj et la numération de position.The article studies the birth and development of the Christian ecclesiastical calendar, i.e. the computus, from the first witnesses to the yearly celebration of the resurrection of Jesus to the translations of arabic astronomical tables in the 12th century. It focuses on the procedures which resulted in determinig the dates of Easter and their being put into tabular form. These analyses were undertaken from two perspectives. One was scientific, relying on the astronomical data preserved by Ptolemy and on the contribution of the Greek mathematical

  7. A Classification Table for Achondrites

    Science.gov (United States)

    Chennaoui-Aoudjehane, H.; Larouci, N.; Jambon, A.; Mittlefehldt, D. W.

    2014-01-01

    Classifying chondrites is relatively easy and the criteria are well documented. It is based on mineral compositions, textural characteristics and more recently, magnetic susceptibility. It can be more difficult to classify achondrites, especially those that are very similar to terrestrial igneous rocks, because mineralogical, textural and compositional properties can be quite variable. Achondrites contain essentially olivine, pyroxenes, plagioclases, oxides, sulphides and accessory minerals. Their origin is attributed to differentiated parents bodies: large asteroids (Vesta); planets (Mars); a satellite (the Moon); and numerous asteroids of unknown size. In most cases, achondrites are not eye witnessed falls and some do not have fusion crust. Because of the mineralogical and magnetic susceptibility similarity with terrestrial igneous rocks for some achondrites, it can be difficult for classifiers to confirm their extra-terrestrial origin. We -as classifiers of meteorites- are confronted with this problem with every suspected achondrite we receive for identification. We are developing a "grid" of classification to provide an easier approach for initial classification. We use simple but reproducible criteria based on mineralogical, petrological and geochemical studies. We presented the classes: acapulcoites, lodranites, winonaites and Martian meteorites (shergottite, chassignites, nakhlites). In this work we are completing the classification table by including the groups: angrites, aubrites, brachinites, ureilites, HED (howardites, eucrites, and diogenites), lunar meteorites, pallasites and mesosiderites. Iron meteorites are not presented in this abstract.

  8. AC Electrokinetics of Physiological Fluids for Biomedical Applications

    OpenAIRE

    Lu, Yi; Liu,Tingting; Lamanda, Ariana C.; Sin, Mandy L. Y.; Gau, Vincent; Liao, Joseph C.; Wong, Pak Kin

    2014-01-01

    AC electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration and separation, makes it possible to develop integrated systems for clinical diagnostics in non-traditional healthcare settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics based dia...

  9. CEC/ICMC'99. Superconduction. AC loss; Koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Amamiya, Naoyuki [Yokohama National University, Yokohama (Japan)

    1999-09-25

    Ten presentations of studies on AC loss of superconductive materials are outlined, which include theoretical expression for AC loss analysis in superconducting cable, frequency dependency of AC loss, effect of aspect ratio and sectional structure by magnetising loss measurement, and effect of base metal resistivity and twist pitch by numerical analysis. Presentations on AC superconduction for commercial frequency were almost all ones concerning to oxide superconductors. (NEDO)

  10. Vibration transfers to measure the performance of vibration isolated platforms on site using background noise excitation

    NARCIS (Netherlands)

    Segerink, Franciscus B.; Korterik, Jeroen P.; Offerhaus, Herman L.

    2011-01-01

    This article demonstrates a quick and easy way of quantifying the performance of a vibration-isolated platform. We measure the vibration transfer from floor to table using background noise excitation from the floor. As no excitation device is needed, our setup only requires two identical sensors (in

  11. The Periodic Table as a Mnemonic Device for Writing Electronic Configurations.

    Science.gov (United States)

    Mabrouk, Suzanne T.

    2003-01-01

    Presents an interactive method for using the periodic table as an effective mnemonic for writing electronic configurations. Discusses the intrinsic relevance of configurations to chemistry by building upon past analogies. Addresses pertinent background information, describes the hands-on method, and demonstrates its use. Transforms the traditional…

  12. Life table estimates of adult HIV/AIDS mortality in Addis Ababa ...

    African Journals Online (AJOL)

    Background: With the expansion of antiretroviral treatment in the country, HIV prevalence figures alone, are expected to become insufficient for monitoring the HIV/AIDS epidemic. Objective: To develop life table method for estimating AIDS mortality based on surveillance of deaths at burial sites in Addis Ababa. Methods: An ...

  13. Systematic review of implementation strategies for risk tables in the prevention of cardiovascular diseases.

    NARCIS (Netherlands)

    Steenkiste, B van; Grol, R.P.T.M.; Weijden, T.T. van der

    2008-01-01

    BACKGROUND: Cardiovascular disease prevention is guided by so-called risk tables for calculating individual's risk numbers. However, they are not widely used in routine practice and it is important to understand the conditions for their use. OBJECTIVES: Systematic review of the literature on

  14. A simple technique for a.c. conductivity measurements

    Indian Academy of Sciences (India)

    Unknown

    A.c. conductivity; complex impedance spectroscopy; bulk resistance; grain boundaries. 1. Introduction. A.c. conductivity is one of the studies done on solids in order to characterize the bulk resistance of the crystalline sample. Measurement of a.c. .... If Zs is purely resistive, there will be change in the amplitude. But if Zs is ...

  15. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  16. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  17. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area. (b...

  18. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  19. Evaluation of ac conductivity of rubber ferrite composites from ...

    Indian Academy of Sciences (India)

    They were then incorporated into a butyl rubber matrix according to a specific recipe. The a.c. electrical conductivity (a.c.) calculations were carried out by using the data available from dielectric measurements and by employing a simple relationship. The a.c. conductivity values were found to be of the order of 10–3 S/m.

  20. 7 CFR 944.503 - Table Grape Import Regulation 4.

    Science.gov (United States)

    2010-01-01

    ... Vinifera species table grapes, except Emperor, Calmeria, Almeria, and Ribier varieties, is prohibited... Table, as set forth in the United States Standards for Grades of Table Grapes (European or Vinifera Type...

  1. Medicaid Analytic eXtract (MAX) Rx Table Listing

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Statistical Compendium table listing (below) enables users to choose to view Medicaid prescription drug tables for 1999 - 2009, and to select the tables for the...

  2. Background stratospheric aerosol reference model

    Science.gov (United States)

    Mccormick, M. P.; Wang, P.

    1989-01-01

    In this analysis, a reference background stratospheric aerosol optical model is developed based on the nearly global SAGE 1 satellite observations in the non-volcanic period from March 1979 to February 1980. Zonally averaged profiles of the 1.0 micron aerosol extinction for the tropics and the mid- and high-altitudes for both hemispheres are obtained and presented in graphical and tabulated form for the different seasons. In addition, analytic expressions for these seasonal global zonal means, as well as the yearly global mean, are determined according to a third order polynomial fit to the vertical profile data set. This proposed background stratospheric aerosol model can be useful in modeling studies of stratospheric aerosols and for simulations of atmospheric radiative transfer and radiance calculations in atmospheric remote sensing.

  3. Evaluation of 225Ac decay data.

    Science.gov (United States)

    Xiaolong, Huang; Baosong, Wang

    2007-06-01

    Evaluation of the complete decay scheme and data for (225)Ac including new measurements are presented in this report; literature data available up to March 2006 are included. The half-life is determined to be 10.0+/-0.1 days. All known measured gamma-ray relative intensities have been examined; the gamma-ray emission probability of the reference gamma-ray line of 150.04 keV is recommended to be 0.693+/-0.012%. The calculated internal conversion coefficients and their uncertainties have been used to obtain the complete decay intensity balance. The other decay characteristics are calculated using the ENSDF analysis program. Finally, the new decay scheme for (225)Ac is presented.

  4. Estimating COCOM Natural Background Dormancy

    Science.gov (United States)

    2015-04-01

    affected by the location and the types of vegetation being as- sessed. Hmimina et al. (2013) found that among five biomes —temperate deciduous forests ...distribution is unlimited. Cover photo: upper left, verdant deciduous trees, White Mountain Forest , New...brown, forest green, and partly white, the latter consisting of white and the local background color. The atlas contains 72 maps: 12 monthly maps

  5. Comparing Cosmic Microwave Background Datasets

    OpenAIRE

    Knox, L.; Bond, J..R.; Jaffe, A. H.; Segal, M; Charbonneau, D

    1998-01-01

    To extract reliable cosmic parameters from cosmic microwave background datasets, it is essential to show that the data are not contaminated by residual non-cosmological signals. We describe general statistical approaches to this problem, with an emphasis on the case in which there are two datasets that can be checked for consistency. A first visual step is the Wiener filter mapping from one set of data onto the pixel basis of another. For more quantitative analyses we develop and apply both B...

  6. The Astronomical Tables of Moses Farissol Botarel

    OpenAIRE

    Goldstein, Bernard R.; Chabás, José

    2017-01-01

    Moses Farissol Botarel (Avignon, late fifteenth century) was an astronomer who wrote in Hebrew and continued various traditions that depended on astronomy in al-Andalus which, in turn, derived in large part from the zij of al-Battānī (Raqqa, d. 929). His astronomical tables are unusual in that they combine elements from the Parisian Alfonsine Tables with elements from the tables of Levi ben Gerson (Orange, France, d. 1344), Immanuel ben Jacob Bonfils (Tarascon, France, fl. 1350), and Jacob be...

  7. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  8. Energetics of Table Tennis and Table Tennis-Specific Exercise Testing.

    Science.gov (United States)

    Zagatto, Alessandro Moura; Leite, Jorge Vieira de Mello; Papoti, Marcelo; Beneke, Ralph

    2016-11-01

    To test the hypotheses that the metabolic profile of table tennis is dominantly aerobic, anaerobic energy is related to the accumulated duration and intensity of rallies, and activity and metabolic profile are interrelated with the individual fitness profile determined via table tennis-specific tests. Eleven male experienced table tennis players (22 ± 3 y, 77.6 ± 18.9 kg, 177.1 ± 8.1 cm) underwent 2 simulated table tennis matches to analyze aerobic (WOXID) energy, anaerobic glycolytic (WBLC) energy, and phosphocreatine breakdown (WPCr); a table tennis-specific graded exercise test to measure ventilatory threshold and peak oxygen uptake; and an exhaustive supramaximal table tennis effort to determine maximal accumulated deficit of oxygen. WOXID, WBLC, and WPCr corresponded to 96.5% ± 1.7%, 1.0% ± 0.7%, and 2.5% ± 1.4%, respectively. WOXID was interrelated with rally duration (r = .81) and number of shots per rally (r = .77), whereas match intensity was correlated with WPCr (r = .62) and maximal accumulated oxygen deficit (r = .58). The metabolic profile of table tennis is predominantly aerobic and interrelated with the individual fitness profile determined via table tennis-specific tests. Table tennis-specific ventilatory threshold determines the average oxygen uptake and overall WOXID, whereas table tennis-specific maximal accumulated oxygen deficit indicates the ability to use and sustain slightly higher blood lactate concentration and WBLC during the match.

  9. Direct amplitude detuning measurement with ac dipole

    Science.gov (United States)

    White, S.; Maclean, E.; Tomás, R.

    2013-07-01

    In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning). The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  10. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  11. Influence of passive leg movements on blood circulation on the tilt table in healthy adults

    Directory of Open Access Journals (Sweden)

    Czell David

    2004-10-01

    Full Text Available Abstract Background One problem in the mobilization of patients with neurological diseases, such as spinal cord injury, is the circulatory collapse that occurs while changing from supine to vertical position because of the missing venous pump due to paralyzed leg muscles. Therefore, a tilt table with integrated stepping device (tilt stepper was developed, which allows passive stepping movements for performing locomotion training in an early state of rehabilitation. The aim of this pilot study was to investigate if passive stepping and cycling movements of the legs during tilt table training could stabilize blood circulation and prevent neurally-mediated syncope in healthy young adults. Methods In the first experiment, healthy subjects were tested on a traditional tilt table. Subjects who had a syncope or near-syncope in this condition underwent a second trial on the tilt stepper. In the second experiment, a group of healthy subjects was investigated on a traditional tilt table, the second group on the tilt ergometer, a device that allows cycling movements during tilt table training. We used the chi-square test to compare the occurrence of near-syncope/syncope in both groups (tilt table/tilt stepper and tilt table/tilt ergometer and ANOVA to compare the blood pressure and heart rate between the groups at the four time intervals (supine, at 2 minutes, at 6 minutes and end of head-up tilt. Results Separate chi-square tests performed for each experiment showed significant differences in the occurrence of near syncope or syncope based on the device used. Comparison of the two groups (tilt stepper/ tilt table in experiment one (ANOVA showed that blood pressure was significantly higher at the end of head-up tilt on the tilt stepper and on the tilt table there was a greater increase in heart rate (2 minutes after head-up tilt. Comparison of the two groups (tilt ergometer/tilt table in experiment 2 (ANOVA showed that blood pressure was significantly

  12. Topologically protected ac transport in zigzag silicene nanosystem

    Science.gov (United States)

    Ye, En-Jia; Sun, Yun-Lei; Yang, Guo-Feng; Chen, Guo-Qing

    2017-04-01

    The linear ac transport properties are investigated theoretically in zigzag silicene nanoribbon and nanojunction systems. Based on the tight-binding approach and ac response theory, we compute the dc conductance and ac emittance. The topologically protected edge states and eliminated ac emittance are presented around the Dirac point. Emittances as functions of the strength of spin-orbital interaction (SOI) and geometric size of the silicene systems are studied. The results show that the eliminated ac response behavior is induced by the strong SOI and is topologically protected against the size variation.

  13. Authenticated hash tables

    DEFF Research Database (Denmark)

    Triandopoulos, Nikolaos; Papamanthou, Charalampos; Tamassia, Roberto

    2008-01-01

    Hash tables are fundamental data structures that optimally answer membership queries. Suppose a client stores n elements in a hash table that is outsourced at a remote server so that the client can save space or achieve load balancing. Authenticating the hash table functionality, i.e., verifying ...... fixed constants 0 1/ε, the server can provide a proof of integrity of the answer to a (non-)membership query in constant time, requiring O(nε/logκε--1 n) time to treat updates, yet keeping the communication and verification costs constant. This is the first construction...... for authenticating a hash table with constant query cost and sublinear update cost. Our solution employs the RSA accumulator in a nested way over the stored data, strictly improving upon previous accumulator-based solutions. Our construction applies to two concrete data authentication models and lends itself...

  14. Stark broadening parameter tables for In II

    Directory of Open Access Journals (Sweden)

    Dimitrijević M.S.

    2000-01-01

    Full Text Available Electron-, proton-, and ionized helium-impact broadening parameter tables for In II spectral lines, are presented as a function of the temperature and the perturber density. Calculations have been performed within the semiclassical perturbation approach.

  15. Map and table of world copper smelters

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This map and table comprise information on 124 world copper smelters (2 of which are closed and 1 of which is under development) and 4 (low-grade solvent...

  16. Ecological periodic tables: In principle and practice

    Science.gov (United States)

    The chemical periodic table, the Linnaean system of classification and the Hertzsprung-Russell diagram are iconic information organizing structure in chemistry, biology and astronomy, respectively, because they are simple, exceptionally useful and they foster the expansion of sci...

  17. Installation Torque Tables for Noncritical Applications

    Science.gov (United States)

    Rivera-Rosario, Hazel T.; Powell, Joseph S.

    2017-01-01

    The objective of this project is to define torque values for bolts and screws when loading is not a concern. Fasteners require a certain torque to fulfill its function and prevent failure. NASA Glenn Research Center did not have a set of fastener torque tables for non-critical applications without loads, usually referring to hand-tight or wrench-tight torqueing. The project is based on two formulas, torque and pullout load. Torque values are calculated giving way to preliminary data tables. Testing is done to various bolts and metal plates, torqueing them until the point of failure. Around 640 torque tables were developed for UNC, UNF, and M fasteners. Different lengths of thread engagement were analyzed for the 5 most common materials used at GRC. The tables were put together in an Excel spreadsheet and then formatted into a Word document. The plan is to later convert this to an official technical publication or memorandum.

  18. The astronomical tables of Giovanni Bianchini

    CERN Document Server

    Chabas, Jose

    2009-01-01

    This book describes and analyses, for the first time, the astronomical tables of Giovanni Bianchini of Ferrara (d. after 1469), explains their context, inserts them into an astronomical tradition that began in Toledo, and addresses their diffusion.

  19. Extreme dynamic compression with a table top laser

    Science.gov (United States)

    Armstrong, Michael; Crowhurst, Jonathan; Radousky, Harry; Zaug, Joseph

    2015-03-01

    Recently, it was shown that the energy required for laser driven dynamic compression experiments varies as the third power of the compression time, where the compression time must be larger than the equilibration time in the sample. Traditional dynamic compression experiments typically have drive times greater than 10 ns, but a wide range of materials equilibrate on substantially faster time scales, which should enable such materials to be compressed on much shorter time scales. So, for materials which equilibrate on a sub-nanosecond time scale, ultrafast dynamic compression has the potential to substantially reduce the laser energy required to obtain highly compressed states of matter. This has been demonstrated for sub-Mbar pressures with <100 μJ energy laser drive pulses, where the laser drive energy per unit density change is as much as 109 smaller than longer time scale experiments. Although these results are promising, extreme pressures (up to 10 Mbar) have not yet been observed with table-top scale laser systems. Here we present results for ultrafast laser driven shock experiments using up to 500x more drive intensity than our previous work, which, by conventional scaling, should result in dynamic pressures previously only accessible to facility scale instruments. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

  20. TableMaker: An Excel Macro for Publication-Quality Tables

    Directory of Open Access Journals (Sweden)

    Marek Hlavac

    2016-04-01

    Full Text Available This article introduces TableMaker, a Microsoft Excel macro that produces publicationquality tables and includes them as new sheets in workbooks. The macro provides an intuitive graphical user interface that allows for the full customization of all table features. It also allows users to save and load table templates, and thus allows layouts to be both reproducible and transferable. It is distributed in a single computer file. As such, the macro is easy to share, as well as accessible to even beginning and casual users of Excel. Since it allows for the quick creation of reproducible and fully customizable tables, TableMaker can be very useful to academics, policy-makers and businesses by making the presentation and formatting of results faster and more efficient.

  1. Genetic warfarin dosing: tables versus algorithms.

    Science.gov (United States)

    Finkelman, Brian S; Gage, Brian F; Johnson, Julie A; Brensinger, Colleen M; Kimmel, Stephen E

    2011-02-01

    The aim of this study was to compare the accuracy of genetic tables and formal pharmacogenetic algorithms for warfarin dosing. Pharmacogenetic algorithms based on regression equations can predict warfarin dose, but they require detailed mathematical calculations. A simpler alternative, recently added to the warfarin label by the U.S. Food and Drug Administration, is to use genotype-stratified tables to estimate warfarin dose. This table may potentially increase the use of pharmacogenetic warfarin dosing in clinical practice; however, its accuracy has not been quantified. A retrospective cohort study of 1,378 patients from 3 anticoagulation centers was conducted. Inclusion criteria were stable therapeutic warfarin dose and complete genetic and clinical data. Five dose prediction methods were compared: 2 methods using only clinical information (empiric 5 mg/day dosing and a formal clinical algorithm), 2 genetic tables (the new warfarin label table and a table based on mean dose stratified by genotype), and 1 formal pharmacogenetic algorithm, using both clinical and genetic information. For each method, the proportion of patients whose predicted doses were within 20% of their actual therapeutic doses was determined. Dosing methods were compared using McNemar's chi-square test. Warfarin dose prediction was significantly more accurate (all p algorithm (52%) than with all other methods: empiric dosing (37%; odds ratio [OR]: 2.2), clinical algorithm (39%; OR: 2.2), warfarin label (43%; OR: 1.8), and genotype mean dose table (44%; OR: 1.9). Although genetic tables predicted warfarin dose better than empiric dosing, formal pharmacogenetic algorithms were the most accurate. Copyright © 2011 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

  2. IUPAC Periodic Table of the Isotopes

    Science.gov (United States)

    Holden, N.E.; Coplen, T.B.; Böhlke, J.K.; Wieser, M.E.; Singleton, G.; Walczyk, T.; Yoneda, S.; Mahaffy, P.G.; Tarbox, L.V.

    2011-01-01

    For almost 150 years, the Periodic Table of the Elements has served as a guide to the world of elements by highlighting similarities and differences in atomic structure and chemical properties. To introduce students, teachers, and society to the existence and importance of isotopes of the chemical elements, an IUPAC Periodic Table of the Isotopes (IPTI) has been prepared and can be found as a supplement to this issue.

  3. Listing of Available ACE Data Tables

    Energy Technology Data Exchange (ETDEWEB)

    Conlin, Jeremy Lloyd [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-31

    This document is divided into multiple sections. Section 2 lists some of the more frequently used ENDF/B reaction types that can be used with the FM input card. The remaining sections (described below) contain tables showing the available ACE data tables for various types of data. These ACE data libraries are distributed by the Radiation Safety Information Computational Center (RSICC) with MCNP6.

  4. Particle propagation in cosmological backgrounds

    CERN Document Server

    Arteaga, Daniel

    2007-01-01

    We study the quantum propagation of particles in cosmological backgrounds, by considering a doublet of massive scalar fields propagating in an expanding universe, possibly filled with radiation. We focus on the dissipative effects related to the expansion rate. At first order, we recover the expected result that the decay rate is determined by the local temperature. Beyond linear order, the decay rate has an additional contribution governed by the expansion parameter. This latter contribution is present even for stable particles in the vacuum. Finally, we analyze the long time behaviour of the propagator and briefly discuss applications to the trans-Planckian question.

  5. [Toothache with a neuropathic background].

    Science.gov (United States)

    Khatchaturian, V; de Wijer, A; Kalaykova, S I; Steenks, M H

    2015-03-01

    A 48-year old woman in good general health was referred to the orofacial pain clinic in a centre for special dentistry with a toothache in the premolar region of the left maxillary quadrant. The complaints had existed for 15 years and various dental treatments, including endodontic treatments, apical surgery, extraction and splint therapy, had not helped to alleviate the complaints. As a result of the fact that anti-epileptic drugs were able to reduce the pain it was concluded that this 'toothache' satisfied the criteria of an atypical odontalgia: 'toothache' with a neuropathic background.

  6. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented. © 2014 Society for Laboratory Automation and Screening.

  7. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  8. Mortality after clopidogrel in the non-invasive PLATO cohort and TRILOGY ACS trial: another mismatched death paradox.

    Science.gov (United States)

    Serebruany, Victor L; DiNicolantonio, James J; Can, Mehmet Mustafa; Dukhanin, Alexander; Tomek, Ales

    2013-09-30

    Excess mortality especially in the clopidogrel arm of the PLATO trial raise concerns of data integrity, and call for independent verification of vital records in the national death registries. Recently published data focused on outcomes in patients after non-invasive strategies yielded from the PLATO (PLATO-NIS) and TRILOGY ACS trials allowing comparison of all cause mortality (ACM) between trials. To compare the prorated over follow-up duration rates of ACM in the clopidogrel arms of PLATO-NIS cohort and TRILOGY ACS trial. The background clinical characteristics indicate similar if not higher mortality should be expected in TRILOGY ACS. PLATO trial was almost half the duration with a mean follow-up of 277 days compared to TRILOGY ACS (513 days). Matching prorated over follow-up duration of ACM rates in the clopidogrel arm revealed 0.027/day or 9.86% yearly mortality in PLATO-NIS cohort (195 fatalities among 2615 patients enrolled). The ACM rates in TRILOGY ACS (409/4663) were only 0.017/day or 6.2% annually after clopidogrel, suggesting that the risk to die in the control PLATO-NIS group was 63% higher and barely missed significance (p=0.051) compared to TRILOGY ACS. Prorated over length of follow-up PLATO-NIS mortality rates after clopidogrel far exceeded those observed in a similar medically managed patients in a TRILOGY ACS trial. The background clinical differences between trials are not responsible for the elevated PLATO-NIS mortality numbers. These data further challenge the death paradox reported in the overall PLATO trial and call for the urgent independent verification of vital records. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  9. A short form of the Autonomy Scale: properties of the Autonomy-Connectedness Scale (ACS-30).

    Science.gov (United States)

    Bekker, Marrie H J; van Assen, Marcel A L M

    2006-02-01

    The Autonomy Scale (Bekker, 1993) measures individual differences in gender-linked autonomy, a psychological condition resulting from the process of individuation and separation. The theoretical background of the concept is found in a combination of feminist, neoanalytical object relations theory and attachment theory. The 3 subscales are Self-Awareness, Sensitivity to Others, and Capacity for Managing New Situations. We report the development and properties of the Autonomy-Connectedness Scale (ACS-30), a shortened 30-item version of the Autonomy Scale. We present 2 studies. In the first study, we examined the structure of the scale as well as its validity and reliability. The second study was aimed at further validation by relating the ACS-30 to various indexes of psychopathology. Exploratory as well as confirmatory factor analyses provided support for a 3-factor structure that was identical to that of the original scale. The ACS-30 showed good internal consistency reliability and an expected pattern of convergent validity with personality and mental health variables. The psychometric properties of the ACS-30 suggest it can be used to assess gender-linked autonomy. It also has the advantage of being more economical and simple as compared with the original 50-item version.

  10. Immunopathogenic Background of Pars Planitis.

    Science.gov (United States)

    Przeździecka-Dołyk, Joanna; Węgrzyn, Agnieszka; Turno-Kręcicka, Anna; Misiuk-Hojło, Marta

    2016-04-01

    Pars planitis is defined as an intermediate uveitis of unknown background of systemic disease with characteristic formations such as vitreous snowballs, snowbanks and changes in peripheral retina. The incidence of pars planitis varies 2.4-15.4 % of the uveitis patients. The pathogenesis of the disease is to be determined in future. Clinical and histopathological findings suggest an autoimmune etiology, most likely as a reaction to endogenous antigen of unknown source, with T cells predominant in both vitreous and pars plana infiltrations. T cells subsets play an important role as a memory-effector peripheral cell. Snowbanks are formed as an effect of post inflammatory glial proliferation of fibrous astrocytes. There is also a genetic predisposition for pars planitis by human leukocyte antigen and several other genes. A coexistence of multiple sclerosis and optic neuritis has been described in numerous studies. Epiretinal membrane, cataract, cystoid macular edema, retinal detachment, retinal vasculitis, neovascularization, vitreous peripheral traction, peripheral hole formation, vitreous hemorrhage, disc edema are common complications observed in pars planitis. There is a need to expand the knowledge of the pathogenic and immunologic background of the pars planitis to create an accurate pharmacological treatment.

  11. Optical polarization: background and camouflage

    Science.gov (United States)

    Škerlind, Christina; Hallberg, Tomas; Eriksson, Johan; Kariis, Hans; Bergström, David

    2017-10-01

    Polarimetric imaging sensors in the electro-optical region, already military and commercially available in both the visual and infrared, show enhanced capabilities for advanced target detection and recognition. The capabilities arise due to the ability to discriminate between man-made and natural background surfaces using the polarization information of light. In the development of materials for signature management in the visible and infrared wavelength regions, different criteria need to be met to fulfil the requirements for a good camouflage against modern sensors. In conventional camouflage design, the aimed design of the surface properties of an object is to spectrally match or adapt it to a background and thereby minimizing the contrast given by a specific threat sensor. Examples will be shown from measurements of some relevant materials and how they in different ways affect the polarimetric signature. Dimensioning properties relevant in an optical camouflage from a polarimetric perspective, such as degree of polarization, the viewing or incident angle, and amount of diffuse reflection, mainly in the infrared region, will be discussed.

  12. Characterization of nonlinear background components in voltammetry by use of large amplitude periodic perturbations and fourier transform analysis.

    Science.gov (United States)

    Bond, Alan M; Duffy, Noel W; Elton, Darrell M; Fleming, Barry D

    2009-11-01

    Under most experimental conditions, a distinctly nonlinear background current is encountered in all forms of voltammetry which arises from the potential dependence of the capacitance. The nonlinear background current has been successfully modeled under large amplitude sinusoidal ac voltammetric conditions with a fourth order polynomial. The model was applied to a dummy cell containing a nonideal ceramic capacitor and commonly used electrodes. The nonlinearity in behavior of the background capacitance is particularly significant when considering the discrimination between the Faradaic and background contributions in the higher order harmonics resolved in ac voltammetry by Fourier transform-inverse Fourier transform approaches and in the simulation of the background current and hence double-layer capacitance as a function of potential. Typically, measurable background current under large amplitude conditions is detectable in the dc and fundamental to fourth harmonic components in large amplitude ac voltammetry. For analytical purposes, this background current can be corrected on a per harmonic basis without the need for any model. Background correction has been successfully applied to the first four harmonics for the oxidation of ferrocenemonocarboxylic acid over the concentration range of 5-500 microM in aqueous 0.5 M NaCl solution.

  13. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    OpenAIRE

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  14. Comportamento Acústico de Fachadas: Isolamento Acústico versus Permeabilidade ao Ar

    OpenAIRE

    Ferreira, Diogo Miguel do Rosário

    2016-01-01

    Nos dias de hoje, o conforto acústico dos edifícios revela-se como um factor muito importante no contexto da comodidade global dos seus habitantes. Para tanto, contribui de forma relevante o isolamento sonoro que as fachadas dos edifícios possam assegurar. Sendo as fachadas constituídas por uma parte opaca e uma outra translúcida, é esta última a que mais condiciona o isolamento acústico que o elemento fachada proporciona, o qual é influenciado tanto pela janela propriamente dita, como pelas ...

  15. Background paper on aquaculture research

    DEFF Research Database (Denmark)

    Wenblad, Axel; Jokumsen, Alfred; Eskelinen, Unto

    The Board of MISTRA established in 2012 a Working Group (WG) on Aquaculture to provide the Board with background information for its upcoming decision on whether the foundation should invest in aquaculture research. The WG included Senior Advisor Axel Wenblad, Sweden (Chairman), Professor Ole...... due to the availability of vast water resources of good quality (both marine and fresh water), a high veterinary status and generally well developed public infrastructure. Swedish aquaculture has the potential to develop into a green business producing environmentally sustainable healthy food with low...... of adequate funding from national and international sources (e.g. EMFF, research councils, EU, Nordic and BONUS). Finally, the financial sector should be made more confident with aquaculture to facilitate investments in aquaculture. The integration of environmental, economic and social sustainability...

  16. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  17. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  18. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  19. The Background to Current Theories of Scuffing

    Science.gov (United States)

    1973-01-01

    m "■"«""*"’ .’i1 ■ ’pi^wnMmippvmK Sprague and Cunningham (39) have shown that such interference can be quite selective. They noted that calcium ...found that it was mainly white etching, but that here and there a patch of the original ferrite remained. From this he deduced that the Ac...temperature had been exceeded in the surface, but not the Ac- temperature, during the firing of the shell. So most of the original ferrite had been

  20. 7 CFR 51.914 - Metric conversion table.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Metric conversion table. 51.914 Section 51.914... STANDARDS) United States Standards for Grades of Table Grapes (European or Vinifera Type) 1 Metric Conversion Table § 51.914 Metric conversion table. Inches Millimeters (mm) 3/16 equals 12.7 9/16 equals 14.3...

  1. Verification of aerial photo stand volume tables for southeast Alaska.

    Science.gov (United States)

    Theodore S. Setzer; Bert R. Mead

    1988-01-01

    Aerial photo volume tables are used in the multilevel sampling system of Alaska Forest Inventory and Analysis. These volume tables are presented with a description of the data base and methods used to construct the tables. Volume estimates compiled from the aerial photo stand volume tables and associated ground-measured values are compared and evaluated.

  2. 40 CFR Table 7 to Subpart Vvvvvv... - Partially Soluble HAP

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 14 2010-07-01 2010-07-01 false Partially Soluble HAP 7 Table 7 to... Pt. 63, Subpt. VVVVVV, Table 7 Table 7 to Subpart VVVVVV of Part 63—Partially Soluble HAP As required... partially soluble HAP listed in the following table. Partially soluble HAP name CAS No. 1. 1,1,1...

  3. 26 CFR 1.807-1 - Mortality and morbidity tables.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Mortality and morbidity tables. 1.807-1 Section... (CONTINUED) INCOME TAXES Investment Income § 1.807-1 Mortality and morbidity tables. (a) Tables to be used... is issued, then the mortality and morbidity tables set forth in this subsection are used to compute...

  4. 40 CFR 89.420 - Background sample.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Background sample. 89.420 Section 89... Procedures § 89.420 Background sample. (a) Background samples are produced by continuously drawing a sample... background samples may be produced and analyzed for each mode. Hence, a unique background value will be used...

  5. The Wild Aviolyt AC 1/Aviotab TA 2 - A computer controlled photogrammetric system

    Science.gov (United States)

    Kreiling, W.; Hasler, A.

    1980-10-01

    The Aviolyt AC 1/Aviotab TA 2 is designed to meet the highest requirements of photogrammetry in precision, flexibility, economy and reliability while also handling problems in the area of research and in the university. There are three basic components, an optical-mechanical unit with an integrated computer console, an electronics cabinet with the process computer, and the TA 2 digital-servo plotting table. The applications of the system are expanded by a wide range of accessories including a zoom system, plotting tools, and a magnetic tape unit among others. The computer software incorporates an operation system, a program library and a series of accessory programs that edit, interpret and debug. The system software is designed under principles of interactive operation, with several programs having individual logical unity.

  6. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  7. single-phase dc phase dc-ac boost converter ac boost converter

    African Journals Online (AJOL)

    User

    This paper describes a new power conversion circuit dc-dc boost converter. It boost converter. It boost converter. It comprises an H comprises an H. Change of load .... A full-wave rectified signal is used to produce an AC reference voltage v* o. The outer voltage loop generates the reference current command i* f. A common.

  8. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  9. Acid rain: a background report

    Energy Technology Data Exchange (ETDEWEB)

    Glustrom, L.; Stolzenberg, J.

    1982-07-08

    This Staff Brief was prepared for the Wisconsin Legislative Council's Special Committee on Acid Rain to provide an introduction to the issue of acid rain. It is divided into four parts. Part I provides an overview on the controversies surrounding the measurement, formation and effects of acid rain. As described in Part I, the term acid rain is used to describe the deposition of acidic components through both wet deposition (e.g., rain or snow) and dry deposition (e.g., direct contact between atmospheric constituents and the land, water or vegetation of the earth). Part II presents background information on state agency activities relating to acid rain in Wisconsin, describes what is known about the occurrence of, susceptibility to and effects of acid rain in Wisconsin, and provides information related to man-made sources of sulfur and nitrogen oxides in Wisconsin. Part III describes major policies and regulations relating to acid rain which have been or are being developed jointly by the United States and Canadian governments, by the United States government and by the State of Wisconsin. Part IV briefly discusses possible areas for Committee action.

  10. Plenoptic background oriented schlieren imaging

    Science.gov (United States)

    Klemkowsky, Jenna N.; Fahringer, Timothy W.; Clifford, Christopher J.; Bathel, Brett F.; Thurow, Brian S.

    2017-09-01

    The combination of the background oriented schlieren (BOS) technique with the unique imaging capabilities of a plenoptic camera, termed plenoptic BOS, is introduced as a new addition to the family of schlieren techniques. Compared to conventional single camera BOS, plenoptic BOS is capable of sampling multiple lines-of-sight simultaneously. Displacements from each line-of-sight are collectively used to build a four-dimensional displacement field, which is a vector function structured similarly to the original light field captured in a raw plenoptic image. The displacement field is used to render focused BOS images, which qualitatively are narrow depth of field slices of the density gradient field. Unlike focused schlieren methods that require manually changing the focal plane during data collection, plenoptic BOS synthetically changes the focal plane position during post-processing, such that all focal planes are captured in a single snapshot. Through two different experiments, this work demonstrates that plenoptic BOS is capable of isolating narrow depth of field features, qualitatively inferring depth, and quantitatively estimating the location of disturbances in 3D space. Such results motivate future work to transition this single-camera technique towards quantitative reconstructions of 3D density fields.

  11. Calibration free method for measurement of the AC magnetization loss

    Energy Technology Data Exchange (ETDEWEB)

    Souc, Jan [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Goemoery, Fedor [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Vojenciak, Michal [Department of Power Electrical Systems, University of Zilina, Vel' ky diel, 010 26 Zilina (Slovakia)

    2005-05-01

    A calibration free measurement method for determination of the magnetization loss of superconducting samples exposed to the external AC magnetic field is presented. The idea is based on the measurement of the part of the power which is supplied by the AC source to the AC magnet generating the magnetic field, in which the sample is located. It uses a coil wound in parallel to the AC field magnet as the measurement coil. To achieve the necessary sensitivity, two identical systems are used, each consisting of an AC magnet and a measurement coil, one of them containing the sample and the other left empty. No measurement and/or calculation of the calibration constant is required. To confirm the suitability of this method, the loss of a Cu sample with known dissipation was measured. The applicability to the AC magnetization loss measurements of superconducting tapes is presented.

  12. QTL Information Table: 770 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available qAC-6 Physiological trait Eating quality Amylose content SSR C)Interval DHL Wuyujin...apping quantitative trait loci underlying the cooking and eating quality of rice using a DH population Molecular Breeding 15, 117-124. ...

  13. Ancient Maya astronomical tables from Xultun, Guatemala.

    Science.gov (United States)

    Saturno, William A; Stuart, David; Aveni, Anthony F; Rossi, Franco

    2012-05-11

    Maya astronomical tables are recognized in bark-paper books from the Late Postclassic period (1300 to 1521 C.E.), but Classic period (200 to 900 C.E.) precursors have not been found. In 2011, a small painted room was excavated at the extensive ancient Maya ruins of Xultun, Guatemala, dating to the early 9th century C.E. The walls and ceiling of the room are painted with several human figures. Two walls also display a large number of delicate black, red, and incised hieroglyphs. Many of these hieroglyphs are calendrical in nature and relate astronomical computations, including at least two tables concerning the movement of the Moon, and perhaps Mars and Venus. These apparently represent early astronomical tables and may shed light on the later books.

  14. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  15. Non-vanishing ponderomotive AC electrophoretic effect for particle trapping

    Energy Technology Data Exchange (ETDEWEB)

    Guan, Weihau [Yale University; Park, Jae Hyun nmn [ORNL; Krstic, Predrag S [ORNL; Reed, Mark A [Yale University

    2011-01-01

    We present here a study on overlooked aspects of alternating current (AC) electrokinetics AC electrophoretic (ACEP) phenomena. The dynamics of a particle with both polarizability and net charges in a non-uniform AC electric trapping field is investigated. It is found that either electrophoretic (EP) or dielectrophoretic (DEP) effects can dominate the trapping dynamics, depending on experimental conditions. A dimensionless parameter gamma is developed to predict the relative strength of EP and DEP effects in a quadrupole AC field. An ACEP trap is feasible for charged particles in salt-free or low salt concentration solutions. In contrast to DEP traps, an ACEP trap favors the downscaling of the particle size.

  16. A contingency table approach to nonparametric testing

    CERN Document Server

    Rayner, JCW

    2000-01-01

    Most texts on nonparametric techniques concentrate on location and linear-linear (correlation) tests, with less emphasis on dispersion effects and linear-quadratic tests. Tests for higher moment effects are virtually ignored. Using a fresh approach, A Contingency Table Approach to Nonparametric Testing unifies and extends the popular, standard tests by linking them to tests based on models for data that can be presented in contingency tables.This approach unifies popular nonparametric statistical inference and makes the traditional, most commonly performed nonparametric analyses much more comp

  17. Mathematics of Periodic Tables for Benzenoid Hydrocarbons.

    Science.gov (United States)

    Dias, Jerry Ray

    2007-01-01

    The upper and lower bounds for invariants of polyhex systems based on the Harary and Harborth inequalities are studied. It is shown that these invariants are uniquely correlated by the Periodic Table for Benzenoid Hydrocarbons. A modified periodic table for total resonant sextet (TRS) benzenoids based on the invariants of Ds and r(empty) is presented; Ds is the number of disconnections among the empty rings for fused TRS benzenoid hydrocarbons. This work represents a contribution toward deciphering the topological information content of benzenoid formulas.

  18. Comparison of the Accuracy and Speed of Transient Mobile A/C System Simulation Models: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Kiss, T.; Lustbader, J.

    2014-03-01

    The operation of air conditioning (A/C) systems is a significant contributor to the total amount of fuel used by light- and heavy-duty vehicles. Therefore, continued improvement of the efficiency of these mobile A/C systems is important. Numerical simulation has been used to reduce the system development time and to improve the electronic controls, but numerical models that include highly detailed physics run slower than desired for carrying out vehicle-focused drive cycle-based system optimization. Therefore, faster models are needed even if some accuracy is sacrificed. In this study, a validated model with highly detailed physics, the 'Fully-Detailed' model, and two models with different levels of simplification, the 'Quasi-Transient' and the 'Mapped- Component' models, are compared. The Quasi-Transient model applies some simplifications compared to the Fully-Detailed model to allow faster model execution speeds. The Mapped-Component model is similar to the Quasi-Transient model except instead of detailed flow and heat transfer calculations in the heat exchangers, it uses lookup tables created with the Quasi-Transient model. All three models are set up to represent the same physical A/C system and the same electronic controls. Speed and results of the three model versions are compared for steady state and transient operation. Steady state simulated data are also compared to measured data. The results show that the Quasi-Transient and Mapped-Component models ran much faster than the Fully-Detailed model, on the order of 10- and 100-fold, respectively. They also adequately approach the results of the Fully-Detailed model for steady-state operation, and for drive cycle-based efficiency predictions

  19. ACS6, a Hydrogen sulfide-donating derivative of sildenafil, inhibits homocysteine-induced apoptosis by preservation of mitochondrial function

    Directory of Open Access Journals (Sweden)

    Tang Xiao-Qing

    2011-08-01

    Full Text Available Abstract Background The hydrogen sulfide-releasing sildenafil, ACS6, has been demonstrated to inhibit superoxide formation through donating hydrogen sulfide (H2S. We have found that H2S antagonizes homocysteine-induced oxidative stress and neurotoxicity. The aim of the present study is to explore the protection of ACS6 against homocysteine-triggered cytotoxicity and apoptosis and the molecular mechanisms underlying in PC12 cells. Methods Cell viability was determined by Cell Counting Kit-8 assay. Cell apoptosis was observed using the chromatin dye Hoechst 33258 and analyzed by Flow Cytometry after propidium iodide staining. Mitochondrial membrane potential was monitored using the fluorescent dye Rh123. Intracellular reactive oxygen species were determined by oxidative conversion of cell permeable 2',7'-dichlorfluorescein-diacetate to fluorescent 2',7'-dichlorfluorescein. The expression of cleaved caspase-3 and bcl-2 and the accumulation of cytosolic cytochrome c were analyzed by Western blot. Results We show that ACS6 protects PC12 cells against cytotoxicity and apoptosis induced by homocysteine and blocks homocysteine-triggered cytochrome c release and caspase-3 activation. ACS6 treatment results in not only prevention of homocysteine-caused mitochondrial membrane potential (Δψ loss and reactive oxygen species (ROS overproduction but also reversal of Bcl-2 down-expression. Conclusions These results indicate that ACS6 protects PC12 cells against homocysteine-induced cytotoxicity and apoptosis by preservation of mitochondrial function though inhibiting both loss of Δψ and accumulation of ROS as well as modulating the expression of Bcl-2. Our study provides evidence both for a neuroprotective effect of ACS6 and for further evaluation of ACS6 as novel neuroprotectants for Alzheimer's disease associated with homocysteine.

  20. Hypoxia-mediated mechanism of MUC5AC production in human nasal epithelia and its implication in rhinosinusitis.

    Directory of Open Access Journals (Sweden)

    Yoon-Ju Kim

    Full Text Available BACKGROUND: Excessive mucus production is typical in various upper airway diseases. In sinusitis, the expression of MUC5AC, a major respiratory mucin gene, increases. However, the mechanisms leading to mucus hypersecretion in sinusitis have not been characterized. Hypoxia due to occlusion of the sinus ostium is one of the major pathologic mechanisms of sinusitis, but there have been no reports regarding the mechanism of hypoxia-induced mucus hypersecretion. METHODS AND FINDINGS: This study aims to identify whether hypoxia may induce mucus hypersecretion and elucidate its mechanism. Normal human nasal epithelial (NHNE cells and human lung mucoepidermoid carcinoma cell line (NCI-H292 were used. Sinus mucosa from patients was also tested. Anoxic condition was in an anaerobic chamber with a 95% N2/5% CO2 atmosphere. The regulatory mechanism of MUC5AC by anoxia was investigated using RT-PCR, real-time PCR, western blot, ChIP, electrophoretic mobility shift, and luciferase assay. We show that levels of MUC5AC mRNA and the corresponding secreted protein increase in anoxic cultured NHNE cells. The major transcription factor for hypoxia-related signaling, HIF-1α, is induced during hypoxia, and transfection of a mammalian expression vector encoding HIF-1α results in increased MUC5AC mRNA levels under normoxic conditions. Moreover, hypoxia-induced expression of MUC5AC mRNA is down-regulated by transfected HIF-1α siRNA. We found increased MUC5AC promoter activity under anoxic conditions, as indicated by a luciferase reporter assay, and mutation of the putative hypoxia-response element in MUC5AC promoter attenuated this activity. Binding of over-expressed HIF-1α to the hypoxia-response element in the MUC5AC promoter was confirmed. In human sinusitis mucosa, which is supposed to be hypoxic, expression of MUC5AC and HIF-1α is higher than in control mucosa. CONCLUSION: The results indicate that anoxia up-regulates MUC5AC by the HIF-1α signaling pathway in

  1. AC-93253 iodide, a novel Src inhibitor, suppresses NSCLC progression by modulating multiple Src-related signaling pathways

    Directory of Open Access Journals (Sweden)

    Yi-Hua Lai

    2017-11-01

    Full Text Available Abstract Background The tyrosine kinase Src is involved in the progression of many cancers. Moreover, inhibiting Src activity has been shown to obstruct several signaling pathways regulated by the EGFR. Thus, Src is a valuable target molecule in drug development. The purpose of this study was to identify compounds that directly or indirectly modulate Src to suppress lung cancer cell growth and motility and to investigate the molecular mechanisms underlying the effects of these compounds. Methods Human non-small cell lung cancer (NSCLC cell lines (PC9, PC9/gef, A549, and H1975 with different EGFR statuses were tested by cytotoxicity and proliferation assays after AC-93253 iodide treatment. Src and Src-related protein expression in AC-93253 iodide-treated PC9, PC9/gef, and A549 cells were assessed by western blotting. The effects of AC-93253 iodide on cancer cell colony formation, invasion, and migration were assessed in PC9 and PC9/gef cells. The synergistic effects of gefitinib and AC-93253 iodide were evaluated by combination index (CI-isobologram analysis in gefitinib-resistant cell lines. The efficacy of AC-93253 iodide in vivo was determined using nude mice treated with either the compound or the vehicle. Results Among the compounds, AC-93253 iodide exhibited the most potent dose-independent inhibitory effects on the activity of Src as well as on that of the Src-related proteins EGFR, STAT3, and FAK. Furthermore, AC-93253 iodide significantly suppressed cancer cell proliferation, colony formation, invasion, and migration in vitro and tumor growth in vivo. AC-93253 iodide sensitized tumor cells to gefitinib treatment regardless of whether the cells were gefitinib-sensitive (PC9 or resistant (H1975 and PC9/gef, indicating that it may exert synergistic effects when used in combination with established therapeutic agents. Our findings also suggested that the inhibitory effects of AC-93253 iodide on lung cancer progression may be attributable to

  2. Mortality in the TRACER and ATLAS ACS 2 trials: two more reasons to audit vital records in PLATO.

    Science.gov (United States)

    Serebruany, Victor L; DiNicolantonio, James J; Can, Mehmet Mustafa

    2012-01-01

    Extreme rates of vascular and all-cause mortality, especially in the clopidogrel arm of the PLATO (PLATelet Inhibition and Clinical Outcomes) trial, raise concerns of data accuracy and call for independent verification of vital records in the national death registries. Two recently completed acute coronary syndrome (ACS) trials, TRACER and ATLAS ACS 2 (Thrombin Receptor Antagonist for Clinical Event Reduction in ACS and Anti-Xa Therapy to Lower Cardiovascular Events in Addition to Standard Therapy in Subjects with ACS-Thrombolysis in Myocardial Infarction), provide a valuable opportunity to match mortality numbers among 3 similar studies. To compare the rates of vascular and all-cause mortality in the PLATO, TRACER and ATLAS ACS 2 trials. Despite a shorter mean follow-up (277 days) for the PLATO trial than for the TRACER (502 days) or ATLAS ACS 2 (393 days) trials, both vascular (5.1%) and all-cause (5.9%) mortality in PLATO were higher than in the TRACER (3.2 and 4.9%) or ATLAS ACS 2 (4.1 and 4.5%) control arms, respectively. Adjusting for follow-up duration, rates of vascular (0.0184/day), or all-cause (0.0213/day) mortality in PLATO differ importantly from daily death rates in TRACER (0.0063 and 0.0097) and ATLAS ACS 2 (0.0104 and 0.0115), suggesting that the risk of death in the control PLATO arm was approximately double that of the other trials. The mismatch is particularly striking considering that ATLAS ACS 2 enrolled more STEMI (ST-segment elevation in myocardial infarction) patients (50.9%) than PLATO (38.0%). Both overall and follow-up duration-adjusted mortality rates in PLATO far exceeded the risk of death observed in the two recent ACS trials. The background STEMI rates are not likely to be responsible for the PLATO mortality paradox. These data provide an additional reason to request an independent audit of the deceased PLATO clopidogrel cohort. Copyright © 2012 S. Karger AG, Basel.

  3. Tilt table testing in patients with suspected epilepsy1

    DEFF Research Database (Denmark)

    Edfors, R.; Erdal, J.; Rogvi-Hansen, B.

    2008-01-01

    BACKGROUND: Approximately 20-30% of patients with epilepsy are misdiagnosed and syncope often seems to be the mistaken cause. We re-evaluated patients referred to an epilepsy clinic where suspicion of neurally mediated (reflex) syncope were raised using tilt table testing (HUT). METHODS: HUT...... laboratory results and medical records of 120 consecutive patients were reviewed retrospectively over a period of 27 months. RESULTS: HUT was positive in 59 (49%) patients. Seventeen of 38 (45%) patients previously diagnosed with epilepsy and taking antiepileptic drugs were found to be misdiagnosed. Four...... of 21 patients with epilepsy (19%) had dual diagnoses of reflex syncope and epilepsy. CONCLUSION: HUT is an informative investigation when suspicions of reflex syncope are raised in patients referred to an epilepsy clinic. Reflex syncope is an important and common differential diagnosis of epilepsy...

  4. 40 CFR 90.422 - Background sample.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Background sample. 90.422 Section 90... Procedures § 90.422 Background sample. (a) Background samples are produced by drawing a sample of the dilution air during the exhaust collection phase of each test cycle mode. (1) An individual background...

  5. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  6. Sub-Kelvin ac magnetic susceptometry.

    Science.gov (United States)

    Schmidt, M A; Silevitch, D M; Woo, N; Rosenbaum, T F

    2013-01-01

    Designing an apparatus for experiments that operate deep into the milliKelvin regime requires a careful selection of materials and construction techniques, and often entails balancing mutually contradictory requirements. In the case of magnetic susceptibility measurements, this involves choosing materials that realize both high thermal conductivity for good heat sinking and low electrical conductivity for minimal eddy-current heating. A coil mounting system with a completely nonmetallic construction, achieved through the use of a sapphire skeleton and a machined carbon-fiber body, resolves this dilemma. This system permits the use of large ac magnetic field amplitudes at kHz frequencies and above, opening the door to studies of the nonlinear dynamics of a wide variety of magnetic systems that were previously inaccessible.

  7. The impact of personal background and school contextual factors on academic competence and mental health functioning across the primary-secondary school transition.

    Directory of Open Access Journals (Sweden)

    Sharmila Vaz

    Full Text Available Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC and mental health functioning (MHF of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.

  8. The impact of personal background and school contextual factors on academic competence and mental health functioning across the primary-secondary school transition.

    Science.gov (United States)

    Vaz, Sharmila; Parsons, Richard; Falkmer, Torbjörn; Passmore, Anne Elizabeth; Falkmer, Marita

    2014-01-01

    Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC) and mental health functioning (MHF) of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.

  9. Multi-Touch Tables and Collaborative Learning

    Science.gov (United States)

    Higgins, Steve; Mercier, Emma; Burd, Liz; Joyce-Gibbons, Andrew

    2012-01-01

    The development of multi-touch tables, an emerging technology for classroom learning, offers valuable opportunities to explore how its features can be designed to support effective collaboration in schools. In this study, small groups of 10- to 11-year-old children undertook a history task where they had to connect various pieces of information…

  10. Water-table altitude of Nevada

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This is a raster-based, depth to ground-water data set for the State of Nevada. The source of this data set is a statewide water-table contour data set constructed...

  11. The periodic table: icon and inspiration.

    Science.gov (United States)

    Poliakoff, Martyn; Tang, Samantha

    2015-03-13

    To start this discussion meeting on the new chemistry of the elements held on 12 May 2014, Martyn Poliakoff, Foreign Secretary of the Royal Society, was invited to give the opening remarks. As a chemist and a presenter of the popular online video channel 'The periodic table of videos', Martyn communicates his personal and professional interest in the elements to the public, who in turn use these videos both as an educational resource and for entertainment purposes. Ever since Mendeleev's first ideas for the periodic table were published in 1869, the table has continued to grow as new elements have been discovered, and it serves as both icon and inspiration; its form is now so well established that it is recognized the world over as a symbol for science. This paper highlights but a few of the varied forms that the table can take, such as an infographic, which can convey the shortage of certain elements with great impact. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  12. Trunnion Collar Removal Machine - Gap Analysis Table

    Energy Technology Data Exchange (ETDEWEB)

    M. Johnson

    2005-06-27

    The purpose of this document is to review the existing the trunnion collar removal machine against the ''Nuclear Safety Design Bases for License Application'' (NSDB) [Ref. 10] requirements and to identify codes and standards and supplemental requirements to meet these requirements. If these codes and standards can not fully meet these requirements then a ''gap'' is identified. These gaps will be identified here and addressed using the ''Trunnion Collar Removal Machine Design Development Plan'' [Ref. 15]. The codes and standards, supplemental requirements, and design development requirements for the trunnion collar removal machine are provided in the gap analysis table (Appendix A, Table 1). Because the trunnion collar removal machine is credited with performing functions important to safety (ITS) in the NSDB [Ref. 10], design basis requirements are applicable to ensure equipment is available and performs required safety functions when needed. The gap analysis table is used to identify design objectives and provide a means to satisfy safety requirements. To ensure that the trunnion collar removal machine performs required safety functions and meets performance criteria, this portion of the gap analysis tables supplies codes and standards sections and the supplemental requirements and identifies design development requirements, if needed.

  13. Yield tables for Italian coppice stands

    Energy Technology Data Exchange (ETDEWEB)

    Bernetti, G.

    1980-01-01

    A critical review of results from 32 yield tables for Italian coppice stands. Particular attention is paid to age of maximum m.a.i., distribution of total volume of fuelwood up to 3 cm in diameter and of brushwood, and relation between mean height and volume. A provisional general yield table is given for Quercus cerris and mixed deciduous coppice stands, based on data from 12 local tables. Maximum m.a.i. occurs relatively early, with rather low values. For Quercus ilex and mixed evergreen broadleaved coppice stands on the coast of Tuscany, tables perpared separately by Giordano and Patrone are broadly in agreement. In terms of total volume, the evergreen coppice stands of the Mediterranean maquis have a higher yield than deciduous coppice stands, and contain a higher % of brushwood. Data for Fagus sylvatica are somewhat incomplete, but m.a.i. for fuelwood appears to remain constant between the ages of 12 and 24, with maximum values of 5 and 2.1 cu.m/ha for the best and poorest quality classes respectively. Castanea sativa coppice stands can show very high rates of increment e.g. maximum m.a.i. of 20 cu.m/ha on highly fertile volcanic soils.

  14. Table-top diffuse optical imaging

    NARCIS (Netherlands)

    Sturgeon, K.A.; Bakker, L.P.

    2006-01-01

    This report describes the work done during a six months internshipat Philips Research for a Masters in Electronic and Electrical Engineering. An existing table-top tomography system for measuring lightin phantom breasts was restored. Updated software control and image reconstruction software was

  15. Experiences with Interactive Multi-touch Tables

    NARCIS (Netherlands)

    Fikkert, F.W.; Hakvoort, M.; Hakvoort, M.C.; van der Vet, P.E.; Nijholt, Antinus; Nijholt, A.; Reidsma, D.; Reidsma, Dennis; Hondorp, G.H.W.

    2009-01-01

    Interactive multi-touch tables can be a powerful means of communication for collaborative work as well as an engaging environment for competition. Through enticing gameplay we have evaluated user experience on competitive gameplay, collaborative work and musical expression. In addition, we report on

  16. Normal yield tables for red alder.

    Science.gov (United States)

    Norman P. Worthington; Floyd A. Johnson; George R. Staebler; William J. Lloyd

    1960-01-01

    Increasing interest in the management of red alder (Alnus rubra) has created a need for reliable yield information. Existing yield tables for red alder have been very useful as interim sources of information, but they are generally inadequate for current and prospective management needs. The advisory committee for the Station's Olympia...

  17. Ecological periodic tables for estuarine habitats

    Science.gov (United States)

    Southwood (1977; J Anim Ecol 46: 337-365) compared the situation in ecology to that in chemistry before the development of the periodic table when each fact, for example, the solubility or reactivity of a chemical element, had to be discovered independently and remembered in isol...

  18. Submatrices of character tables and basic sets

    DEFF Research Database (Denmark)

    Bessenrodt, Christine; Olsson, Jørn Børling

    2012-01-01

    combinatorial determinant formulae for submatrices of the character table and Cartan matrices with respect to basic sets; we observe that similar phenomena occur for the transition matrices between power sum symmetric functions to bounded partitions and the k-Schur functions dened by Lapointe and Morse....... Arithmetic properties of the numbers occurring in this context are studied via generating functions...

  19. 3D virtual table in anatomy education

    DEFF Research Database (Denmark)

    Dahl, Mads Ronald; Simonsen, Eivind Ortind

    The ‘Anatomage’ is a 3D virtual human anatomy table, with touchscreen functionality, where it is possible to upload CT-scans and digital. Learning the human anatomy terminology requires time, a very good memory, anatomy atlas, books and lectures. Learning the 3 dimensional structure, connections...

  20. Extreme charge-trapping by pixels in Hubble's ACS/WFC detectors

    Science.gov (United States)

    Ryon, Jenna E.; Grogin, Norman A.; ACS Team

    2017-06-01

    We investigate the properties of sink pixels in the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detector. These pixels likely contain extra charge traps and therefore appear anomalously low in images with relatively high backgrounds. We identify sink pixels in the average short (0.5-second) dark image from each monthly anneal cycle, which, since January 2015, have been post-flashed to a background of about 60 e-. Sink pixels can affect the pixels immediately above and below them in the same column, resulting in high downstream pixels and low trails of upstream pixels. We determine typical trail lengths for sink pixels of different depths at various background levels. We create a reference image, one for each anneal cycle since January 2015, that will be used by CALACS to flag sink pixels and the adjacent affected pixels in science images.

  1. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

    2009-01-01

    of semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype......This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

  2. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Loh, Poh Chiang; Gao, Feng

    2007-01-01

    a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper.......This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...

  3. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  4. A scalable lock-free hash table with open addressing

    DEFF Research Database (Denmark)

    Nielsen, Jesper Puge; Karlsson, Sven

    2016-01-01

    resolve any duplicate or conflicting values. Our hash table has a constant and low memory usage that is less than existing lock-free hash tables at a fill level of 33% and above. The hash table exhibits good cache locality. Compared to prior art, our hash table results in 16% and 15% fewer L1 and L2 cache...... misses respectively, leading to 21% fewer memory stall cycles. Our experiments show that our hash table scales close to linearly with the number of threads and outperforms, in throughput, other lock-free hash tables by 19%...

  5. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  6. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

  7. Trajectory Control of Self-Propelled Micromotors Using AC Electrokinetics.

    Science.gov (United States)

    Yoshizumi, Yoshitaka; Honegger, Thibault; Berton, Kevin; Suzuki, Hiroaki; Peyrade, David

    2015-11-11

    3D control of the motion of self-powered micromotors is demonstrated using AC electrokinetics by applying an AC electric field on indium tin oxide transparent electrodes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  9. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  10. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    . This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  11. Low frequency ac conduction and dielectric relaxation in poly (N ...

    Indian Academy of Sciences (India)

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

  12. From the Mendeleev periodic table to particle physics and back to the periodic table

    Energy Technology Data Exchange (ETDEWEB)

    Kibler, Maurice R. [Universite de Lyon, Institut de Physique Nucleaire, Universite Lyon 1 and CNRS/IN2P3, 43 Bd du 11 Novembre 1918, F-69622 Villeurbanne Cedex (France)

    2006-11-15

    We briefly describe in this paper the passage from Mendeleev's chemistry (1869) to atomic physics (in the 1900's), nuclear physics (in the 1932's) and particle physics (from 1953 to 2006). We show how the consideration of symmetries, largely used in physics since the end of the 1920's, gave rise to a new format of the periodic table in the 1970's. More specifically, this paper is concerned with the application of the group SO(4,2)xSU(2) to the periodic table of chemical elements. It is shown how the Madelung rule of the atomic shell model can be used for setting up a periodic table that can be further rationalized via the group SO(4,2)xSU(2) and some of its subgroups. Qualitative results are obtained from this nonstandard table. (author)

  13. Development of YBCO HTS cable with low AC loss

    Energy Technology Data Exchange (ETDEWEB)

    Yagi, M. [Energy Transmission Research Department Ecology and Energy Laboratory, Furukawa Electric Co., Ltd., 6, Yawata-Kaigandori, Ichihara, Chiba 290-8555 (Japan)], E-mail: m-yagi@ch.furukawa.co.jp; Mukoyama, S. [Energy Transmission Research Department Ecology and Energy Laboratory, Furukawa Electric Co., Ltd., 6, Yawata-Kaigandori, Ichihara, Chiba 290-8555 (Japan); Amemiya, N. [Yokohama National University, 79-5, Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Nagaya, S.; Kashima, N. [Chubu Electric Power Co., Inc., 20-1, Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan); Shiohara, Y. [Superconductivity Research Laboratory, 1-10-13, Shinonome, Koto-ku, Tokyo 135-0062 (Japan)

    2008-09-15

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s.

  14. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  15. The use of low frequency AC for offshore wind power

    Energy Technology Data Exchange (ETDEWEB)

    Schuette, T.; Stroem, M.; Gustavsson, Bo [Balfour Beatty Rail AB, Vaesteraas (Sweden)

    2001-07-01

    Low frequency AC, that means AC with a frequency well below the usual frequencies 50 or 60 Hz, has today its main use in single phase AC electrified railways in a number of European countries (16 2/3 Hz), USA (25 Hz) and Costa Rica (20 Hz). Offshore wind power is well suited to 'join the club' as low frequency AC has a number of advantages for that use: Low frequency AC better fits the low revolution frequency of wind power rotors. This can either be used for reduction of pole number for direct generation machines or for a reduction of the gear ratio for conventional machines, resulting in simpler, lighter and more reliable gearboxes. Low frequency AC gives rise to lower charging current/reactive power production, which restricts the maximum cable length for 50 - 60 Hz heavily due to the high specific capacitance of power cables. For low frequency AC, cables longer than 100 km are possible, which is necessary for many future offshore wind power sites. Low frequency AC enables for the use of (air insulated) transmission lines at loads well above their characteristic power, often up to their thermal maximum load. This means that weak 50 or 60 Hz lines between the shore and consumers or stronger parts of a national grid can transfer more power when operated with low frequency AC. On all aspects of low frequency AC, profound knowledge has been accumulated the last century in the railway sector and can be made available for wind power.

  16. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning tests...

  17. Lamin A/C truncation in dilated cardiomyopathy with conduction disease

    Directory of Open Access Journals (Sweden)

    Huber Jill M

    2003-07-01

    Full Text Available Abstract Background Mutations in the gene encoding the nuclear membrane protein lamin A/C have been associated with at least 7 distinct diseases including autosomal dominant dilated cardiomyopathy with conduction system disease, autosomal dominant and recessive Emery Dreifuss Muscular Dystrophy, limb girdle muscular dystrophy type 1B, autosomal recessive type 2 Charcot Marie Tooth, mandibuloacral dysplasia, familial partial lipodystrophy and Hutchinson-Gilford progeria. Methods We used mutation detection to evaluate the lamin A/C gene in a 45 year-old woman with familial dilated cardiomyopathy and conduction system disease whose family has been well characterized for this phenotype 1. Results DNA from the proband was analyzed, and a novel 2 base-pair deletion c.908_909delCT in LMNA was identified. Conclusions Mutations in the gene encoding lamin A/C can lead to significant cardiac conduction system disease that can be successfully treated with pacemakers and/or defibrillators. Genetic screening can help assess risk for arrhythmia and need for device implantation.

  18. NNDSS - Table II. Invasive pneumococcal disease, all ages

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive pneumococcal disease, all ages - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during...

  19. NNDSS - Table II. Invasive Pneumococcal Diseases, All Ages

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal Diseases, All Ages - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during...

  20. NNDSS - Table II. Carbapenemase-producing carbapenem-resistant Enterobacteriaceae

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Carbapenemase-producing carbapenem-resistant Enterobacteriaceae - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000...

  1. NNDSS - Table II. Invasive pneumococcal disease, age <5

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive pneumococcal disease, age <5 - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during...

  2. NNDSS - Table II. Cryptosporidiosis to Dengue Hemorrhagic Fever

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue Hemorrhagic Fever - 2014. In this Table, all conditions with a 5-year average annual national total of more than or...

  3. Tropical forest biomass estimation from truncated stand tables.

    Science.gov (United States)

    A. J. R. Gillespie; S. Brown; A. E. Lugo

    1992-01-01

    Total aboveground forest biomass may be estimated through a variety of techniques based on commercial inventory stand and stock tables. Stand and stock tables from tropical countries commonly omit trees bellow a certain commercial limit.

  4. Karna Particle Size Dataset for Tables and Figures

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset contains 1) table of bulk Pb-XAS LCF results, 2) table of bulk As-XAS LCF results, 3) figure data of particle size distribution, and 4) figure data for...

  5. NNDSS - Table II. Hepatitis (viral, acute, by type) A & B

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute, by type) A & B - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported...

  6. NNDSS - Table II. Hepatitis (viral, acute, by type) C

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute, by type) C - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  7. NNDSS - Table II. Hepatitis (viral, acute) A & B

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) A & B - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  8. NNDSS - Table II. Cryptosporidiosis to Dengue virus infection

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue virus infection - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported...

  9. NNDSS - Table II. Rabies, animal to Rubella, congenital syndrome

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rabies, animal to Rubella, congenital syndrome - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported...

  10. NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during...

  11. NNDSS - Table II. Invasive Pneumococcal Diseases, Age <5

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal Diseases, Age <5 - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during...

  12. NNDSS - Table II. Rabies, animal to Rubella, congenital syndrome

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rabies, animal to Rubella, congenital syndrome - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported...

  13. NNDSS - Table II. Varicella to West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Varicella to West Nile virus disease - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000...

  14. NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during...

  15. NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  16. NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals...

  17. Malheur NWR: Initial Survey Instructions for Water Table Depth Survey

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water table wells assist in filling a critical information gap related to fluctuating water table depth and its influence on habitat expression within wet meadow...

  18. Ecological periodic tables: in principle and practice - January 2013

    Science.gov (United States)

    The chemical periodic table, the Linnaean system of classification and the Hertzsprung-Russell diagram are iconic information organizing structures in chemistry, biology and astronomy, respectively. Ecological periodic tables are information organizing structures for ecology. T...

  19. Ecological periodic tables: Killer apps for translational ecology

    Science.gov (United States)

    The chemical periodic table, the Linnaean system of classification and the Hertzsprung-Russell diagram are information organizing structures that have transformed chemistry, biology and astronomy, respectively. Ecological periodic tables are information organizing structures wit...

  20. Literature review tables for Karna et al. 2017

    Data.gov (United States)

    U.S. Environmental Protection Agency — N/A. Users will need to access the manuscript to see non-EPA data presented in tables and figures. This dataset is not publicly accessible because: The tables in the...

  1. [National Elk Refuge background and operating statement

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document is a background on National Elk Refuge in Wyoming. Part I is solely background information concerning the physical characteristics, habitat, major...

  2. Environmental Regulatory Update Table, January/February 1992

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1992-03-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated bi-monthly with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action. This table is for January/February 1992.

  3. Systematic review of implementation strategies for risk tables in the prevention of cardiovascular diseases

    Directory of Open Access Journals (Sweden)

    Ben van Steenkiste

    2008-06-01

    Full Text Available Ben van Steenkiste, Richard Grol, Trudy van der WeijdenCentre for Quality of Care Research, School for Public Health and Primary Care (Caphri, Maastricht University, Maastricht, The NetherlandsBackground: Cardiovascular disease prevention is guided by so-called risk tables for calculating individual’s risk numbers. However, they are not widely used in routine practice and it is important to understand the conditions for their use.Objectives: Systematic review of the literature on professionals’ performance regarding cardiovascular risk tables, in order to develop effective implementation strategies.Selection criteria: Studies were eligible for inclusion if they reported quantitative empirical data on the effect of professional, financial, organizational or regulatory strategies on the implementation of cardiovascular risk tables. Participants were physicians or nurses.Outcome measure: Primary: professionals’ self-reported performance related to actual use of cardiovascular risk tables. Secondary: patients’ cardiovascular risk reduction.Data collection and analysis: An extensive strategy was used to search MEDLINE, EMBASE, CINAHL, and PSYCHINFO from database inception to February 2007.Main results: The review included 9 studies, covering 3 types of implementation strategies (or combinations. Reported effects were moderate, sometimes conflicting and contradictory. Although no clear relation was observed between a particular type of strategy and success or failure of the implementation, promising strategies for patient selection and risk assessment seem to be teamwork, nurse led-clinics and integrated IT support.Conclusions: Implementation strategies for cardiovascular risk tables have been sparsely studied. Future research on implementation of cardiovascular risk tables needs better embedding in the systematic and problem-based approaches developed in implementation science.Keywords: systematic review, implementation, cardiovascular

  4. 16 CFR 1101.1 - General background.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false General background. 1101.1 Section 1101.1 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS INFORMATION DISCLOSURE UNDER SECTION 6(b) OF THE CONSUMER PRODUCT SAFETY ACT Background § 1101.1 General background. (a...

  5. 45 CFR 650.16 - Background rights.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Background rights. 650.16 Section 650.16 Public... Background rights. The Foundation will acquire rights to a research performer's pre-existing technology only... of the cognizant Program Manager, will negotiate a background rights provision. If the affected...

  6. The ACS Nearby Galaxy Survey Treasury: Overview

    Science.gov (United States)

    Dalcanton, Julianne

    2006-12-01

    The ACS Nearby Galaxy Survey Treasury program (ANGST) consists of a carefully crafted imaging survey of a volume-limited sample of galaxies in the Local Universe outside the Local Group. The resulting images will allow unprecedented measurements of: (1) the SFH of a >100 Mpc3 volume of the Universe with a time resolution of Delta[log(t)]=0.25; (2) correlations between spatially resolved SFHs and environment; (3) the structure and properties of thick disks and stellar halos; and (4) the color distributions, sizes, and specific frequencies of globular and disk clusters as a function of galaxy mass and environment. To reach these goals, we are using a combination of wide-field tiling, pointed deep imaging, and archival data to carry out a uniform analysis of the ancient and recent star formation histories of 70 galaxies within a volume-limited sample extending to 3.5 Mpc, with an extension to the M81 group. For all galaxies, a radial strip of imaging will cover out to beyond the optical radius and will reach photometric depths of at least 2 magnitudes below the tip of the red giant branch throughout the limits of the survey volume. Additional deep pointings will reach SNR 10 for red clump stars, sufficient to recover the ancient star formation history (SFH) from the color-magnitude diagram for the galaxies that provide more than 99% of the star formation in the local volume. The resulting analysis will produce photometric information for several million stars.

  7. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  8. Periodic table for Floquet topological insulators

    Science.gov (United States)

    Roy, Rahul; Harper, Fenner

    2017-10-01

    Dynamical phases with novel topological properties are known to arise in driven systems of free fermions. In this paper, we obtain a `periodic table' to describe the phases of such time-dependent systems, generalizing the periodic table for static topological insulators. Using K theory, we systematically classify Floquet topological insulators from the ten Altland-Zirnbauer symmetry classes across all dimensions. We find that the static classification scheme described by a group G becomes G×n in the time-dependent case, where n is the number of physically important gaps in the quasienergy spectrum (including any gaps at quasienergy π ). The factors of G may be interpreted as arising from the bipartite decomposition of the unitary time-evolution operator. Topologically protected edge modes may arise at the boundary between two Floquet systems, and we provide a mapping between the number of such edge modes and the topological invariant of the bulk.

  9. Improving GRADE evidence tables part 2

    DEFF Research Database (Denmark)

    Langendam, Miranda; Carrasco-Labra, Alonso; Santesso, Nancy

    2016-01-01

    OBJECTIVES: The Grading of Recommendations Assessment, Development, and Evaluation (GRADE) working group has developed GRADE evidence profiles (EP) and summary of findings (SoF) tables to present evidence summaries in systematic reviews, clinical guidelines, and health technology assessments....... Explanatory notes are used to explain choices and judgments in these summaries, for example, on rating of the quality of evidence. STUDY DESIGN AND SETTING: A systematic survey of the explanations in SoF tables in 132 randomly selected Cochrane Intervention reviews and in EPs of 10 guidelines. We analyzed...... the content of 1,291 explanations using a predefined list of criteria. RESULTS: Most explanations were used to describe or communicate results and to explain downgrading of the quality of evidence, in particular for risk of bias and imprecision. Addressing the source of baseline risk (observational data...

  10. The Table of Chords and Greek Trigonometry

    Directory of Open Access Journals (Sweden)

    Stefano Buscherini

    2010-12-01

    Full Text Available Trigonometry was born due to the need of ancient astronomy to calculate and to predict the movement of the heavenly bodies. However it is hard to know who the founder of this mathematical branch was: it is likely that its origins date back to Hipparchus of Nicaea who compiled the first table of chords, which are the forerunners of the modern trigonometric function “sine”. Nevertheless the most ancient existing work on trigonometry is the Almagest of Ptolemy in which the author describes the mathematical steps that are necessary for the compilation of the table of chords. These steps are based on more ancient theories and for this reason one gets the impression that they could be the result of a preparatory study. This article is not only a brief survey of Greek trigonometry but it also analyzes the Greek numeration system, the sexagesimal fractions and the arithmetical operations which were used in the calculation of the chords.

  11. Shaking Table Tests of Reinforced Concrete Frames

    DEFF Research Database (Denmark)

    Skjærbæk, P. S.; Kirkegaard, Poul Henning; Nielsen, Søren R.K.

    The purpose of the paper is to present a series of shaking table experiments performed at the Structural Laboratory at Aalborg University, Denmark during the autumn of 1996 and to show some selected results from these experiments. The aim of the tests was to test methods for identification of time...... in the shaking table test are 2-bay, 6-storey RC-frames in scale 1:5 with outer measures of 2.4 m in with and 3.3 m in height. The structures are subjected to a series of sequential earthquakes and after each earthquake the structure is visually inspected. The results of the work have revealed that the recursive...... vector ARMA model is suitable for modal identification of degrading reinforced concrete structures and the maximum softening damage index calculated from the obtained identification provides a valuable tool for assessment of the damage state of the structure....

  12. Mobile Lift Table Capacity 300 kg

    OpenAIRE

    Kirst, Pavel

    2014-01-01

    Bakalářská práce se zabývá mobilní manipulační plošinou o nosnosti 300 kg. Hlavním cílem je tuto manipulační plošinu navrhnout. Práce se zaměřuje na manipulační plošinu s nůžkovým mechanismem a s elektrohydraulickým pohonem. V první části je řešena technická zpráva pro navrhovanou plošinu a druhá část obsahuje výkresovou dokumentaci. Bachelor’s thesis is dealing with mobile lift table - capacity 300kg. The main target is to create mobile lift table. My work aims at the mobile scissor lift ...

  13. 21 CFR 880.6140 - Medical chair and table.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Miscellaneous Devices § 880.6140 Medical chair and table. (a) Identification. A medical chair or table is a device... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Medical chair and table. 880.6140 Section 880.6140...

  14. 40 CFR Appendix - Tables to Subpart B of Part 88

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Tables to Subpart B of Part 88 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CLEAN-FUEL VEHICLES California Pilot Test Program State opt-in for the California Pilot Test Program. Pt. 88, Subpart B, Tables Tables to Subpart B of Part 88...

  15. 40 CFR Appendix - Tables to Subpart C of Part 88

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Tables to Subpart C of Part 88 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CLEAN-FUEL VEHICLES Clean-Fuel Fleet Program Incentives for the purchase of Inherently Low-Emission Vehicles. Pt. 88, Subpt. C, Tables Tables to Subpart C of Par...

  16. 42 CFR Appendix - Tables to Subpart I of Part 84

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Tables to Subpart I of Part 84 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Gas Masks Canister bench tests; minimum requirements. Pt. 84, Subpt. I, Tables Tables...

  17. 50 CFR Table 2 to Part 680 - Crab Species Code

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Crab Species Code 2 Table 2 to Part 680..., Table 2 Table 2 to Part 680—Crab Species Code Species code Common name Scientific name 900 Box Lopholithodes mandtii. 910 Dungeness Cancer magister. 921 Red king crab Paralithodes camtshaticus. 922 Blue king...

  18. 7 CFR 51.2854 - Metric conversion table.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Metric conversion table. 51.2854 Section 51.2854 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards...) Metric Conversion Table § 51.2854 Metric conversion table. Inches Millimeters (mm) 1/8 3.2 1/4 6.4 3/8 9...

  19. 7 CFR 51.653 - Metric conversion table.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Metric conversion table. 51.653 Section 51.653 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards..., and Arizona) Metric Conversion Table § 51.653 Metric conversion table. Inches Millimeters (mm) 1/4...

  20. 7 CFR 51.714 - Metric conversion table.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Metric conversion table. 51.714 Section 51.714 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards..., and Arizona) Metric Conversion Table § 51.714 Metric conversion table. Inches Millimeters (mm) 1/4...

  1. 30 CFR 250.1200 - Question index table.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Question index table. 250.1200 Section 250.1200... Security § 250.1200 Question index table. The table in this section lists questions concerning Oil and Gas Production Measurement, Surface Commingling, and Security. Frequently asked questions CFR citation 1. What...

  2. 16 CFR 501.5 - Paper table covers, bedsheets, pillowcases.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Paper table covers, bedsheets, pillowcases... REQUIREMENTS AND PROHIBITIONS UNDER PART 500 § 501.5 Paper table covers, bedsheets, pillowcases. Table covers, bedsheets, and pillowcases, fabricated from paper, are exempt from the requirements of § 500.12 of this...

  3. 40 CFR Appendix to Subpart Hh of... - Tables

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 10 2010-07-01 2010-07-01 false Tables Appendix to Subpart HH of Part..., Subpt. HH, App. Appendix to Subpart HH of Part 63—Tables Table 1 to Subpart HH of Part 63—List of Hazardous Air Pollutants for Subpart HH CAS Number a Chemical name 75070 Acetaldehyde 71432 Benzene...

  4. 31 CFR Appendix to Part 341 - Tables of Redemption Values

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Tables of Redemption Values Appendix... RETIREMENT PLAN BONDS Pt. 341, App. Appendix to Part 341—Tables of Redemption Values Table of Redemption Values Providing an Investment Yield of 33/4 Percent per Annum for Bonds Bearing Issue Dates Beginning...

  5. Environmental Regulatory Update Table, January/February 1995

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Bock, R.E.; Mayer, S.J.; Salk, M.S.

    1995-03-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives impacting environmental, health, and safety management responsibilities. the table is updated bi-monthly with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  6. 32 CFR Attachment D to Subpart B... - Decision Tables

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Decision Tables D Attachment D to Subpart B of Part 147 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY... Investigative Standards Pt. 147, Subpt. B, Att. D Attachment D to Subpart B of Part 147—Decision Tables Table 1...

  7. 40 CFR Table 3 to Subpart Ggg of... - Soluble HAP

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 11 2010-07-01 2010-07-01 true Soluble HAP 3 Table 3 to Subpart GGG of Part 63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... for Pharmaceuticals Production Pt. 63, Subpt. GGG, Table 3 Table 3 to Subpart GGG of Part 63—Soluble...

  8. Deacetylation of H4-K16Ac and heterochromatin assembly in senescence

    Directory of Open Access Journals (Sweden)

    Contrepois Kévin

    2012-08-01

    Full Text Available Abstract Background Cellular senescence is a stress response of mammalian cells leading to a durable arrest of cell proliferation that has been implicated in tumor suppression, wound healing, and aging. The proliferative arrest is mediated by transcriptional repression of genes essential for cell division by the retinoblastoma protein family. This repression is accompanied by varying degrees of heterochromatin assembly, but little is known regarding the molecular mechanisms involved. Results We found that both deacetylation of H4-K16Ac and expression of HMGA1/2 can contribute to DNA compaction during senescence. SIRT2, an NAD-dependent class III histone deacetylase, contributes to H4-K16Ac deacetylation and DNA compaction in human fibroblast cell lines that assemble striking senescence-associated heterochromatin foci (SAHFs. Decreased H4-K16Ac was observed in both replicative and oncogene-induced senescence of these cells. In contrast, this mechanism was inoperative in a fibroblast cell line that did not assemble extensive heterochromatin during senescence. Treatment of senescent cells with trichostatin A, a class I/II histone deacetylase inhibitor, also induced rapid and reversible decondensation of SAHFs. Inhibition of DNA compaction did not significantly affect the stability of the senescent state. Conclusions Variable DNA compaction observed during senescence is explained in part by cell-type specific regulation of H4 deacetylation and HMGA1/2 expression. Deacetylation of H4-K16Ac during senescence may explain reported decreases in this mark during mammalian aging and in cancer cells.

  9. Military Retirement: Background and Recent Developments

    Science.gov (United States)

    2016-09-12

    retention. Military retirees, families , and veterans’ service organizations closely monitor potential future changes to the retirement system. When...survivors and the veterans’ service organizations that support them. In addition, there are roughly 6 million to 8 million family members, who...0.3472) produces a monthly retirement annuity of $3,042 per month. Number of Non-Disability Retirees by Retirement System Table 2 reflects retirees by

  10. Measurement of AC loss of superconductors by vaporizing method

    Energy Technology Data Exchange (ETDEWEB)

    Wakabayashi, Hiroshi; Isono, Takaaki; Matsui, Kunihiro; Fujisaki, Reishi; Nunoya, Yoshihiko; Koizumi, Norikiyo; Takahashi, Yoshikazu; Tsuji, Hiroshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1995-07-01

    In Japan Atomic Energy Research Institute, the development of superconducting pulse conductors for next period nuclear fusion reactors has been carried out. For these conductors, the rated current of 46 kA and the rated magnetic field of 13T are demanded. When the pulse excitation of superconductors is carried out, AC loss arises, and the temperature of the superconductors rises, and when it exceeds a certain value, the superconducting state cannot be maintained. Therefore, the AC loss of pulse conductors must be limited to a low value. It is difficult to evaluate the AC loss of superconductors by calculation, therefore, it is evaluated by actual measurement. There are magnetizing method and vaporizing method for measuring the AC loss. This time, the equipment for measuring the AC loss of 40 kA class superconductors by vaporizing method which measures the helium gas quantity vaporizing at the time of AC loss occurrence was designed and manufactured for the first time. The method of measuring the AC loss, the structure of the measuring equipment, the helium gas recovering part and the measuring part, the countermeasures for preventing helium gas leakage, the resistance heater for calibration, and the results of measurement are reported. (K.I.)

  11. Investigation of AC losses in horizontally parallel HTS tapes

    Science.gov (United States)

    Shen, Boyang; Li, Jing; Geng, Jianzhao; Fu, Lin; Zhang, Xiuchang; Zhang, Heng; Li, Chao; Grilli, Francesco; Coombs, T. A.

    2017-07-01

    This paper presents an AC loss study of horizontally parallel HTS tapes. We proposed to use three parallel HTS tapes as an example. The AC losses of the middle and end tape of three parallel tapes have been measured using the electrical method and compared to those of an individual tape. The effect of the interaction between tapes on AC losses has been analysed, and compared with finite-element method (FEM) simulations using the 2D H -formulation implemented in COMSOL Multiphysics. By using FEM simulations, the cases of increasing number of parallel tapes have been considered, and the normalised ratio between the total average AC losses per tape and the AC losses of an individual single tape has been calculated for different gap distances. We proposed a new parameter, Ns , a turning point for number of tapes, to divide Stage 1 and Stage 2 for the AC loss study of horizontally parallel tapes. For Stage 1, N Ns , the total average losses per tape decrease with the increasing number of tapes. The analysis demonstrates that horizontally parallel HTS tapes could be potentially used in superconducting devices like HTS transformers, which could retain or even reduce the total average AC losses per tape with large number of parallel tapes.

  12. Electron transport through ac driven graphene p-n junctions

    Science.gov (United States)

    Zhang, Zhi-Qiang; Kang, Yan-Zhuo; Ding, Kai-He

    2018-02-01

    We study the electronic transport through ac driven graphene p-n junctions under a perpendicular magnetic field. It is found that subject to the transversely or longitudinally polarized ac field, in the p-n region, the conductance versus the on-site energy of the right electrode exhibits a characteristic structure with a zero value plateau and the followed oscillation peaks, whose widths are greatly suppressed by the ac field. In the n-n region, the conductance plateaus at G = (n + 1 / 2) (4e2 / h) (n is an integer) shrink for the transversely polarized ac field, whereas accompanied with the addition of the new quantized plateaus at G = n (4e2 / h) for the longitudinally polarized ac field. The combined influence of the ac field with the disorder can trigger a change in the mixing of the hole and electron states at the p-n interface, which leads to a destruction of the plateaus structure in the conductance versus the disorder strength with the emergence of new ones. The influence of the elliptically and circularly polarized ac field on the conductance is also shown.

  13. Advances in food composition tables in Japan-Standard Tables Of Food Composition in Japan - 2015 - (Seventh Revised Edition).

    Science.gov (United States)

    Watanabe, Tomoko; Kawai, Ryoko

    2018-01-01

    The latest version of the Standard Tables of Food Composition in Japan-2015- comprises the main food composition table (Standard Tables of Food Composition in Japan-2015-[Seventh revised Edition)) and three supplementary books. The supplementary books are Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Amino Acids -, Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Fatty Acids - and Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Available Carbohydrates, Polyols and Organic Acids-. We believe understanding these food composition tables can give greater insight into Japan's gastronomic culture and changes in eating habits. We expect them to play important roles as part of the East Asia food composition tables. Copyright © 2017. Published by Elsevier Ltd.

  14. The Caux Round Table principles for business.

    Science.gov (United States)

    Curtin, L L

    1996-02-01

    In 1994, the Caux Round Table in Switzerland developed what is believed to be the first international code of business ethics. Business leaders from Japan, Europe and the United States collaborated to create a set of principles rooted in two basic ideals: kyosei and human dignity. Because of its importance and its applicability to the conduct of today's health care businesses, this entire column is devoted to reprinting these "Principles for Business."

  15. Tables of double beta decay data

    Energy Technology Data Exchange (ETDEWEB)

    Tretyak, V.I. [AN Ukrainskoj SSR, Kiev (Ukraine)]|[Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Zdesenko, Y.G. [AN Ukrainskoj SSR, Kiev (Ukraine)

    1995-12-31

    A compilation of experimental data on double beta decay is presented. The tables contain the most stringent known experimental limits or positive results of 2{beta} transitions of 69 natural nuclides to ground and excited states of daughter nuclei for different channels (2{beta}{sup -}; 2{beta}{sup +}; {epsilon}{beta}{sup +}; 2{epsilon}) and modes (0{nu}; 2{nu}; 0{nu}M) of decay. (authors). 189 refs., 9 figs., 3 tabs.

  16. Tables of thermodynamic properties of sodium

    Energy Technology Data Exchange (ETDEWEB)

    Fink, J.K.

    1982-06-01

    The thermodynamic properties of saturated sodium, superheated sodium, and subcooled sodium are tabulated as a function of temperature. The temperature ranges are 380 to 2508 K for saturated sodium, 500 to 2500 K for subcooled sodium, and 400 to 1600 K for superheated sodium. Tabulated thermodynamic properties are enthalpy, heat capacity, pressure, entropy, density, instantaneous thermal expansion coefficient, compressibility, and thermal pressure coefficient. Tables are given in SI units and cgs units.

  17. Web life: The Periodic Table of Videos

    Science.gov (United States)

    2009-01-01

    Eagle-eyed readers may spot a change in this column. Previously known as Blog life, it highlighted top picks from the physics blogosphere, and was itself an outgrowth of an earlier column on physics books, Shelf life. The new Web life column will continue to feature the best of physics blogging, but it will also include other types of Web content of interest to Physics World readers. First up is a periodic table of videos from Nottingham University in the UK.

  18. XII Tables for researchers on extraterrestrial intelligence

    Science.gov (United States)

    Cocca, Aldo Armando

    In the legal field, studies on extraterrestrial intelligence began four years before the leading article on interstellar communication was published. Even though discussion of the legal problems still lacks a juridical framework of universal acceptance, a few guidelines are suggested under the title of XII Tables (or Commandments). The XII Tables, which was the Romans' first code, also included provisions on international law and may be seen as a very important source of the law of nations. Their great merit was brevity, which allowed the progressive development of the law. These XII Tables have been divided into six to guide reactions in the event messages or signals are received, and six to determine the behavior of those responsible for answering if and when a communication attempt takes place. They were drafted on the basis of what is known as "ethics" and "law" in a way that any progress in this respect may be to the credit of our civilization and the human condition. For a wise and cautious analysis of the matter, the creation of a committee of representatives of governmental and non-governmental organizations is proposed.

  19. Mini table de radionucléides

    CERN Document Server

    2015-01-01

    Cette table est un outil pratique et quotidien pour tous les travailleurs opérant au contact de radionucléides. Elle concerne tous les secteurs scientifiques et techniques, comme la médecine, la recherche ou l'industrie. La Mini Table de radionucléides a été conçue comme un instrument permettant de repérer et valider rapidement les principales caractéristiques des radionucléides les plus utilisés (environ 300) que l'on rencontre en milieu médical, industriel, nucléaire, gestion des déchets, etc. Présentée en format de poche, elle permet pour chaque radionucléide d'indiquer ses caractéristiques fondamentales : La période radioactive ; Le ou les principaux modes de désintégration ; Les principales émissions en termes d'énergie et d'intensité. Pour des caractéristiques complètes, l'ouvrage renvoie aux Tables de Données de référence. Au sein du CEA, le Laboratoire National Henri Becquerel (LNHB) est mandaté par le Laboratoire National de Métrologie et d'Essais (LNE) comme laboratoir...

  20. STILTS -- Starlink Tables Infrastructure Library Tool Set

    Science.gov (United States)

    Taylor, Mark

    STILTS is a set of command-line tools for processing tabular data. It has been designed for, but is not restricted to, use on astronomical data such as source catalogues. It contains both generic (format-independent) table processing tools and tools for processing VOTable documents. Facilities offered include crossmatching, format conversion, format validation, column calculation and rearrangement, row selection, sorting, plotting, statistical calculations and metadata display. Calculations on cell data can be performed using a powerful and extensible expression language. The package is written in pure Java and based on STIL, the Starlink Tables Infrastructure Library. This gives it high portability, support for many data formats (including FITS, VOTable, text-based formats and SQL databases), extensibility and scalability. Where possible the tools are written to accept streamed data so the size of tables which can be processed is not limited by available memory. As well as the tutorial and reference information in this document, detailed on-line help is available from the tools themselves. STILTS is available under the GNU General Public Licence.

  1. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  2. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the grids......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...

  3. International thermodynamic tables of the fluid state helium-4

    CERN Document Server

    Angus, S; McCarty, R D

    2013-01-01

    International Thermodynamic Tables of the Fluid State Helium-4 presents the IUPAC Thermodynamic Tables for the thermodynamic properties of helium. The IUPAC Thermodynamic Tables Project has therefore encouraged the critical analysis of the available thermodynamic measurements for helium and their synthesis into tables. This book is divided into three chapters. The first chapter discusses the experimental results and compares with the equations used to generate the tables. These equations are supplemented by a vapor pressure equation, which represents the 1958 He-4 scale of temperature that is

  4. The Relationship of Stated Learning Preferences, Personality Type, and Career Background to Academic and Leadership Performance at the United States Air Command and Staff College

    Science.gov (United States)

    1999-12-11

    psychoanalysis , and humanism while Hannafin et al. (1997) added constructivism and situated cognition as a third and fourth theory base along with...adjustedR2 = .058. Table 10 provides model variables. Table 10 Regression Model Summary for LPS Variable Beta 1 ^ig ^ art Career Background -.229... art and science of combined and joint air operations. This research also provides ACSC with a unique learning preferences survey that has endured

  5. Ac45 silencing mediated by AAV-sh-Ac45-RNAi prevents both bone loss and inflammation caused by periodontitis.

    Science.gov (United States)

    Zhu, Zheng; Chen, Wei; Hao, Liang; Zhu, Guochun; Lu, Yun; Li, Sheng; Wang, Lin; Li, Yi-Ping

    2015-07-01

    Periodontitis induced by oral pathogens leads to severe periodontal tissue damage and osteoclast-mediated bone resorption caused by inflammation. On the basis of the importance of Ac45 in osteoclast formation and function, we performed this study to evaluate the therapeutic potential of periodontitis by local adeno-associated virus (AAV)-mediated Ac45 gene knockdown. We used AAV-mediated short hairpin RNAi knockdown of Ac45 gene expression (AAV-sh-Ac45) to inhibit bone erosion and gingival inflammation simultaneously in a well-established periodontitis mouse model induced by Porphyromonas gingivalis W50. Histological studies were performed to evaluate the bone protection of AAV-sh-Ac45. Immunochemistry, ELISA and qRT-PCR were performed to reveal the role of Ac45 knockdown on inflammation, immune response and expression of cytokine. We found that Ac45 knockdown impaired osteoclast-mediated extracellular acidification and bone resorption in vitro and in vivo. Furthermore, local administration of AAV-sh-Ac45 protected mice from bone erosion by >85% and attenuated inflammation and decreased infiltration of T cells, dendritic cells and macrophages in the periodontal lesion. Notably, the expression of pro-inflammatory cytokines was also reduced. Local AAV-sh-Ac45 gene therapy efficiently protects against periodontal tissue damage and bone erosion through both inhibition of osteoclast function and attenuating inflammation, and may represent a powerful new treatment strategy for periodontitis. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  6. ISTTOK upgrade towards AC and remote operation

    Science.gov (United States)

    Fernandes, H.; Silva, C.; Carvalho, B.; Sousa, J.; Valcárcel, D.; Neto, A.; Fortunato, J.; Carvalho, I.; Varandas, C. A. F.

    2006-12-01

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed. In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented. The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat.

  7. Measuring Disclosure Risk and Data Utility for Flexible Table Generators

    Directory of Open Access Journals (Sweden)

    Shlomo Natalie

    2015-06-01

    Full Text Available Statistical agencies are making increased use of the internet to disseminate census tabular outputs through web-based flexible table-generating servers that allow users to define and generate their own tables. The key questions in the development of these servers are: (1 what data should be used to generate the tables, and (2 what statistical disclosure control (SDC method should be applied. To generate flexible tables, the server has to be able to measure the disclosure risk in the final output table, apply the SDC method and then iteratively reassess the disclosure risk. SDC methods may be applied either to the underlying data used to generate the tables and/or to the final output table that is generated from original data. Besides assessing disclosure risk, the server should provide a measure of data utility by comparing the perturbed table to the original table. In this article, we examine aspects of the design and development of a flexible table-generating server for census tables and demonstrate a disclosure risk-data utility analysis for comparing SDC methods. We propose measures for disclosure risk and data utility that are based on information theory.

  8. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  9. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  10. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  11. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  12. Non-vanishing ponderomotive AC electrophoretic effect for particle trapping

    Energy Technology Data Exchange (ETDEWEB)

    Guan Weihua; Reed, Mark A [Department of Electrical Engineering, Yale University, New Haven, CT 06520 (United States); Park, Jae Hyun; Krstic, Predrag S, E-mail: mark.reed@yale.edu [Physics Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States)

    2011-06-17

    We present here a study on overlooked aspects of alternating current (AC) electrokinetics-AC electrophoretic (ACEP) phenomena. The dynamics of a particle with both polarizability and net charges in a non-uniform AC electric trapping field is investigated. It is found that either electrophoretic (EP) or dielectrophoretic (DEP) effects can dominate the trapping dynamics, depending on experimental conditions. A dimensionless parameter {gamma} is developed to predict the relative strength of EP and DEP effects in a quadrupole AC field. An ACEP trap is feasible for charged particles in 'salt-free' or low salt concentration solutions. In contrast to DEP traps, an ACEP trap favors the downscaling of the particle size.

  13. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  14. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  15. Initial tests of an AC dipole for the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; /Texas U.; Jansson, A.; /Fermilab; Kopp, S.; /Texas U.; Syphers, M.; /Fermilab

    2006-06-01

    The AC dipole is a device to diagnose transverse motions of a beam. It can achieve large-amplitude oscillations without two inevitable problems of conventional kicker/pinger magnets: decoherence and emittance growth. While not the first synchrotron to operate with an AC dipole, the Tevatron can now make use of its recently upgraded BPM system, providing unprecedented resolution for use with an AC dipole, to measure both linear and nonlinear properties of the accelerator. Plans are to provide AC dipole systems for both transverse degrees of freedom. Preliminary tests have been done using an audio power amplifier with an existing vertical pinger magnet, producing oscillation amplitudes up to 2{sigma} at 150 GeV. In this paper, we will present the configuration of this system. We also show the analysis of a first few data sets, including the direct measurement of beta functions at BPM locations.

  16. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    For a sufficiently strong ac field the dc conductance fluctuations are much stronger for the periodic pumping than in the case of the noise ac field of the same intensity. The reduction factor in a static magnetic field takes the universal value of 2 only for the white-noise pumping. In general may deviate from 2 thus ...

  17. AC magnetic dipole localization by a magnetoelectric sensor

    Science.gov (United States)

    Shen, Y.; McLaughlin, K. L.; Gao, J.; Gray, D.; Shen, L.; Wang, Y.; Li, M.; Berry, D.; Li, J.; Viehland, D.

    2012-06-01

    We report progress towards achievement of a triple-axis magnetoelectric (ME) sensor technology that is capable of localizing an AC magnetic dipole at quasi-static frequencies. Estimation of the location of the AC dipole was realized with the help of a grid search (GS) algorithm. The results show good convergence and accuracy of object location along three orthogonal directions. Through simulation analysis, the major localization errors were found to arise from sensor calibration.

  18. Mixed mobile ion effect on ac conductivity of boroarsenate glasses

    Indian Academy of Sciences (India)

    In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...

  19. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  20. Optimal football strategies: AC Milan versus FC Barcelona

    OpenAIRE

    Papahristodoulou, Christos

    2012-01-01

    In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

  1. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc....... Mathematically, our study refers to the expanding area of fractional calculus and we propose a systematic derivation of the fractional relaxation and fractional diffusion equations from the property of ac universality....

  2. PENGARUH BACKGROUND MAHASISWA TERHADAP KINERJA AKADEMIK

    OpenAIRE

    Trianasari Angkawijaya; Yenny Sugiarti

    2014-01-01

    Abstract: The Effect of Students’ Background on Academic Performance. This study examines the effect of background variables on the academic performance of accounting students in a private university in Surabaya. The background variables under study included previous academic performance, prior knowledge on accounting, sex, motivation, preparedness, and expectations. The results show that previous academic performance, motivation, and expectations have positive and significant effects on the ...

  3. IRST infrared background analysis of bay environments

    CSIR Research Space (South Africa)

    Schwering, PBW

    2008-04-01

    Full Text Available environment. Some sensor management approaches for application in IRST systems is discussed. Keywords: Infrared backgrounds, coastal bay analysis, small surface target contrasts, IRST application. 1. INTRODUCTION More and more, coastal... in environments with highly cluttered backgrounds as well as rapidly varying atmospheric conditions. Threat contrasts may be low and varying in littoral environments, and the amount of background clutter can be severe. Electro-optical sensors, used for detection...

  4. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions

    Science.gov (United States)

    Lockerbie, N. A.; Tokmakov, K. V.

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m-1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain ratio

  5. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  6. Experimental verification of Faradaic charging in ac electrokinetics.

    Science.gov (United States)

    Ng, Wee Yang; Lam, Yee Cheong; Rodríguez, Isabel

    2009-04-23

    This paper investigates the phenomenon of Faradaic charging in ac electrokinetics. Faradaic reactions were suggested as a key effect responsible for the reversal of pumping direction in ac micropumps. However, this hypothesis has yet to be proven convincingly and directly. Here we present an ion detection strategy to determine the production of ions through Faradaic hydrolytic reactions originating from direct application of voltage to electrolytic solutions during ac electrokinetics. Experiments were performed with symmetrical planar electrodes aligned along a microfluidic channel. Fluorescein, a pH-dependent dye, was employed as the pH indicator for the detection of ion production. Images were captured for analysis at various voltage levels. From analyzing the fluorescence intensity and its distribution, it can be concluded that the production of ions from hydrolytic reactions takes place and increases with the ac voltage. The coefficient of deviation indicates a significant enhancement at ac voltage above 11 V(pp). Lastly, we demonstrate a strategy using dc-biased ac electrokinetics to achieve controllability in direction and magnitude of the net fluid flow in pumping application.

  7. Role of the AcsF protein in Chloroflexus aurantiacus.

    Science.gov (United States)

    Tang, Kuo-Hsiang; Wen, Jianzhong; Li, Xianglu; Blankenship, Robert E

    2009-06-01

    The green phototrophic bacteria contain a unique complement of chlorophyll pigments, which self-assemble efficiently into antenna structures known as chlorosomes with little involvement of protein. The few proteins found in chlorosomes have previously been thought to have a primarily structural function. The biosynthetic pathway of the chlorosome pigments, bacteriochlorophylls c, d, and e, is not well understood. In this report, we used spectroscopic, proteomic, and gene expression approaches to investigate the chlorosome proteins of the green filamentous anoxygenic phototrophic bacterium Chloroflexus aurantiacus. Surprisingly, Mg-protoporphyrin IX monomethyl ester (oxidative) cyclase, AcsF, was identified under anaerobic growth conditions. The AcsF protein was found in the isolated chlorosome fractions, and the proteomics analysis suggested that significant portions of the AcsF proteins are not accessible to protease digestion. Additionally, quantitative real-time PCR studies showed that the transcript level of the acsF gene is not lower in anaerobic growth than in semiaerobic growth. Since the proposed enzymatic activity of AcsF requires molecular oxygen, our studies suggest that the roles of AcsF in C. aurantiacus need to be investigated further.

  8. AC electrophoretic deposition of organic-inorganic composite coatings.

    Science.gov (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. Decolonizing Trauma Studies Round-Table Discussion

    Directory of Open Access Journals (Sweden)

    Stef Craps

    2015-11-01

    Full Text Available This round-table, which featured literary critics Professor Stef Craps, Professor Bryan Cheyette and Dr. Alan Gibbs, was recorded as part of the “Decolonizing Trauma Studies” symposium organized by Dr. Sonya Andermahr and Dr. Larissa Allwork at The School of The Arts, The University of Northampton (15 May 2015. Convened a week after the University of Zaragoza’s “Memory Frictions” conference, where Cheyette, Gibbs, Andermahr and Allwork gave papers, the Northampton symposium and round-table was sponsored by The School of The Arts to coincide with Andermahr’s guest editorship of this special issue of Humanities. Craps, Cheyette and Gibbs addressed five questions during the round-table. Namely, does trauma studies suffer from a form of psychological universalism? Do you see any signs that trauma studies is becoming more decolonized? What are the challenges of a decolonized trauma studies for disciplinary thinking? How does a decolonized trauma studies relate to pedagogical ethics? Finally, where do you see the future of the field? While this edited transcript retains a certain informality of style, it offers a significant contribution to knowledge by capturing a unique exchange between three key thinkers in contemporary trauma studies, providing a timely analysis of the impact of postcolonial theory on trauma studies, the state of the field and its future possibilities. Issues addressed include the problematic scholarly tendency to universalize a western model of Post-Traumatic Stress Disorder (PTSD; the question of the centrality of the Holocaust in trauma studies and the implications of this for the study of atrocities globally; the vexed issues posed by the representation of perpetrators; as well as how the basic tenets of western cultural trauma theory, until recently so often characterized by a Caruth-inspired focus on belatedness and afterwardness, are being rethought, both in response to developments in the US and in answer to

  10. Israel: Background and U.S. Relations

    Science.gov (United States)

    2012-11-07

    there are no options to divert the terrible end.” Aaron David Miller, “ Debunking Myths on Israel and U.S. Foreign Policy,” op. cit. 24 See, e.g...more stringent. Israel does not have a written constitution. Instead, 11 Basic Laws lay down the rules of government and enumerate fundamental rights...can be delayed until the end of March 2013, with the government managing finances within the framework of the 2012 budget in the meantime.17 Table

  11. Modulation schemes with enhanced switch thermal distribution for single-phase AC-DC-AC reduced-switch converters

    DEFF Research Database (Denmark)

    Qin, Zian; Loh, Poh Chiang; Blaabjerg, Frede

    2015-01-01

    though various topologies have been proposed. The motivation of this paper is to study two promising single-phase ac-dc-ac converters using reduced number of switches, and subsequently proposes new modulation schemes for them. The proposed schemes help the converters to achieve a better thermal spread...... among their switches, while keeping their dc-link voltages low. Single points of failure are thus minimized, allowing the converters to have longer lifetimes. Simulation and experimental results have demonstrated the intended performances and hence verifying the idea.......ulation schemes can significantly change the performance of a power converter in steady state, and they have been extensively studied, but mostly directed to three-phase topologies, where triplen offsets are added. Single-phase systems, including ac-dc-ac systems, are less widely pursued, even...

  12. Distributed hash table theory, platforms and applications

    CERN Document Server

    Zhang, Hao; Xie, Haiyong; Yu, Nenghai

    2013-01-01

    This SpringerBrief summarizes the development of Distributed Hash Table in both academic and industrial fields. It covers the main theory, platforms and applications of this key part in distributed systems and applications, especially in large-scale distributed environments. The authors teach the principles of several popular DHT platforms that can solve practical problems such as load balance, multiple replicas, consistency and latency. They also propose DHT-based applications including multicast, anycast, distributed file systems, search, storage, content delivery network, file sharing and c

  13. Hot Air Drying of Green Table Olives

    Directory of Open Access Journals (Sweden)

    Sayit Sargin

    2005-01-01

    Full Text Available The characteristics of hot air-drying of green table olives (Domat variety by using a tray dryer were studied. Air temperature varied from 40 to 70 °C with an air velocity of 1 m/s. Drying rate curves were determined and quality of dried green olives was evaluated by instrumental analysis (bulk density, particle density, porosity, shrinkage, moisture content, water activity, colour value, protein content, oil content, peroxide value and acidity. Consumers’ acceptance test and microbiological analysis were also applied.

  14. Construction of an automated table standing

    Science.gov (United States)

    Neira, R. E.; Barbero, M. D.; Di Giulio, E. A.; Folco, J. F.; Jiménez, G. F.

    2011-12-01

    In this paper, the construction of an upright stretcher designed for patients in rehabilitation. The standing back to patients' expectations of therapeutic improvement, allowing correct all the troubles of a passive long. It has been shown that this table favors not only physically but also has a psychological reach beyond the scope of physical therapy and strongly affects the recovery. At the same time, the use of an upright stretcher greatly decreases the biomechanical disorders of hospital staff in the process of recovery. Thus the problem of rehabilitation of trafficking in a comprehensive way which not only focuses on the patient's undivided attention but also includes medical and auxiliary personnel.

  15. Combining contingency tables with missing dimensions.

    Science.gov (United States)

    Dominici, F

    2000-06-01

    We propose a methodology for estimating the cell probabilities in a multiway contingency table by combining partial information from a number of studies when not all of the variables are recorded in all studies. We jointly model the full set of categorical variables recorded in at least one of the studies, and we treat the variables that are not reported as missing dimensions of the study-specific contingency table. For example, we might be interested in combining several cohort studies in which the incidence in the exposed and nonexposed groups is not reported for all risk factors in all studies while the overall numbers of cases and cohort size is always available. To account for study-to-study variability, we adopt a Bayesian hierarchical model. At the first stage of the model, the observation stage, data are modeled by a multinomial distribution with fixed total number of observations. At the second stage, we use the logistic normal (LN) distribution to model variability in the study-specific cells' probabilities. Using this model and data augmentation techniques, we reconstruct the contingency table for each study regardless of which dimensions are missing, and we estimate population parameters of interest. Our hierarchical procedure borrows strength from all the studies and accounts for correlations among the cells' probabilities. The main difficulty in combining studies recording different variables is in maintaining a consistent interpretation of parameters across studies. The approach proposed here overcomes this difficulty and at the same time addresses the uncertainty arising from the missing dimensions. We apply our modeling strategy to analyze data on air pollution and mortality from 1987 to 1994 for six U.S. cities by combining six cross-classifications of low, medium, and high levels of mortality counts, particulate matter, ozone, and carbon monoxide with the complication that four of the six cities do not report all the air pollution variables. Our

  16. Gaseous Electronics Tables, Atoms, and Molecules

    CERN Document Server

    Raju, Gorur Govinda

    2011-01-01

    With the constant emergence of new research and application possibilities, gaseous electronics is more important than ever in disciplines including engineering (electrical, power, mechanical, electronics, and environmental), physics, and electronics. The first resource of its kind, Gaseous Electronics: Tables, Atoms, and Molecules fulfills the author's vision of a stand-alone reference to condense 100 years of research on electron-neutral collision data into one easily searchable volume. It presents most--if not all--of the properly classified experimental results that scientists, researchers,

  17. ECOGRAMS FOR PHYTOSOCIOLOGICAL TABLES BASED ON ELLENBERG

    Directory of Open Access Journals (Sweden)

    H. ELLENBERG

    1996-01-01

    Full Text Available

    Description of the method to obtain ecograms, which can be calculated from normal phytosociological tables, plotting average values of Ellenberg’s Zeigewerte on 6 axes corresponding to diagonals of a hexagon. The ecogram is the ecological fingerprint of the association. With adequate software the ecogram can be obtained automatically. It makes possible the immediate comparison among different communities. Ecograms give the synecological characterization of associations and can be used for detecting ecological gradients and the delimitation of higher syntaxa. A first example consisting of a selected group of 33 forest communities from Italy is discussed.

  18. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  19. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...... it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach....

  20. Hanford Site background: Part 1, Soil background for nonradioactive analytes. Revision 1, Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    1993-04-01

    Volume two contains the following appendices: Description of soil sampling sites; sampling narrative; raw data soil background; background data analysis; sitewide background soil sampling plan; and use of soil background data for the detection of contamination at waste management unit on the Hanford Site.