WorldWideScience

Sample records for ac backgrounder table

  1. The Prioritization and Comparison of Technical Background Criteria in the Selection Of Iran's National Table Tennis Coach: Sport Elites Perspectives

    Directory of Open Access Journals (Sweden)

    Tahereh RAHMATI

    2015-06-01

    Full Text Available The purpose of this study was the prioritization and comparison of technical background criteria in the selection of Iran's national table tennis coach from the perspectives of sport elites. Method of this research was descriptive and survey kind. The study population were about 100 table tennis sport elites of whom 80 subjects were randomly selected based on Morgan table. Technical background criteria for national coach selection wer e based on McLean and Zakrajsk model. This questionnaire was provided with 7 items. The views of ten sport management professors were used for determining the content validity. To determine the reliability coefficient, Cronbach’s Alpha of 0.968 was used. T hese data were analyzed in both descriptive and inferential statistical. Descriptive statistics was used for description of demographic and inferential statistics was including Friedman Anova test for rating criteria and Kruskal - Wallis test for hypothesis and these data were analyzed using Spss software. The highest rank is for “Goodwill work and the lack of bad records in the past” and the lowest rank is for “Enough experience coaching in league and tournaments. There was no significa nt difference among sport elites to prioritize & compare of technical background criteria in the selection of Iran’s national table tennis coach (P>0.05.

  2. The eating assessment table-an evidence-based nutrition tool for clinicians: background, description, future of tool.

    Science.gov (United States)

    Govig, Bert; de Souza, Russell; Levitan, Emily B; Crookston, David; Kestens, Yan; Mendivil, Carlos O; Mittleman, Murray A

    2009-06-01

    The complex relationships between health and dietary components and patterns have been intensely studied. Researchers have developed various tools, such as food diaries and food frequency questionnaires, to help understand relationships between dietary components and health, and have developed indexes such as the Alternative Healthy Eating Index, and the revised Dietary Quality Index, to help understand relationships between dietary patterns and health. These tools have greatly enhanced our understanding, but they are too costly and cumbersome to use in routine clinical practice.This article gives a brief overview of the features and advantages of existing tools, and describes a new self-administered tool (the Eating Assessment Table) that retains many of the advantages of existing research tools, but which is simple enough to be used in clinical practice.The background and design of this tool are described as well as a mechanism for guiding the evolution of future versions of this tool. Forms for using this tool in clinical and research settings are supplied in English, French, and Spanish.

  3. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  4. Elementary Statistics Tables

    CERN Document Server

    Neave, Henry R

    2012-01-01

    This book, designed for students taking a basic introductory course in statistical analysis, is far more than just a book of tables. Each table is accompanied by a careful but concise explanation and useful worked examples. Requiring little mathematical background, Elementary Statistics Tables is thus not just a reference book but a positive and user-friendly teaching and learning aid. The new edition contains a new and comprehensive "teach-yourself" section on a simple but powerful approach, now well-known in parts of industry but less so in academia, to analysing and interpreting process dat

  5. Contingency Tables.

    Science.gov (United States)

    1980-02-01

    in Table 2, from Waite [1915], give the cross-classification or right-hand fingerprints according to the nimber of whorls and small loops. The total...number of whorls and small loops is at most 5, and the resulting table is triangular: Table 2: Fingerprints of the right hand classified by the number...Table 4. Estimated Expected Values for Fingerprint Data Under Quasi- Independence Small loops Whorls 0 1 2 3 4 5 Total 0 200.6 167.4 166.6 150.3

  6. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  7. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  8. Scanning table

    CERN Multimedia

    1960-01-01

    Before the invention of wire chambers, particles tracks were analysed on scanning tables like this one. Today, the process is electronic and much faster. Bubble chamber film - currently available - (links can be found below) was used for this analysis of the particle tracks.

  9. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  10. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  11. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  12. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    increased with temperature for all the biopolymers which corresponds to high polarization effect in these biopoly- mers. The AC impedance parameters for papain, gum aca- cia, gum tragacanth and gum guar are given for four different temperatures in table 1 for comparison. The conductivity of papain increases from 1·65× ...

  13. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  14. Background Material

    DEFF Research Database (Denmark)

    Zandersen, Marianne; Hyytiäinen, Kari; Saraiva, Sofia

    This document serves as a background material to the BONUS Pilot Scenario Workshop, which aims to develop harmonised regional storylines of socio-ecological futures in the Baltic Sea region in a collaborative effort together with other BONUS projects and stakeholders.......This document serves as a background material to the BONUS Pilot Scenario Workshop, which aims to develop harmonised regional storylines of socio-ecological futures in the Baltic Sea region in a collaborative effort together with other BONUS projects and stakeholders....

  15. Background radiation

    International Nuclear Information System (INIS)

    Arnott, D.

    1985-01-01

    The effects of background radiation, whether natural or caused by man's activities, are discussed. The known biological effects of radiation in causing cancers or genetic mutations are explained. The statement that there is a threshold below which there is no risk is examined critically. (U.K.)

  16. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  17. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  18. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  19. AC resistance measuring instrument

    Science.gov (United States)

    Hof, P.J.

    1983-10-04

    An auto-ranging AC resistance measuring instrument for remote measurement of the resistance of an electrical device or circuit connected to the instrument includes a signal generator which generates an AC excitation signal for application to a load, including the device and the transmission line, a monitoring circuit which provides a digitally encoded signal representing the voltage across the load, and a microprocessor which operates under program control to provide an auto-ranging function by which range resistance is connected in circuit with the load to limit the load voltage to an acceptable range for the instrument, and an auto-compensating function by which compensating capacitance is connected in shunt with the range resistance to compensate for the effects of line capacitance. After the auto-ranging and auto-compensation functions are complete, the microprocessor calculates the resistance of the load from the selected range resistance, the excitation signal, and the load voltage signal, and displays of the measured resistance on a digital display of the instrument. 8 figs.

  20. SUN HUB – ENERGY HUB FOR OUTDOOR TABLES

    DEFF Research Database (Denmark)

    Poulsen, Peter Behrensdorff; Benatto, Gisele Alves dos Reis; Riedel, Nicholas

    2017-01-01

    on festivals where people camps for several days it can be hard to have your portable units charged. In this this work we report a solar powered hub, as an add-on to a table in the urban environment for charging mobile phones and tablets and other handheld devices through USBs, charging laptops through AC...... Sun Hubs to monitor the overall energy system and the consumption of each functionality in the table....

  1. NNDSS - Table IV. Tuberculosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2016.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  2. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and selected...

  3. NNDSS - Table IV. Tuberculosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2014.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  4. NNDSS - Table III. Tuberculosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table III. Tuberculosis - 2017.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  5. NNDSS - Table IV. Tuberculosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2015.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  6. Tabled Execution in Scheme

    Energy Technology Data Exchange (ETDEWEB)

    Willcock, J J; Lumsdaine, A; Quinlan, D J

    2008-08-19

    Tabled execution is a generalization of memorization developed by the logic programming community. It not only saves results from tabled predicates, but also stores the set of currently active calls to them; tabled execution can thus provide meaningful semantics for programs that seemingly contain infinite recursions with the same arguments. In logic programming, tabled execution is used for many purposes, both for improving the efficiency of programs, and making tasks simpler and more direct to express than with normal logic programs. However, tabled execution is only infrequently applied in mainstream functional languages such as Scheme. We demonstrate an elegant implementation of tabled execution in Scheme, using a mix of continuation-passing style and mutable data. We also show the use of tabled execution in Scheme for a problem in formal language and automata theory, demonstrating that tabled execution can be a valuable tool for Scheme users.

  7. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and selected...

  8. Pension Insurance Data Tables

    Data.gov (United States)

    Pension Benefit Guaranty Corporation — Find out about retirement trends in PBGC's data tables. The tables include statistics on the people and pensions that PBGC protects, including how many Americans are...

  9. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  10. NNDSS - Table II. Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  11. Tilt Table Test

    Science.gov (United States)

    ... test may also be appropriate to investigate the cause of fainting if you've fainted only once, but another ... recommend a tilt table test to evaluate the cause of syncope. A tilt table test may also be recommended ...

  12. Single-Phase Direct Boost AC-AC Converter

    Directory of Open Access Journals (Sweden)

    URSARU, O.

    2017-11-01

    Full Text Available This paper introduces and studies a boost AC-AC converter circuit that can be used to supply power to the 220V receivers in the 110V grids or to increase and adjust voltage at the end of long lines. High frequency AC-AC converters have better specifications than alternative voltage phase control drives with thyristors or TRIACs. When frequency exceeds 20kHz, noise is eliminated, filters are smaller and efficiency is higher. The current waveform is much better, the output voltage can be higher than the input voltage and voltage control is more accurate.

  13. Table Tennis Club

    CERN Multimedia

    Table Tennis Club

    2013-01-01

    Apparently table tennis plays an important role in physics, not so much because physicists are interested in the theory of table tennis ball scattering, but probably because it provides useful breaks from their deep intellectual occupation. It seems that many of the greatest physicists took table tennis very seriously. For instance, Heisenberg could not even bear to lose a game of table tennis, Otto Frisch played a lot of table tennis, and had a table set up in his library, and Niels Bohr apparently beat everybody at table tennis. Therefore, as the CERN Table Tennis Club advertises on a poster for the next CERN Table Tennis Tournament: “if you want to be a great physicist, perhaps you should play table tennis”. Outdoor table at restaurant n° 1 For this reason, and also as part of the campaign launched by the CERN medical service “Move! & Eat better”, to encourage everyone at CERN to take regular exercise, the CERN Table Tennis Club, with the supp...

  14. Periodic Table of Students.

    Science.gov (United States)

    Johnson, Mike

    1998-01-01

    Presents an exercise in which an eighth-grade science teacher decorated the classroom with a periodic table of students. Student photographs were arranged according to similarities into vertical columns. Students were each assigned an atomic number according to their placement in the table. The table is then used to teach students about…

  15. AcuTable

    DEFF Research Database (Denmark)

    Dibbern, Simon; Rasmussen, Kasper Vestergaard; Ortiz-Arroyo, Daniel

    2017-01-01

    In this paper we describe AcuTable, a new tangible user interface. AcuTable is a shapeable surface that employs capacitive touch sensors. The goal of AcuTable was to enable the exploration of the capabilities of such haptic interface and its applications. We describe its design and implementation...

  16. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    Prakash

    Therefore, these glycoproteins appear to be potential candidates for a vector- directed transmission-blocking vaccine (TBV). [Chugh M, Gulati B R and Gakhar S K 2010 Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae); J.

  17. CERN Table Tennis Club

    CERN Multimedia

    CERN Table Tennis Club

    2014-01-01

    CERN Table Tennis Club Announcing CERN 60th Anniversary Table Tennis Tournament to take place at CERN, from July 1 to July 15, 2014   The CERN Table Tennis Club, reborn in 2008, is encouraging people at CERN to take more regular exercise. This is why the Club, thanks to the strong support of the CERN Staff Association, installed last season a first outdoor table on the terrace of restaurant # 1, and will install another one this season on the terrace of Restaurant # 2. Table tennis provides both physical exercise and friendly social interactions. The CERN Table Tennis club is happy to use the unique opportunity of the 60th CERN anniversary to promote table tennis at CERN, as it is a game that everybody can easily play, regardless of level. Table tennis is particularly well suited for CERN, as many great physicists play table tennis, as you might already know: “Heisenberg could not even bear to lose a game of table tennis”; “Otto Frisch played a lot of table tennis;...

  18. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  19. Electricity-AC versus DC

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  20. TABLE TENNIS CLUB

    CERN Multimedia

    TABLE TENNIS CLUB

    2010-01-01

    2010 CERN Table Tennis Tournament The CERN Table Tennis Club organizes its traditional CERN Table Tennis Tournament, at the Meyrin club, 2 rue de livron, in Meyrin, Saturday August 21st, in the afternoon. The tournament is open to all CERN staff, users, visitors and families, including of course summer students. See below for details. In order to register, simply send an E-mail to Jean-Pierre Revol (jean-pierre.revol@cern.ch). You can also download the registration form from the Club Web page (http://www.cern.ch/tabletennis), and send it via internal mail. Photo taken on August 22, 2009 showing some of the participants in the 2nd CERN Table Tennis tournament. INFORMATION ON CERN TABLE TENNIS CLUB CERN used to have a tradition of table tennis activities at CERN. For some reason, at the beginning of the 1980’s, the CERN Table Tennis club merged with the Meyrin Table Tennis club, a member of the Association Genevoise de Tennis de Table (AGTT). Therefore, if you want to practice table tennis, you...

  1. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 5. Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. Research News Volume 5 Issue 5 May 2000 pp 95-100. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/005/05/0095-0100 ...

  2. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  3. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  4. Standard Reference Tables -

    Data.gov (United States)

    Department of Transportation — The Standard Reference Tables (SRT) provide consistent reference data for the various applications that support Flight Standards Service (AFS) business processes and...

  5. AcEST: DK945159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  6. AcEST: DK945724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  7. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 ...

  8. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  9. AC power system breadboard

    Science.gov (United States)

    Wappes, Loran J.; Sundberg, R.; Mildice, J.; Peterson, D.; Hushing, S.

    1987-01-01

    The object of this program was to design, build, test, and deliver a high-frequency (20-kHz) Power System Breadboard which would electrically approximate a pair of dual redundant power channels of an IOC Space Station. This report describes that program, including the technical background, and discusses the results, showing that the major assumptions about the characteristics of this class of hardware (size, mass, efficiency, control, etc.) were substantially correct. This testbed equipment has been completed and delivered to LeRC, where it is operating as a part of the Space Station Power System Test Facility.

  10. The Living Periodic Table

    Science.gov (United States)

    Nahlik, Mary Schrodt

    2005-01-01

    To help make the abstract world of chemistry more concrete eighth-grade students, the author has them create a living periodic table that can be displayed in the classroom or hallway. This display includes information about the elements arranged in the traditional periodic table format, but also includes visual real-world representations of the…

  11. Table Tennis Club

    CERN Multimedia

    Table Tennis Club

    2011-01-01

    CERN Table Tennis Tournament Saturday 20th August 2011 at 13.30 at the CERN/Meyrin TT club (underneath the Piscine de Livron, rue de Livron 2, 1217 Meyrin) Details: http://cern.ch/club-TableTennis Registration: jean-pierre.revol@cern.ch Open to all CERN staff, visitors, summer students, and families

  12. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  13. Iris pigmentation and AC thresholds.

    Science.gov (United States)

    Roche, A F; Mukherjee, D; Chumlea, W C; Siervogel, R M

    1983-03-01

    Data from 160 White children were used to analyze possible associations between iris pigmentation and AC pure-tone thresholds. Iris pigmentation was graded from iris color using glass models of eyes, and AC thresholds were obtained under carefully controlled conditions. Analyses of variance using two groupings of iris color grades showed no evidence of an association between iris color grade and AC thresholds. Furthermore, inspection of arrays of the actual glass eye models, in conjunction with the order of mean thresholds at each test frequency, did not indicate the presence of an association between iris color grades and thresholds. It was concluded that while iris pigmentation may be related to some aspects of hearing ability, it does not appear to be related to AC thresholds in children.

  14. Getting started with tables.

    Science.gov (United States)

    Inskip, Hazel; Ntani, Georgia; Westbury, Leo; Di Gravio, Chiara; D'Angelo, Stefania; Parsons, Camille; Baird, Janis

    2017-01-01

    Tables are often overlooked by many readers of papers who tend to focus on the text. Good tables tell much of the story of a paper and give a richer insight into the details of the study participants and the main research findings. Being confident in reading tables and constructing clear tables are important skills for researchers to master. Common forms of tables were considered, along with the standard statistics used in them. Papers in the Archives of Public Health published during 2015 and 2016 were hand-searched for examples to illustrate the points being made. Presentation of graphs and figures were not considered as they are outside the scope of the paper. Basic statistical concepts are outlined to aid understanding of each of the tables presented. The first table in many papers gives an overview of the study population and its characteristics, usually giving numbers and percentages of the study population in different categories (e.g. by sex, educational attainment, smoking status) and summaries of measured characteristics (continuous variables) of the participants (e.g. age, height, body mass index). Tables giving the results of the analyses follow; these often include summaries of characteristics in different groups of participants, as well as relationships between the outcome under study and the exposure of interest. For continuous outcome data, results are often expressed as differences between means, or regression or correlation coefficients. Ratio/relative measures (e.g. relative risks, odds ratios) are usually used for binary outcome measures that take one of two values for each study participants (e.g. dead versus alive, obese versus non-obese). Tables come in many forms, but various standard types are described here. Clear tables provide much of the important detail in a paper and researchers are encouraged to read and construct them with care.

  15. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Slides

    Science.gov (United States)

    Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Steven P. Ferraro, U.S. Environmental Protection Agency, Newport, OR Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Her...

  16. Problem Posing with the Multiplication Table

    Science.gov (United States)

    Dickman, Benjamin

    2014-01-01

    Mathematical problem posing is an important skill for teachers of mathematics, and relates readily to mathematical creativity. This article gives a bit of background information on mathematical problem posing, lists further references to connect problem posing and creativity, and then provides 20 problems based on the multiplication table to be…

  17. Decision table languages and systems

    CERN Document Server

    Metzner, John R

    1977-01-01

    ACM Monograph Series: Decision Table Languages and Systems focuses on linguistic examination of decision tables and survey of the features of existing decision table languages and systems. The book first offers information on semiotics, programming language features, and generalization. Discussions focus on semantic broadening, outer language enrichments, generalization of syntax, limitations, implementation improvements, syntactic and semantic features, decision table syntax, semantics of decision table languages, and decision table programming languages. The text then elaborates on design im

  18. United States Life Tables, 1997.

    Science.gov (United States)

    Anderson, Robert N.

    1999-01-01

    The life tables in this report are current life tables for the United States based on age-specific death rates in 1997. Beginning with the 1997 tables, U.S. life tables have been constructed with a new methodology that is similar to that used in the decennial life tables. Life expectancy and other tables are shown for the first time for ages 85 to…

  19. Body Mass Index Table

    Science.gov (United States)

    ... Families ( We Can! ) Health Professional Resources Body Mass Index Table 1 for BMI greater than 35, go ... Health Information Email Alerts Jobs and Careers Site Index About NHLBI National Institute of Health Department of ...

  20. The Periodic Table CD.

    Science.gov (United States)

    Banks, Alton J.; Holmes, Jon L.

    1995-01-01

    Describes the characteristics of the digitized version of The Periodic Table Videodisc. Provides details about the organization of information and access to the data via Macintosh and Windows computers. (DDR)

  1. Setting the Periodic Table.

    Science.gov (United States)

    Saturnelli, Annette

    1985-01-01

    Examines problems resulting from different forms of the periodic table, indicating that New York State schools use a form reflecting the International Union of Pure and Applied Chemistry's 1984 recommendations. Other formats used and reasons for standardization are discussed. (DH)

  2. VMS forms Output Tables

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These output tables contain parsed and format validated data from the various VMS forms that are sent from any given vessel, while at sea, from the VMS devices on...

  3. Permit.LOA table

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This table includes the effective dates by vessel and permit number for each issued letter of authorization (LOA) by the Permit Office (APSD)

  4. A periodic table of coiled-coil protein structures.

    Science.gov (United States)

    Moutevelis, Efrosini; Woolfson, Derek N

    2009-01-23

    Coiled coils are protein structure domains with two or more alpha-helices packed together via interlacing of side chains known as knob-into-hole packing. We analysed and classified a large set of coiled-coil structures using a combination of automated and manual methods. This led to a systematic classification that we termed a "periodic table of coiled coils," which we have made available at http://coiledcoils.chm.bris.ac.uk/ccplus/search/periodic_table. In this table, coiled-coil assemblies are arranged in columns with increasing numbers of alpha-helices and in rows of increased complexity. The table provides a framework for understanding possibilities in and limits on coiled-coil structures and a basis for future prediction, engineering and design studies.

  5. A Comprehensive Assessment of the Effects of Transgenic Cry1Ac/Cry1Ab Rice Huahui 1 on Adult Micraspis discolor (Fabricius (Coleoptera: Coccinellidae.

    Directory of Open Access Journals (Sweden)

    Xia Zhou

    Full Text Available Micraspis discolor (Fabricius (Coleoptera: Coccinellidae is a widely distributed coleoptera predator in southern Asia in rice ecosystem, and adult M. discolor feed on both rice pollen and soft-bodied arthropods. Bitrophic bioassay and tritrophic bioassay were conducted to evaluate the potential impact of Cry1Ac/Cry1Ab-expressing rice Huahui 1 and its non-transgenic counterpart Minghui 63 on fitness parameters of adult M. discolor. The results showed that the survival, and fecundity of this beetle' adults were not different when they fed on Bt rice or non-Bt rice pollen or Nilaparvata lugens (Stål reared on Bt rice or non-Bt rice. Toxicity assessment to ensure M. discolor adults were not sensitive to Cry1Ab or Cry1Ac protein independent from the pollen background, M. discolor adults were fed with an artificial diet containing Cry1Ac, Cry1Ab or both protein approximately 10 times higher concentration than in Huahui 1 rice pollen. No difference was detected for any of the life-table parameters tested between Cry protein-containing and pure diet. Artificial diet containing E-64 (N-(trans-Epoxysuccinyl-L-leucine 4-guanidinobutylamide was included as a positive control. In contrast, the pre-oviposition and fecundity of M. discolor were significantly adversely affected by feeding on E-64-containing diet. In both bioassays, the uptakes of Cry protein by adult M. discolor were tested by ELISA measurements. These results indicated that adults of M. discolor are not affected by Cry1Ab- or Cry1Ac-expressing rice pollen and are not sensitive to Cry protein at concentrations exceeding the levels in rice pollen in Huahui1. This suggests that M. discolor adults would not be harmed by Cry1Ac/Cry1Ab rice if Bt rice Huahui 1 were commercialized.

  6. A Comprehensive Assessment of the Effects of Transgenic Cry1Ac/Cry1Ab Rice Huahui 1 on Adult Micraspis discolor (Fabricius) (Coleoptera: Coccinellidae).

    Science.gov (United States)

    Zhou, Xia; Guo, Yunling; Kong, Hua; Zuo, Jiao; Huang, Qixing; Jia, Ruizong; Guo, Anping; Xu, Lin

    2016-01-01

    Micraspis discolor (Fabricius) (Coleoptera: Coccinellidae) is a widely distributed coleoptera predator in southern Asia in rice ecosystem, and adult M. discolor feed on both rice pollen and soft-bodied arthropods. Bitrophic bioassay and tritrophic bioassay were conducted to evaluate the potential impact of Cry1Ac/Cry1Ab-expressing rice Huahui 1 and its non-transgenic counterpart Minghui 63 on fitness parameters of adult M. discolor. The results showed that the survival, and fecundity of this beetle' adults were not different when they fed on Bt rice or non-Bt rice pollen or Nilaparvata lugens (Stål) reared on Bt rice or non-Bt rice. Toxicity assessment to ensure M. discolor adults were not sensitive to Cry1Ab or Cry1Ac protein independent from the pollen background, M. discolor adults were fed with an artificial diet containing Cry1Ac, Cry1Ab or both protein approximately 10 times higher concentration than in Huahui 1 rice pollen. No difference was detected for any of the life-table parameters tested between Cry protein-containing and pure diet. Artificial diet containing E-64 (N-(trans-Epoxysuccinyl)-L-leucine 4-guanidinobutylamide) was included as a positive control. In contrast, the pre-oviposition and fecundity of M. discolor were significantly adversely affected by feeding on E-64-containing diet. In both bioassays, the uptakes of Cry protein by adult M. discolor were tested by ELISA measurements. These results indicated that adults of M. discolor are not affected by Cry1Ab- or Cry1Ac-expressing rice pollen and are not sensitive to Cry protein at concentrations exceeding the levels in rice pollen in Huahui1. This suggests that M. discolor adults would not be harmed by Cry1Ac/Cry1Ab rice if Bt rice Huahui 1 were commercialized.

  7. A Comprehensive Assessment of the Effects of Transgenic Cry1Ac/Cry1Ab Rice Huahui 1 on Adult Micraspis discolor (Fabricius) (Coleoptera: Coccinellidae)

    Science.gov (United States)

    Zhou, Xia; Guo, Yunling; Kong, Hua; Zuo, Jiao; Huang, Qixing; Jia, Ruizong; Guo, Anping; Xu, Lin

    2016-01-01

    Micraspis discolor (Fabricius) (Coleoptera: Coccinellidae) is a widely distributed coleoptera predator in southern Asia in rice ecosystem, and adult M. discolor feed on both rice pollen and soft-bodied arthropods. Bitrophic bioassay and tritrophic bioassay were conducted to evaluate the potential impact of Cry1Ac/Cry1Ab-expressing rice Huahui 1 and its non-transgenic counterpart Minghui 63 on fitness parameters of adult M. discolor. The results showed that the survival, and fecundity of this beetle’ adults were not different when they fed on Bt rice or non-Bt rice pollen or Nilaparvata lugens (Stål) reared on Bt rice or non-Bt rice. Toxicity assessment to ensure M. discolor adults were not sensitive to Cry1Ab or Cry1Ac protein independent from the pollen background, M. discolor adults were fed with an artificial diet containing Cry1Ac, Cry1Ab or both protein approximately 10 times higher concentration than in Huahui 1 rice pollen. No difference was detected for any of the life-table parameters tested between Cry protein-containing and pure diet. Artificial diet containing E-64 (N-(trans-Epoxysuccinyl)-L-leucine 4-guanidinobutylamide) was included as a positive control. In contrast, the pre-oviposition and fecundity of M. discolor were significantly adversely affected by feeding on E-64-containing diet. In both bioassays, the uptakes of Cry protein by adult M. discolor were tested by ELISA measurements. These results indicated that adults of M. discolor are not affected by Cry1Ab- or Cry1Ac-expressing rice pollen and are not sensitive to Cry protein at concentrations exceeding the levels in rice pollen in Huahui1. This suggests that M. discolor adults would not be harmed by Cry1Ac/Cry1Ab rice if Bt rice Huahui 1 were commercialized. PMID:26914608

  8. Les tables de multiplication

    OpenAIRE

    Ghys, Etienne

    2009-01-01

    International audience; Ah ! les tables de multiplication de notre enfance, quels mauvais souvenirs ! (en ce qui me concerne, c'est la table de 7 qui m'a posé des problèmes). Elles nous narguaient sur le dos des cahiers de brouillon... Y aurait-il encore aujourd'hui des mathématiciens qui tenteraient d'en simplifier l'usage ?

  9. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  10. AcEST: BP913556 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N Ubiquitin-protein ligase E3B OS=Homo sapie... 31 3.5 sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/F/G/H O...SVPALVTHLSTVTPERLTVLESHDMLRKF 287 >sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/

  11. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  12. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  13. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  14. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  15. X-ray table

    International Nuclear Information System (INIS)

    Craig, J.R.; Otto, G.W.

    1980-01-01

    An X-ray radiographic or fluoroscopic table is described which includes a film holder with a frame attached to a cable running over end pulleys for positioning the holder longitudinally as desired under the table top. The holder has a front opening to receive a cassette-supporting tray which can be slid out on tracks to change the cassette. A reed switch on the frame is opened by a permanent magnet on the tray only when the tray is half-way out. When the switch is closed, an electromagnet locks the pulley and the holder in place. The holder is thus automatically locked in place not only during exposure (tray in) but when the tray is out for changing the cassette. To re-position the holder, the operator pulls the tray half-out and, using the tray itself, pushes the holder along the table, the holder being counterbalanced by a weight. (author)

  16. Table Tennis Club

    CERN Multimedia

    Table Tennis Club

    2012-01-01

    The CERN Table Tennis club and the Meyrin CTT are organizing two Table Tennis workshops from 2 to 6 July and from 20 to 24 August 2012 inclusive in Meyrin. A professional would be with your children from 14.00 pm to 18.00 pm: an instructor J + S category A. Training courses with specific themes, individual courses would be given depending on the level of the child’s game, “discoveries –table tennis games” courses and games with the robot. Other activities (stretching, relaxation). Afternoons (from 18 to 20 children): 40 CHF per workshop and per child. Evenings (from 18 to 20 adults): 60 CHF per workshop and per adult. For further information, please contact Mr. Monteil : Mobile: (+33) 06 61 31 70 47 E-mail: wilfried.monteil@free.fr.

  17. Periodic table of elements

    International Nuclear Information System (INIS)

    Fluck, E.; Heumann, K.G.

    1985-01-01

    Following a recommendation by the International Union for Pure and Applied Chemistry (IUPAC), the groups of the periodic table shall be numbered from 1 to 18, instead of I to VIII as before. The recommendations has been approved of by the Committee on Nomenclature of the American Chemical Society. The new system abandons the distinction between main groups (a) and auxiliary groups (b), which in the past frequently has been the reason for misunderstandings between European and American chemists, due to different handling. The publishing house VCH Verlagsgesellschaft recently produced a new periodic table that shows the old and the new numbering system together at a glance, so that chemists will have time to get familiar with the new system. In addition the new periodic table represents an extensive data compilation arranged by elements. The front page lists the chemical properties of elements, the back page their physical properties. (orig./EF) [de

  18. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  19. Metal weight table

    International Nuclear Information System (INIS)

    1995-03-01

    This book is comprised of two parts about metallic material weight table. the first part deals with steel on weight table of section steel and bar steel, hexagonal steel, equal angle steel, unequal angle steel, channel steel, T steel, H steel, CT steel, light gauge steel, light rail, stainless steel weight calculation, carbon steel pipe for general rescue a circular nail, zinc galvanizing and wire lope. The second part is about nonferrous metal on weight calculation for nonferrous metal nonferrous metal plates, steel pipe, brass copper bar and aluminum.

  20. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  1. Accounting for Readout Dark in ACS/WFC Superbiases

    Science.gov (United States)

    Ryon, J. E.; Grogin, N. A.; Coe, D.

    2017-12-01

    We investigate the properties of excess dark current accumulated during the 100-second full-frame readout of the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detectors. This excess dark current, called "readout dark", gives rise to ambient background gradients and hot columns in each ACS/WFC image. We present an analysis of simulated readout dark images developed in ACS ISR 2014-02, and find that the results from the simulated data cannot be fully reconciled with the results from observed bias images. We develop a new method to estimate the readout dark noise properties in ACS/WFC observations instead of using simulated images. While readout dark signal is removed from science images during the bias correction step in CALACS, the additional noise from the readout dark is currently not taken into account. We will update the ERR extensions of superbias images to include the appropriate noise from the ambient readout dark gradient and stable hot columns. We will also flag unstable hot columns in the DQ extensions of the superbiases. A new reference file pipeline for ACS/WFC that will implement these changes is currently under construction.

  2. A Modern Periodic Table.

    Science.gov (United States)

    Herrenden-Harker, B. D.

    1997-01-01

    Presents a modern Periodic Table based on the electron distribution in the outermost shell and the order of filling of the sublevels within the shells. Enables a student to read off directly the electronic configuration of the element and the order in which filling occurs. (JRH)

  3. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  4. Tomographic examination table

    International Nuclear Information System (INIS)

    Redington, R.W.; Henkes, J.L.

    1979-01-01

    Equipment is described for positioning and supporting patients during tomographic mammography using X-rays. The equipment consists of a table and fabric slings which permit the examination of a downward, pendant breast of a prone patient by allowing the breast to pass through a aperture in the table into a fluid filled container. The fluid has an X-ray absorption coefficient similar to that of soft human tissue allowing high density resolution radiography and permitting accurate detection of breast tumours. The shape of the equipment and the positioning of the patient allow the detector and X-ray source to rotate 360 0 about a vertical axis through the breast. This permits the use of relatively simple image reconstruction algorithms and a divergent X-ray geometry. (UK)

  5. Global Reference Tables Services Architecture

    Data.gov (United States)

    Social Security Administration — This database stores the reference and transactional data used to provide a data-driven service access method to certain Global Reference Table (GRT) service tables.

  6. Seashore marine table quiz

    OpenAIRE

    Institute, Marine

    2013-01-01

    Develop an increasing awareness of plants and animals that live in local marine environments including the seashore, seas and oceans of Ireland. After learning all about the seashore and other marine related lessons, this quiz can be used to evaluate the student’s knowledge of the marine related living things and natural environments. The table quiz can be used as a guide, highlighting facts about the marine environment and some of the animals that live there.

  7. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  8. Table Tennis Club

    CERN Multimedia

    Table Tennis Club

    2012-01-01

    2012 CERN Table Tennis Tournament As the campaign launched by the CERN medical service “Move! & Eat better” is designed in particular to encourage people at CERN to take more regular exercise, the CERN Table Tennis Club, with its traditional CERN Table Tennis Tournament is providing an excellent opportunity to practice moving. The tournament will take place at the Meyrin CTT, 2 rue de Livron, Saturday August 25, 2012, in the afternoon (starting at 13:30). It is open to all CERN staff, users, visitors and families, including of course summer students, who are strongly encouraged to participate. In order to register, simply send an E-mail to Jean-Pierre Revol (jean-pierre.revol@cern.ch). You may also find useful information on the Club Web page http://www.cern.ch/tabletennis CERN 2011 champion Savitha Flaecher, between the finalist Bertrand Mouches on her left, the winner of the consolation draw on her right (Sudarshan Paramesvaran), and far left, Denis Moriaud (semi-finalist a...

  9. Investigation of the transition of multicycle AC operation in ISTTOK under edge electrode biasing

    Science.gov (United States)

    Malaquias, A.; Henriques, R. B.; Silva, C.; Figueiredo, H.; Nedzelskiy, I. S.; Fernandes, H.; Sharma, R.; Plyusnin, V. V.

    2017-11-01

    In this paper we present recent results obtained on plasma edge electrode biasing during AC discharges. The goal is to obtain experimental evidence on a number of plasma parameters that can play a role during the AC transition on the repeatability and reproducibility of AC operation. The control of the plasma density in the quiescent phase is made just before the AC transition by means of positive edge biasing leading to a transitory improved of density (30%-40%). Gas puff experiments show that the increase of background gas pressure during discharge led to a better success of the AC transition. The experimental results indicate that the increase of density during the AC transition induced by edge biasing is followed by an electron temperature drop. The drop in electron temperature leads in most cases the formation of runaway electrons. It has been observed that the runaway population during discharge flattop depends on the interplay between gas content and plasma density and temperature. The results also confirm that the correct balance of external magnetic fields is crucial during the AC transition phase where drift electron currents are formed. The results from the heavy ion beam diagnostic show that the formation of plasma current during consecutive AC transitions is asymmetric. Numerical simulations indicate that for some particular conditions this result could be reproduced from assuming the presence of two counter-currents during AC transition.

  10. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  11. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  12. Supplementary data: Table 1. QTL for tassel related traits of F2:3 ...

    Indian Academy of Sciences (India)

    User

    Supplementary data: Table 1. QTL for tassel related traits of F2:3 population across and RIL population through single-environment analysis (SEA). Trait. Population. Environment. QTL. Binlocusa. Flanking marker. Peak position. (cM). Range. (cM)b. Ac. Dd. Gene actione. R2(%)f. Subtotal R2. (%)g. F(0.05)h type. TTL. F2:3.

  13. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  14. Background sources at PEP

    International Nuclear Information System (INIS)

    Lynch, H.; Schwitters, R.F.; Toner, W.T.

    1988-01-01

    Important sources of background for PEP experiments are studied. Background particles originate from high-energy electrons and positrons which have been lost from stable orbits, γ-rays emitted by the primary beams through bremsstrahlung in the residual gas, and synchrotron radiation x-rays. The effect of these processes on the beam lifetime are calculated and estimates of background rates at the interaction region are given. Recommendations for the PEP design, aimed at minimizing background are presented. 7 figs., 4 tabs

  15. Cosmic Shear With ACS Pure Parallels

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  16. Symbol Tables and Branch Tables: Linking Applications Together

    Science.gov (United States)

    Handler, Louis M.

    2011-01-01

    This document explores the computer techniques used to execute software whose parts are compiled and linked separately. The computer techniques include using a branch table or indirect address table to connect the parts. Methods of storing the information in data structures are discussed as well as differences between C and C++.

  17. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  18. Three phase AC motor controller

    Science.gov (United States)

    Vuckovich, Michael; Wright, Maynard K.; Burkett, John P.

    1984-03-20

    A motor controller for a three phase AC motor (10) which is adapted to operate bidirectionally from signals received either from a computer (30) or a manual control (32). The controller is comprised of digital logic circuit means which implement a forward and reverse command signal channel (27, 29) for the application of power through the forward and reverse power switching relays (16, 18, 20, 22). The digital logic elements are cross coupled to prevent activation of both channels simultaneously and each includes a plugging circuit (65, 67) for stopping the motor upon the removal of control signal applied to one of the two channels (27, 29) for a direction of rotation desired. Each plugging circuit (65, 67) includes a one-shot pulse signal generator (88, 102) which outputs a single pulse signal of predetermined pulsewidth which is adapted to inhibit further operation of the application of power in the channel which is being activated and to apply a reversal command signal to the other channel which provides a reversed phase application of power to the motor for a period defined by the pulse-width output of the one-shot signal generator to plug the motor (10) which will then be inoperative until another rotational command signal is applied to either of the two channels.

  19. Influence of SDBD plasma aerodynamic actuation on flow control by AC power supply and AC-DC power supply

    Science.gov (United States)

    Hu, Xu; Gao, Chao; Hao, Jiangnan

    2018-01-01

    In this paper, the excitation effect of single dielectric barrier discharge plasma actuator (SDBD) is compared by using AC power supply and AC-DC power supply. AC-DC power supply is based on the AC power supply, just adding DC component. The flow measurement is carried out by PIV technique. Results show that the excitation effect of AC power supply and AC-DC power supply increases by the increase of voltage, the range of speed field excited by AC power is greater than that of AC-DC power supply. For x direction maximum speed, excited by AC power supply is close to AC-DC, and for y direction maximum speed, AC power supply is greater than AC-DC power supply. So the excitation effect of AC power supply is better than that of AC-DC power supply for SDBD.

  20. Table tennis dystonia.

    Science.gov (United States)

    Le Floch, Anne; Vidailhet, Marie; Flamand-Rouvière, Constance; Grabli, David; Mayer, Jean-Michel; Gonce, Michel; Broussolle, Emmanuel; Roze, Emmanuel

    2010-02-15

    Focal task-specific dystonia (FTSD) occurs exclusively during a specific activity that usually involves a highly skilled movement. Classical FTSD dystonias include writer's cramp and musician's dystonia. Few cases of sport-related dystonia have been reported. We describe the first four cases of FTSD related to table tennis (TT), two involving professional international competitors. We also systematically analyzed the literature for reports of sport-related dystonia including detailed clinical descriptions. We collected a total of 13 cases of sport-related dystonia, including our four TT players. Before onset, all the patients had trained for many years, for a large number of hours per week. Practice time had frequently increased significantly in the year preceding onset. As TT is characterized by highly skilled hand/forearm movements acquired through repetitive exercises, it may carry a higher risk of FTSD than other sports. Intensive training may result in maladaptive responses and overwhelm homeostatic mechanisms that regulate cortical plasticity in vulnerable individuals. Our findings support the importance of environmental risk factors in sport-related FTSD, as also suggested in classical FTSD, and have important implications for clinical practice. (c) 2010 Movement Disorder Society.

  1. A comprehensive assessment of the effects of Bt cotton on Coleomegilla maculata demonstrates no detrimental effects by Cry1Ac and Cry2Ab.

    Directory of Open Access Journals (Sweden)

    Yunhe Li

    Full Text Available The ladybird beetle, Coleomegilla maculata (DeGeer, is a common and abundant predator in many cropping systems. Its larvae and adults are predaceous, feeding on aphids, thrips, lepidopteran larvae and plant tissues, such as pollen. Therefore, this species is exposed to insecticidal proteins expressed in insect-resistant, genetically engineered cotton expressing Cry proteins derived from Bacillus thuringiensis (Bt. A tritrophic bioassay was conduced to evaluate the potential impact of Cry2Ab- and Cry1Ac-expressing cotton on fitness parameters of C. maculata using Bt-susceptible and -resistant larvae of Trichoplusia ni as prey. Coleomegilla maculata survival, development time, adult weight and fecundity were not different when they were fed with resistant T. ni larvae reared on either Bt or control cotton. To ensure that C. maculata were not sensitive to the tested Cry toxins independent from the plant background and to add certainty to the hazard assessment, C. maculata larvae were fed artificial diet incorporated with Cry2Ab, Cry1Ac or both at >10 times higher concentrations than in cotton tissue. Artificial diet containing E-64 was included as a positive control. No differences were detected in any life-table parameters between Cry protein-containing diet treatments and the control diet. In contrast, larvae of C. maculata fed the E-64 could not develop to the pupal stage and the 7-d larval weight was significantly negatively affected. In both feeding assays, the stability and bioactivity of Cry proteins in the food sources were confirmed by ELISA and sensitive-insect bioassays. Our results show that C. maculata is not affected by Bt cotton and is not sensitive to Cry2Ab and Cry1Ac at concentrations exceeding the levels in Bt cotton, thus demonstrating that Bt cotton will pose a negligible risk to C. maculata. More importantly, this study demonstrates a comprehensive system for assessing the risk of genetically modified plants on non

  2. MCNPX Model/Table Comparison

    International Nuclear Information System (INIS)

    Hendricks, J.S.

    2003-01-01

    MCNPX is a Monte Carlo N-Particle radiation transport code extending the capabilities of MCNP4C. As with MCNP, MCNPX uses nuclear data tables to transport neutrons, photons, and electrons. Unlike MCNP, MCNPX also uses (1) nuclear data tables to transport protons; (2) physics models to transport 30 additional particle types (deuterons, tritons, alphas, pions, muons, etc.); and (3) physics models to transport neutrons and protons when no tabular data are available or when the data are above the energy range (20 to 150 MeV) where the data tables end. MCNPX can mix and match data tables and physics models throughout a problem. For example, MCNPX can model neutron transport in a bismuth germinate (BGO) particle detector by using data tables for bismuth and oxygen and using physics models for germanium. Also, MCNPX can model neutron transport in UO 2 , making the best use of physics models and data tables: below 20 MeV, data tables are used; above 150 MeV, physics models are used; between 20 and 150 MeV, data tables are used for oxygen and models are used for uranium. The mix-and-match capability became available with MCNPX2.5.b (November 2002). For the first time, we present here comparisons that calculate radiation transport in materials with various combinations of data charts and model physics. The physics models are poor at low energies (<150 MeV); thus, data tables should be used when available. Our comparisons demonstrate the importance of the mix-and-match capability and indicate how well physics models work in the absence of data tables

  3. Finding Atmospheric Composition (AC) Metadata

    Science.gov (United States)

    Strub, Richard F..; Falke, Stefan; Fiakowski, Ed; Kempler, Steve; Lynnes, Chris; Goussev, Oleg

    2015-01-01

    The Atmospheric Composition Portal (ACP) is an aggregator and curator of information related to remotely sensed atmospheric composition data and analysis. It uses existing tools and technologies and, where needed, enhances those capabilities to provide interoperable access, tools, and contextual guidance for scientists and value-adding organizations using remotely sensed atmospheric composition data. The initial focus is on Essential Climate Variables identified by the Global Climate Observing System CH4, CO, CO2, NO2, O3, SO2 and aerosols. This poster addresses our efforts in building the ACP Data Table, an interface to help discover and understand remotely sensed data that are related to atmospheric composition science and applications. We harvested GCMD, CWIC, GEOSS metadata catalogs using machine to machine technologies - OpenSearch, Web Services. We also manually investigated the plethora of CEOS data providers portals and other catalogs where that data might be aggregated. This poster is our experience of the excellence, variety, and challenges we encountered.Conclusions:1.The significant benefits that the major catalogs provide are their machine to machine tools like OpenSearch and Web Services rather than any GUI usability improvements due to the large amount of data in their catalog.2.There is a trend at the large catalogs towards simulating small data provider portals through advanced services. 3.Populating metadata catalogs using ISO19115 is too complex for users to do in a consistent way, difficult to parse visually or with XML libraries, and too complex for Java XML binders like CASTOR.4.The ability to search for Ids first and then for data (GCMD and ECHO) is better for machine to machine operations rather than the timeouts experienced when returning the entire metadata entry at once. 5.Metadata harvest and export activities between the major catalogs has led to a significant amount of duplication. (This is currently being addressed) 6.Most (if not all

  4. MCNPX Model/Table Comparison

    CERN Document Server

    Hendricks, J S

    2003-01-01

    MCNPX is a Monte Carlo N-Particle radiation transport code extending the capabilities of MCNP4C. As with MCNP, MCNPX uses nuclear data tables to transport neutrons, photons, and electrons. Unlike MCNP, MCNPX also uses (1) nuclear data tables to transport protons; (2) physics models to transport 30 additional particle types (deuterons, tritons, alphas, pions, muons, etc.); and (3) physics models to transport neutrons and protons when no tabular data are available or when the data are above the energy range (20 to 150 MeV) where the data tables end. MCNPX can mix and match data tables and physics models throughout a problem. For example, MCNPX can model neutron transport in a bismuth germinate (BGO) particle detector by using data tables for bismuth and oxygen and using physics models for germanium. Also, MCNPX can model neutron transport in UO sub 2 , making the best use of physics models and data tables: below 20 MeV, data tables are used; above 150 MeV, physics models are used; between 20 and 150 MeV, data t...

  5. Elekta Precise Table characteristics of IGRT remote table positioning

    International Nuclear Information System (INIS)

    Riis, Hans L.; Zimmermann, Sune J.

    2009-01-01

    Cone beam CT is a powerful tool to ensure an optimum patient positioning in radiotherapy. When cone beam CT scan of a patient is acquired, scan data of the patient are compared and evaluated against a reference image set and patient position offset is calculated. Via the linac control system, the patient is moved to correct for position offset and treatment starts. This procedure requires a reliable system for movement of patient. In this work we present a new method to characterize the reproducibility, linearity and accuracy in table positioning. The method applies to all treatment tables used in radiotherapy. Material and methods. The table characteristics are investigated on our two recent Elekta Synergy Platforms equipped with Precise Table installed in a shallow pit concrete cavity. Remote positioning of the table uses the auto set-up (ASU) feature in the linac control system software Desktop Pro R6.1. The ASU is used clinically to correct for patient positioning offset calculated via cone beam CT (XVI)-software. High precision steel rulers and a USB-microscope has been used to detect the relative table position in vertical, lateral and longitudinal direction. The effect of patient is simulated by applying external load on the iBEAM table top. For each table position an image is exposed of the ruler and display values of actual table position in the linac control system is read out. The table is moved in full range in lateral direction (50 cm) and longitudinal direction (100 cm) while in vertical direction a limited range is used (40 cm). Results and discussion. Our results show a linear relation between linac control system read out and measured position. Effects of imperfect calibration are seen. A reproducibility within a standard deviation of 0.22 mm in lateral and longitudinal directions while within 0.43 mm in vertical direction has been observed. The usage of XVI requires knowledge of the characteristics of remote table positioning. It is our opinion

  6. The Periodic Table in Croatia

    Directory of Open Access Journals (Sweden)

    Raos, N.

    2011-12-01

    Full Text Available The Croatian (Yugoslav Academy of Sciences and Arts was the first academy to elect D. I. Mendeleev as its honorary member (1882, whereas the periodic table of the elements has been taught regularly at the Zagreb University since 1888. The early interest of Croatian chemists in the periodic table should be attributed primarily to their pan-Slavic attitude, particularly as proof that Slavic people were able to produce "their own Newtons" (M. V. Lomonosov and D. I. Mendeleev. Such enthusiastic views, however, did not help in analyzing the contribution of Mendeleev and other scientists to the discovery and development of the periodic table of the elements.

  7. Pancreatectomy risk calculator: an ACS-NSQIP resource

    Science.gov (United States)

    Parikh, Purvi; Shiloach, Mira; Cohen, Mark E; Bilimoria, Karl Y; Ko, Clifford Y; Hall, Bruce L; Pitt, Henry A

    2010-01-01

    Background The morbidity of pancreatoduodenectomy remains high and the mortality may be significantly increased in high-risk patients. However, a method to predict post-operative adverse outcomes based on readily available clinical data has not been available. Therefore, the objective was to create a ‘Pancreatectomy Risk Calculator’ using the American College of Surgeons-National Surgical Quality Improvement Program (ACS-NSQIP) database. Methods The 2005–2008 ACS-NSQIP data on 7571 patients undergoing proximal (n =4621), distal (n =2552) or total pancreatectomy (n =177) as well as enucleation (n =221) were analysed. Pre-operative variables (n =31) were assessed for prediction of post-operative mortality, serious morbidity and overall morbidity using a logistic regression model. Statistically significant variables were ranked and weighted to create a common set of predictors for risk models for all three outcomes. Results Twenty pre-operative variables were statistically significant predictors of post-operative mortality (2.5%), serious morbidity (21%) or overall morbidity (32%). Ten out of 20 significant pre-operative variables were employed to produce the three mortality and morbidity risk models. The risk factors included age, gender, obesity, sepsis, functional status, American Society of Anesthesiologists (ASA) class, coronary heart disease, dyspnoea, bleeding disorder and extent of surgery. Conclusion The ACS-NSQIP ‘Pancreatectomy Risk Calculator’ employs 10 easily assessable clinical parameters to assist patients and surgeons in making an informed decision regarding the risks and benefits of undergoing pancreatic resection. A risk calculator based on this prototype will become available in the future as on online ACS-NSQIP resource. PMID:20815858

  8. Let Us Make the Table Periodic.

    Science.gov (United States)

    Campbell, J. Arthur

    1989-01-01

    An approach to teaching the properties of the elements and their arrangement in the periodic table is suggested. Discussed are symbols for the elements, format of the table, and coding the properties of the elements on the table. (CW)

  9. Zambia Country Background Report

    DEFF Research Database (Denmark)

    Hampwaye, Godfrey; Jeppesen, Søren; Kragelund, Peter

    This paper provides background data and general information for the Zambia studies focusing on local food processing sub­‐sector; and the local suppliers to the mines as part of the SAFIC project (Successful African Firms and Institutional Change).......This paper provides background data and general information for the Zambia studies focusing on local food processing sub­‐sector; and the local suppliers to the mines as part of the SAFIC project (Successful African Firms and Institutional Change)....

  10. AC distribution system for TFTR pulsed loads

    International Nuclear Information System (INIS)

    Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

    1977-01-01

    This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

  11. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  12. Tomato leaf curl Kerala virus (ToLCKeV AC3 protein forms a higher order oligomer and enhances ATPase activity of replication initiator protein (Rep/AC1

    Directory of Open Access Journals (Sweden)

    Mukherjee Sunil K

    2010-06-01

    Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.

  13. The Table Mountain Field Site

    Data.gov (United States)

    Federal Laboratory Consortium — The Table Mountain Field Site, located north of Boulder, Colorado, is designated as an area where the magnitude of strong, external signals is restricted (by State...

  14. The redoubtable ecological periodic table

    Science.gov (United States)

    Ecological periodic tables are repositories of reliable information on quantitative, predictably recurring (periodic) habitat–community patterns and their uncertainty, scaling and transferability. Their reliability derives from their grounding in sound ecological principle...

  15. Table 1: Biofuels simulation scenarios

    Data.gov (United States)

    U.S. Environmental Protection Agency — A spreadsheet containing information used to generate Table 1. Agricultural Market sector results presented in the spreadsheet were generated elsewhere (non-EPA) and...

  16. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  17. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2016. In this Table, provisional* cases of selected† infrequently reported notifiable diseases...

  18. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  19. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  20. The Cosmic Background Explorer

    Science.gov (United States)

    Gulkis, Samuel; Lubin, Philip M.; Meyer, Stephan S.; Silverberg, Robert F.

    1990-01-01

    The Cosmic Background Explorer (CBE), NASA's cosmological satellite which will observe a radiative relic of the big bang, is discussed. The major questions connected to the big bang theory which may be clarified using the CBE are reviewed. The satellite instruments and experiments are described, including the Differential Microwave Radiometer, which measures the difference between microwave radiation emitted from two points on the sky, the Far-Infrared Absolute Spectrophotometer, which compares the spectrum of radiation from the sky at wavelengths from 100 microns to one cm with that from an internal blackbody, and the Diffuse Infrared Background Experiment, which searches for the radiation from the earliest generation of stars.

  1. The natural radiation background

    International Nuclear Information System (INIS)

    Duggleby, J.C.

    1982-01-01

    The components of the natural background radiation and their variations are described. Cosmic radiation is a major contributor to the external dose to the human body whilst naturally-occurring radionuclides of primordial and cosmogenic origin contribute to both the external and internal doses, with the primordial radionuclides being the major contributor in both cases. Man has continually modified the radiation dose to which he has been subjected. The two traditional methods of measuring background radiation, ionisation chamber measurements and scintillation counting, are looked at and the prospect of using thermoluminescent dosimetry is considered

  2. Cosmic Tachyon Background Radiation

    CERN Document Server

    Tomaschitz, R

    1999-01-01

    The equilibrium statistical mechanics of a background radiation of superluminal particles is investigated, based on a vectorial wave equation for tachyons of the Proca type. The partition function, the spectral energy density, and the various thermodynamic variables of an ideal Bose gas of tachyons in an open Robertson-Walker cosmology are derived. The negative mass square in the wave equation changes the frequency scaling in the Rayleigh-Jeans law, and there are also significant changes in the low temperature regime as compared to the microwave background, in particular in the caloric and thermal equations of state.

  3. TableButler – a Windows based tool for processing large data tables generated with high-throughput methods

    Directory of Open Access Journals (Sweden)

    Abdollahi Amir

    2009-07-01

    Full Text Available Abstract Background High-throughput "omics" based data analysis play emerging roles in life sciences and molecular diagnostics. This emphasizes the urgent need for user-friendly windows-based software interfaces that could process the diversity of large tab-delimited raw data files generated by these methods. Depending on the study, dozens to hundreds of these data tables are generated. Before the actual statistical or cluster analysis, these data tables have to be combined and merged to expression matrices (e.g., in case of gene expression analysis. Gene annotations as well as information concerning the samples analyzed may be appended, renewed or extended. Often additional data values shall be computed or certain features must be filtered out. Results In order to perform these tasks, we have developed a Microsoft Windows based application, "TableButler", which allows biologists or clinicians without substantial bioinformatics background to perform a plethora of data processing tasks required to analyze the large-scale data. Conclusion TableButler is a monolithic Windows application. It is implemented to handle, join and preprocess large tab delimited ASCII data files. The intuitive user interface enables scientists (e.g. biologists, clinicians or others to setup workflows for their specific problems by simple drag-and drop like operations. For more details about TableButler, visit http://www.OncoExpress.org/software/tablebutler.

  4. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats

    Science.gov (United States)

    Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Hertzsprung-Russell diagram are iconic information organizing systems because they are simple, easy to understand, exceptionally useful, and they foster the expansion of sc...

  5. Nonthermal cosmic neutrino background

    Science.gov (United States)

    Chen, Mu-Chun; Ratz, Michael; Trautner, Andreas

    2015-12-01

    We point out that, for Dirac neutrinos, in addition to the standard thermal cosmic neutrino background (C ν B ), there could also exist a nonthermal neutrino background with comparable number density. As the right-handed components are essentially decoupled from the thermal bath of standard model particles, relic neutrinos with a nonthermal distribution may exist until today. The relic density of the nonthermal (nt) background can be constrained by the usual observational bounds on the effective number of massless degrees of freedom Neff and can be as large as nν nt≲0.5 nγ. In particular, Neff can be larger than 3.046 in the absence of any exotic states. Nonthermal relic neutrinos constitute an irreducible contribution to the detection of the C ν B and, hence, may be discovered by future experiments such as PTOLEMY. We also present a scenario of chaotic inflation in which a nonthermal background can naturally be generated by inflationary preheating. The nonthermal relic neutrinos, thus, may constitute a novel window into the very early Universe.

  6. Nurse-led telephone-based follow-up of secondary prevention after acute coronary syndrome: One-year results from the randomized controlled NAILED-ACS trial

    OpenAIRE

    Huber, Daniel; Henriksson, Robin; Jakobsson, Stina; Mooe, Thomas

    2017-01-01

    Background. Secondary prevention after acute coronary syndrome (ACS) could reduce morbidity and mortality, but guideline targets are seldom reached. We hypothesized that nurse-led telephone- based intervention would increase adherence. Methods. The NAILED ACS trial is a prospective, controlled, randomized trial. Patients admitted for ACS at Ostersund hospital, Sweden, were randomized to usual follow-up by a general practitioner or a nurse-led intervention. The intervention comprised telephone...

  7. Mathematical tables tables of in g [z] for complex argument

    CERN Document Server

    Abramov, A A

    1960-01-01

    Mathematical Tables of In ? (z) for Complex Argument is a compilation of tables of In ? (z), z = x + iy, calculated for steps in x and y of 0.01 and with an accuracy of one unit in the last (the sixth) decimal place. Interpolation is used to calculate In ? (z) for intermediate values and is carried out separately for the real and imaginary parts of In ? (z). Six places are retained in interpolation.This book first explains how the values of In ? (z) are calculated using the asymptotic formula in a wide lattice with step h = 0.16, and how the tables and the nomograph are used. The values in the

  8. Magnetic AC loss in multi-filamentary Bi-2223/Ag tapes

    NARCIS (Netherlands)

    Oomen, M.P.; Rieger, J.; Leghissa, M.; ten Kate, Herman H.J.

    1997-01-01

    The ac loss in high-Tc superconducting tapes with twisted and non-twisted filaments has been studied by a magnetic method. A brief overview of the theoretical background and the experimental set-up is presented. Measurements were made at 77 K in a magnetic field of 50 Hz frequency and 0.001-0.7 T

  9. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (< 1 mCi) quantities for in-house chemistry and imaging research that aims to improve and assess 225Ac radiopharmaceutical targeting. This presentation provides an overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  10. United States Life Tables, 2013.

    Science.gov (United States)

    Arias, Elizabeth; Heron, Melonie; Xu, Jiaquan

    2017-04-01

    Objectives-This report presents complete period life tables for the United States by race, Hispanic origin, and sex, based on agespecific death rates in 2013. Methods-Data used to prepare the 2013 life tables are 2013 final mortality statistics; July 1, 2013 population estimates based on the 2010 decennial census; and 2013 Medicare data for persons aged 66-99. The methodology used to estimate the 2013 life tables was first implemented with data year 2008. The methodology used to estimate the life tables for the Hispanic population remains unchanged from that developed for the publication of life tables by Hispanic origin for data year 2006. Results-In 2013, the overall expectation of life at birth was 78.8 years, unchanged from 2012. Between 2012 and 2013, life expectancy at birth remained the same for both males (76.4) and females (81.2), for the black population (75.5), the Hispanic population (81.9), and the non-Hispanic black population (75.1). Life expectancy at birth declined for both the white population (79.1 to 79.0) and the non-Hispanic white population (78.9 to 78.8). All material appearing in this report is in the public domain and may be reproduced or copied without permission; citation as to source, however, is appreciated.

  11. single-phase dc phase dc-ac boost converter ac boost converter

    African Journals Online (AJOL)

    User

    supply (UPS) AC motor drives and other power sup systems, need to step-up the DC input voltage. increase the output voltage level in order requirements, DC-DC boost converter is used provide DC bus voltage for PWM inverters. Hence, conventional design always cascades DC and a separate DC-AC converter.

  12. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  13. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  14. Alternating current (AC) iontophoretic transport across human epidermal membrane: effects of AC frequency and amplitude.

    Science.gov (United States)

    Yan, Guang; Xu, Qingfang; Anissimov, Yuri G; Hao, Jinsong; Higuchi, William I; Li, S Kevin

    2008-03-01

    As a continuing effort to understand the mechanisms of alternating current (AC) transdermal iontophoresis and the iontophoretic transport pathways in the stratum corneum (SC), the objectives of the present study were to determine the interplay of AC frequency, AC voltage, and iontophoretic transport of ionic and neutral permeants across human epidermal membrane (HEM) and use AC as a means to characterize the transport pathways. Constant AC voltage iontophoresis experiments were conducted with HEM in 0.10 M tetraethyl ammonium pivalate (TEAP). AC frequencies ranging from 0.0001 to 25 Hz and AC applied voltages of 0.5 and 2.5 V were investigated. Tetraethyl ammonium (TEA) and arabinose (ARA) were the ionic and neutral model permeants, respectively. In data analysis, the logarithm of the permeability coefficients of HEM for the model permeants was plotted against the logarithm of the HEM electrical resistance for each AC condition. As expected, linear correlations between the logarithms of permeability coefficients and the logarithms of resistances of HEM were observed, and the permeability data were first normalized and then compared at the same HEM electrical resistance using these correlations. Transport enhancement of the ionic permeant was significantly larger than that of the neutral permeant during AC iontophoresis. The fluxes of the ionic permeant during AC iontophoresis of 2.5 V in the frequency range from 5 to 1,000 Hz were relatively constant and were approximately 4 times over those of passive transport. When the AC frequency decreased from 5 to 0.001 Hz at 2.5 V, flux enhancement increased to around 50 times over passive transport. While the AC frequency for achieving the full effect of iontophoretic enhancement at low AC frequency was lower than anticipated, the frequency for approaching passive diffusion transport at high frequency was higher than expected from the HEM morphology. These observations are consistent with a transport model of multiple

  15. The Cosmic Microwave Background

    Directory of Open Access Journals (Sweden)

    Jones Aled

    1998-01-01

    Full Text Available We present a brief review of current theory and observations of the cosmic microwave background (CMB. New predictions for cosmological defect theories and an overview of the inflationary theory are discussed. Recent results from various observations of the anisotropies of the microwave background are described and a summary of the proposed experiments is presented. A new analysis technique based on Bayesian statistics that can be used to reconstruct the underlying sky fluctuations is summarised. Current CMB data is used to set some preliminary constraints on the values of fundamental cosmological parameters $Omega$ and $H_circ$ using the maximum likelihood technique. In addition, secondary anisotropies due to the Sunyaev-Zel'dovich effect are described.

  16. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility...... and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  17. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  18. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  19. Sri Lanka; Background Papers

    OpenAIRE

    International Monetary Fund

    1995-01-01

    This Background Paper on Sri Lanka provides information on the economic developments during 1992–95. Developments in the domestic and external sectors are discussed. The deficiencies of the official consumer price index that resulted in a substantial understatement of inflation performance in 1994 and alternative estimates of underlying inflation are described. The structural rigidities in the labor market that perpetuate high unemployment and limit job growth are also described. The paper al...

  20. The Alfonsine tables of Toledo

    CERN Document Server

    Chabás, José

    2003-01-01

    The Alfonsine Tables of Toledo is for historians working in the fields of astronomy, science, the Middle Ages, Spanish and other Romance languages. It is also of interest to scholars interested in the history of Castile, in Castilian-French relations in the Middle Ages and in the history of patronage. It explores the Castilian canons of the Alfonsine Tables and offers a study of their context, language, astronomical content, and diffusion. The Alfonsine Tables of Toledo is unique in that it: includes an edition of a crucial text in history of science; provides an explanation of astronomy as it was practiced in the Middle Ages; presents abundant material on early scientific language in Castilian; presents new material on the diffusion of Alfonsine astronomy in Europe; describes the role of royal patronage of science in a medieval context.

  1. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  2. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  3. AC conductivity for a holographic Weyl semimetal

    Energy Technology Data Exchange (ETDEWEB)

    Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

    2017-03-23

    We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

  4. Statistical probability tables CALENDF program

    International Nuclear Information System (INIS)

    Ribon, P.

    1989-01-01

    The purpose of the probability tables is: - to obtain dense data representation - to calculate integrals by quadratures. They are mainly used in the USA for calculations by Monte Carlo and in the USSR and Europe for self-shielding calculations by the sub-group method. The moment probability tables, in addition to providing a more substantial mathematical basis and calculation methods, are adapted for condensation and mixture calculations, which are the crucial operations for reactor physics specialists. However, their extension is limited by the statistical hypothesis they imply. Efforts are being made to remove this obstacle, at the cost, it must be said, of greater complexity

  5. Safety and effectiveness of the new P2Y12r inhibitor agents vs clopidogrel in ACS patients according to the geographic area: East Asia vs Europe

    NARCIS (Netherlands)

    Giordana, Francesca; Montefusco, Antonio; D'Ascenzo, Fabrizio; Moretti, Claudio; Scarano, Silvia; Abu-Assi, Emad; Raposeiras-Roubín, Sergio; Henriques, Jose Paulo Simao; Saucedo, Jorge; González-Juanatey, José Ramón; Wilton, Stephen B.; Kikkert, Wouter J.; Nuñez-Gil, Iván; Ariza-Sole, Albert; Song, Xiantao; Alexopoulos, Dimitrios; Liebetrau, Christoph; Kawaji, Tetsuma; Huczek, Zenon; Nie, Shao-Ping; Fujii, Toshiharu; Correia, Luis; Kawashiri, Masa-Aki; García-Acuña, José María; Southern, Danielle; Alfonso, Emilio; Terol, Belén; Garay, Alberto; Zhang, Dongfeng; Chen, Yalei; Xanthopoulou, Ioanna; Osman, Neriman; Möllmann, Helge; Shiomi, Hiroki; Kowara, Michal; Filipiak, Krzysztof; Wang, Xiao; Yan, Yan; Fan, Jing-Yao; Ikari, Yuji; Nakahayshi, Takuya; Sakata, Kenji; Yamagishi, Masakazu; Kalpak, Oliver; Kedev, Sasko; Gaita, F.

    2016-01-01

    Background: In the setting of the Acute Coronary Syndrome (ACS), differences in response to prasugrel and ticagrelor between East Asian and European patients have not been investigated yet. Methods: This is a sub-analysis of the "BleeMACS registry". Patients admitted for ACS and underwent PCI from

  6. The exenatide analogue AC3174 attenuates hypertension, insulin resistance, and renal dysfunction in Dahl salt-sensitive rats

    Directory of Open Access Journals (Sweden)

    Fernandez Rayne

    2010-08-01

    Full Text Available Abstract Background Activation of glucagon-like peptide-1 (GLP-1 receptors improves insulin sensitivity and induces vasodilatation and diuresis. AC3174 is a peptide analogue with pharmacologic properties similar to the GLP-1 receptor agonist, exenatide. Hypothetically, chronic AC3174 treatment could attenuate salt-induced hypertension, cardiac morbidity, insulin resistance, and renal dysfunction in Dahl salt-sensitive (DSS rats. Methods DSS rats were fed low salt (LS, 0.3% NaCl or high salt (HS, 8% NaCl diets. HS rats were treated with vehicle, AC3174 (1.7 pmol/kg/min, or GLP-1 (25 pmol/kg/min for 4 weeks via subcutaneous infusion. Other HS rats received captopril (150 mg/kg/day or AC3174 plus captopril. Results HS rat survival was improved by all treatments except GLP-1. Systolic blood pressure (SBP was lower in LS rats and in GLP-1, AC3174, captopril, or AC3174 plus captopril HS rats than in vehicle HS rats (p Conclusions Thus, AC3174 had antihypertensive, cardioprotective, insulin-sensitizing, and renoprotective effects in the DSS hypertensive rat model. Furthermore, AC3174 improved animal survival, an effect not observed with GLP-1.

  7. Family Background and Entrepreneurship

    DEFF Research Database (Denmark)

    Lindquist, Matthew J.; Sol, Joeri; Van Praag, Mirjam

    Vast amounts of money are currently being spent on policies aimed at promoting entrepreneurship. The success of such policies, however, rests in part on the assumption that individuals are not ‘born entrepreneurs’. In this paper, we assess the importance of family background and neighborhood...... effects as determinants of entrepreneurship. We start by estimating sibling correlations in entrepreneurship. We find that between 20 and 50 percent of the variance in different entrepreneurial outcomes is explained by factors that siblings share. The average is 28 percent. Allowing for differential...... entrepreneurship does play a large role, as do shared genes....

  8. Background and introduction

    DEFF Research Database (Denmark)

    Jensen, Per Anker; van der Voordt, Theo; Coenen, Christian

    2012-01-01

    in scope between FM and CREM is that CREM has its focus on real estate as physical and economical assets utilized by an organisation, while FM has a wider service focus. The difference in scope between FM and CREM on one side and B2B marketing on the other is that FM and CREM are related to organisations...... background information to understand the following chapters in this book. Research limitations: The chapter is mainly based on the experience and knowledge of the editors. It does not include original research but provides an introductory overview of the book. Originality/value: This chapter takes a look...

  9. Malaysia; Background Paper

    OpenAIRE

    International Monetary Fund

    1996-01-01

    This Background Paper on Malaysia examines developments and trends in the labor market since the mid-1980s. The paper describes the changes in the employment structure and the labor force. It reviews wages and productivity trends and their effects on unit labor cost. The paper highlights that Malaysia’s rapid growth, sustained since 1987, has had a major impact on the labor market. The paper outlines the major policy measures to address the labor constraints. It also analyzes Malaysia’s recen...

  10. Multi-phase AC/AC step-down converter for distribution systems

    Energy Technology Data Exchange (ETDEWEB)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  11. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  12. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles.

    Science.gov (United States)

    Monte, Tainá C C; Gentile, Rosana; Garcia, Juberlan; Mota, Ester; Santos, Jeannie N; Maldonado Júnior, Arnaldo

    2014-12-01

    Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. cantonensis: ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1), but the same was not observed for ac8 (1.2:1). The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male) and distance from the anus to the rear end (female) compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  13. Report of the European Society of Cardiology Cardiovascular Round Table regulatory workshop update of the evaluation of new agents for the treatment of acute coronary syndrome: Executive summary.

    Science.gov (United States)

    Bueno, Héctor; de Graeff, Pieter; Richard-Lordereau, Isabelle; Emmerich, Joseph; Fox, Keith Aa; Friedman, Carola P; Gaudin, Christophe; El-Gazayerly, Amany; Goldman, Samantha; Hemmrich, Melanie; Henderson, Robert A; Himmelmann, Anders; Irs, Alar; Jackson, Neville; James, Stefan K; Katus, Hugo A; Laslop, Andrea; Laws, Ian; Mehran, Roxana; Ong, Seleen; Prasad, Krishna; Roffi, Marco; Rosano, Giuseppe Mc; Rose, Martin; Sinnaeve, Peter R; Stough, Wendy Gattis; Thygesen, Kristian; Van de Werf, Frans; Varin, Claire; Verheugt, Freek Wa; de Los Angeles Alonso García, Maria

    2016-06-29

    Regulatory authorities interpret the results of randomized controlled trials according to published principles. The European Medicines Agency (EMA) is planning a revision of the 2000 and 2003 guidance documents on clinical investigation of new medicinal products for the treatment of acute coronary syndrome (ACS) to achieve consistency with current knowledge in the field. This manuscript summarizes the key output from a collaborative workshop, organized by the Cardiovascular Round Table and the European Affairs Committee of the European Society of Cardiology, involving clinicians, academic researchers, trialists, European and US regulators, and pharmaceutical industry researchers. Specific questions in four key areas were selected as priorities for changes in regulatory guidance: patient selection, endpoints, methodologic issues and issues related to the research for novel agents. Patients with ST-segment elevation myocardial infarction (STEMI) and non-STEMI (NSTEMI) should be studied separately for therapies aimed at the specific pathophysiology of either condition, particularly for treatment of the acute phase, but can be studied together for other treatments, especially long-term therapy. Unstable angina patients should be excluded from acute phase ACS trials. In general, cardiovascular death and reinfarction are recommended for primary efficacy endpoints; other endpoints may be considered if specifically relevant for the therapy under study. New agents or interventions should be tested against a background of evidence-based therapy with expanded follow-up for safety assessment. In conclusion, new guidance documents for randomized controlled trials in ACS should consider changes regarding patient and endpoint selection and definitions, and trial designs. Specific requirements for the evaluation of novel pharmacological therapies need further clarification. © The European Society of Cardiology 2016.

  14. Sand and Water Table Play

    Science.gov (United States)

    Wallace, Ann H.; White, Mary J.; Stone, Ryan

    2010-01-01

    The authors observed preschoolers engaged at the sand and water table to determine if math could be found within their play. Wanting to understand how children interact with provided materials and what kinds of math ideas they explore during these interactions, the authors offer practical examples of how such play can promote mathematical…

  15. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  16. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele...

  17. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    intuition and reason, not by perception and induction'. On the Platonist view, because sentences cannot have either spatial or temporal location, they cannot have material properties either. This timeless and 'spaceless' nature of sentences Katz and Postal (1989:7) illustrate with reference http://spilplus.journals.ac.za/ ...

  18. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    deficiency, but to boorishness or ill-will. While grammatical error may reveal a speaker to be a less than proficient language- http://spilplus.journals.ac.za/ .... problems of meanlng, language use and the various linguistic aspects of interaction... contrastive analysis without a pragmalinguistic dimension is inadequate.".

  19. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    in general terms,. ° what does Gutt see as significant conceptual consequences of his work? Needless to say, the framework for this talk will be Sperber and. Wilson's relevance theory of verbal communication, which was sketched in yesterday's contribution by Melinda Sinclair. Within http://spilplus.journals.ac.za/ ...

  20. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  1. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to dat...

  2. The Computerized Table Setting Test for Detecting Unilateral Neglect

    Science.gov (United States)

    Ye, Byoung Seok; Lee, Hye Sun; Chang, Hyuk-Jae; Song, Dongbeom; Kim, Young Dae; Heo, Ji Hoe; Nam, Hyo Suk

    2016-01-01

    Background Patients with unilateral neglect fail to respond normally to stimuli on the left side. To facilitate the evaluation of unilateral spatial neglect, we developed a new application that runs on a tablet device and investigated its feasibility in stroke patients. Methods We made the computerized table setting test (CTST) to run on the tablet computer. Forty acute ischemic stroke patients (20 patients with right hemispheric infarction with neglect, 10 patients with right hemispheric infarction without neglect, and 10 patients with left hemispheric infarction) and 10 healthy controls were prospectively enrolled to validate the CTST. The test requires subjects to set a table by dragging 12 dishes located below the table on the tablet screen. The horizontal deviation of the 12 dishes from the midline of the table, the selection tendency measured by the sequence of the dish selection, and the elapsed time for table setting were calculated automatically. Results Parameters measured by the CTST were correlated with the results of conventional neglect tests. The horizontal deviation was significantly higher in patients with right hemispheric infarction with neglect compared with the other groups. The selection tendency and elapsed time also were significantly different in patients with right hemispheric infarction with neglect compared with the left hemispheric infarction and control groups, but were similar to those with right hemispheric infarction without neglect. Conclusions The CTST is feasible to administer and comparable with conventional neglect tests. This new application may be useful for the initial diagnosis and follow-up of neglect patients. PMID:26771512

  3. United States Life Tables, 2014.

    Science.gov (United States)

    Arias, Elizabeth; Heron, Melonie; Xu, Jiaquan

    2017-08-01

    Objectives-This report presents complete period life tables for the United States by race, Hispanic origin, and sex, based on age-specific death rates in 2014. Methods-Data used to prepare the 2014 life tables are 2014 final mortality statistics; July 1, 2014 population estimates based on the 2010 decennial census; and 2014 Medicare data for persons aged 66-99. The methodology used to estimate the life tables for the Hispanic population remains unchanged from the methodology developed for the publication of life tables by Hispanic origin for data year 2006. The methodology used to estimate the 2014 life tables for all other groups was first implemented with data year 2008. Results-In 2014, the overall expectation of life at birth was 78.9 years, a 0.1-year increase from 2013. Between 2013 and 2014, life expectancy at birth increased by 0.1 year for both males (76.4 to 76.5) and females (81.2 to 81.3) and for the black (75.5 to 75.6) and white (79.0 to 79.1) populations. Life expectancy at birth increased by 0.2 years for the Hispanic (81.9 to 82.1) and non-Hispanic black (75.1 to 75.3) populations. Life expectancy at birth remained unchanged for the non-Hispanic white population (78.8). All material appearing in this report is in the public domain and may be reproduced or copied without permission; citation as to source, however, is appreciated.

  4. Pump cavitation background noise

    International Nuclear Information System (INIS)

    Cha, Y.S.

    1976-01-01

    Cavitation is defined as the growth and collapse of cavities associated with the change in pressure in contrast to the case of boiling where change in temperature is the dominating factor. It is commonly accepted that cavitation inception occurs when the minimum pressure in a system reaches the vapor pressure corresponding to the local temperatures of the liquid. The foregoing statement is, in fact, another way of defining incipient boiling which is usually defined as the condition where the temperature reaches the saturation temperature corresponding to the system pressure. Therefore, there is no difference between cavitation and boiling since both are associated with the growth and collapse of bubbles in a liquid. Cavitation noise may not be avoidable for an LMFBR primary pump under normal operating conditions, and will be present as background during boiling detection by acoustic methods

  5. Man Made Elements Periodic Table, Astronomical Periodic Table, Geographic Periodic Table-Dimitri Mendeleev Imitation in the 21st Century

    Science.gov (United States)

    Struck, J.-T.

    2013-11-01

    A man made elements periodic table, including every single current element not just synthetic elements can be built differently than the naturally occurring element periodic table. Implications for knowing producible elements in space travel.

  6. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  7. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  8. Background information to the installers guide for small scale mains connected PV

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    This report contains background information used by BRE, EA Technology, Halcrows and Sundog when compiling guidance for the UK's New and Renewable Energy Programme on the installation of small-scale photovoltaics (PV) in buildings. The report considers: relevant standards; general safety issues; fire and safety issues, including the fire resistance of PV modules; PV module ratings such as maximum voltage and maximum current; DC cabling; the DC disconnect; the DC junction box; fault analysis; general and AC side earthing; DC earthing; lightning and surge suppression; inverters; AC modules; AC systems; getting connection; mounting options; and installation issues.

  9. Spectral clustering and biclustering learning large graphs and contingency tables

    CERN Document Server

    Bolla, Marianna

    2013-01-01

    Explores regular structures in graphs and contingency tables by spectral theory and statistical methods This book bridges the gap between graph theory and statistics by giving answers to the demanding questions which arise when statisticians are confronted with large weighted graphs or rectangular arrays. Classical and modern statistical methods applicable to biological, social, communication networks, or microarrays are presented together with the theoretical background and proofs. This book is suitable for a one-semester course for graduate students in data mining, mult

  10. Low background infrared (LBIR) facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Low background infrared (LBIR) facility was originally designed to calibrate user supplied blackbody sources and to characterize low-background IR detectors and...

  11. Hanford Site background: Part 1, Soil background for nonradioactive analytes

    International Nuclear Information System (INIS)

    1993-04-01

    Volume two contains the following appendices: Description of soil sampling sites; sampling narrative; raw data soil background; background data analysis; sitewide background soil sampling plan; and use of soil background data for the detection of contamination at waste management unit on the Hanford Site

  12. Superconductivity and the Periodic Table

    International Nuclear Information System (INIS)

    Chapnik, I.M.

    1985-01-01

    In view of the inability of the present theory of superconductivity to make reliable predictions for the magnitude of Tsub(c) it seems useful to search for empirical relationships between the composition of the compound and the Tsub(c) value. Table I gives a list of the available Tsub(c) data for transition metals (TM) having from 3 to 9 outer electrons and Tsub(c) data for non-transition elements (NTE) of groups IIB, IIIB and IVB, including data for amorphous (Am) structures and structures (marked by triangles) obtained at high pressures. The analogous metals have therefore the same structure. In Tables II to IV the Tsub(c) data are presented for analogous compounds of NTE from IB - VIB group. Conclusions are presented. (author)

  13. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2016. In this Table, provisional* cases of selected†infrequently reported notifiable diseases...

  14. NNDSS - Table II. Salmonellosis to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  15. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  16. NNDSS - Table II. Ehrlichiosis and Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis and Anaplasmosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  17. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  18. NNDSS - Table II. Legionellosis to Malaria

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  19. NNDSS - Table II. Meningococcal to Pertussis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal to Pertussis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  20. NNDSS - Table II. Tetanus to Varicella

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  1. NNDSS - Table II. Hepatitis (viral, acute) C

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) C - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  2. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  3. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  4. NNDSS - Table II. Babesiosis to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Coccidioidomycosis - 2014.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  5. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  6. Global Reference Tables for Management Information Systems

    Data.gov (United States)

    Social Security Administration — This database is a collection of reference tables that store common information used throughout SSA. These tables standardize code structures and code usage of SSA...

  7. Global Reference Tables for Production Systems

    Data.gov (United States)

    Social Security Administration — This database is a collection of reference tables that store common information used throughout SSA. These tables standardized code structures and code usage of SSA...

  8. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2014In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  9. NNDSS - Table II. Salmonellosis to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  10. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  11. Solar cell efficiency tables (version 50)

    Energy Technology Data Exchange (ETDEWEB)

    Green, Martin A. [Australian Centre for Advanced Photovoltaics, University of New South Wales, Sydney 2052 Australia; Hishikawa, Yoshihiro [National Institute of Advanced Industrial Science and Technology (AIST), Research Center for Photovoltaics (RCPV), Central 2, Umezono 1-1-1, Ibaraki Tsukuba 305-8568 Japan; Warta, Wilhelm [Department: Characterisation and Simulation/CalLab Cells, Fraunhofer-Institute for Solar Energy Systems, Heidenhofstr. 2 Freiburg D-79110 Germany; Dunlop, Ewan D. [European Commission-Joint Research Centre, Directorate C-Energy, Transport and Climate, Via E. Fermi 2749 Ispra IT-21027 VA Italy; Levi, Dean H. [National Renewable Energy Laboratory, 15013 Denver West Parkway Golden CO 80401 USA; Hohl-Ebinger, Jochen [Department: Characterisation and Simulation/CalLab Cells, Fraunhofer-Institute for Solar Energy Systems, Heidenhofstr. 2 Freiburg D-79110 Germany; Ho-Baillie, Anita W. H. [Australian Centre for Advanced Photovoltaics, University of New South Wales, Sydney 2052 Australia

    2017-06-21

    Consolidated tables showing an extensive listing of the highest independently confirmed efficiencies for solar cells and modules are presented. Guidelines for inclusion of results into these tables are outlined, and new entries since January 2017 are reviewed.

  12. NNDSS - Table II. Rubella to Salmonellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  13. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  14. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  15. NNDSS - Table II. West Nile to Zika

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile to Zika - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  16. NNDSS - Table II. Tetanus to Varicella

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  17. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  18. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during...

  19. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  20. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  1. NNDSS - Table II. Salmonellosis to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  2. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  3. NNDSS - Table II. Salmonellosis to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  4. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  5. Medicaid Statistical Information System (MSIS) Tables

    Data.gov (United States)

    U.S. Department of Health & Human Services — The 25 MSIS statistical tables contain national state-by-state data. These tables contain high-level aggregated statistics relating to Medicaid eligibility and...

  6. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  7. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  8. NNDSS - Table II. Tetanus to Varicella

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  9. NNDSS - Table II. Meningococcal disease to Pertussis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal disease to Pertussis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  10. NNDSS - Table II. West Nile to Zika

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile to Zika - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  11. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  12. NNDSS - Table II. Tetanus to Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  13. NNDSS - Table II. Tetanus to Vibriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding year),...

  14. NNDSS - Table II. Meningococcal disease to Pertussis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal disease to Pertussis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  15. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  16. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  17. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  18. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  19. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  20. NNDSS - Table II. Legionellosis to Malaria

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  1. NNDSS - Table II. Legionellosis to Malaria

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  2. NNDSS - Table II. Tetanus to Varicella

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  3. NNDSS - Table II. Meningococcal to Pertussis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal to Pertussis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  4. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  5. NNDSS - Table II. Ehrlichiosis and Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis and Anaplasmosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  6. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  7. NNDSS - Table II. Hepatitis (viral, acute) C

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) C - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  8. NNDSS - Table II. Rubella to Salmonellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  9. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  10. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  11. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  12. NNDSS - Table II. Hepatitis (viral, acute)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  13. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  14. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  15. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  16. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  17. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  18. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  19. NNDSS - Table II. Babesiosis to Campylobacteriosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  20. NNDSS - Table II. Lyme disease to Meningococcal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  1. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  2. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals...

  3. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the...

  4. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  5. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  6. NNDSS - Table II. Cryptosporidiosis to Dengue

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  7. The origins of Ptolemy's astronomical tables.

    Science.gov (United States)

    Newton, R. R.

    Following the line set by his earlier book 'The crime of Claudius Ptolemy' the author discusses here the numerous astronomical tables in Ptolemy's work that have been calculated with the aid of trigonometric tables, as well as a few that are nonlinear but that do not involve trigonometry. The purpose in this study is to determine, if possible, whether Ptolemy calculated these tables or whether he copied them from now-lost original works. The conclusion isthat Ptolemy made few if any original contributions to astronomy, either observational or computational.Contents: 1. Introduction; thetable of chords. 2. The tables of the latitude and of gnomon shadows.3. Tables of the Sun. 4. Astronomical geography. 5. The tables of theMoon. 6. Eclipse tables. 7. Tables of the planets. 8. The empirical basis for Hipparchus's mean motions of the Moon. 9. Summary and conclusions.

  8. NNDSS - Table II. West Nile virus disease

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  9. NNDSS - Table II. Legionellosis to Malaria

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  10. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2018. In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  11. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2017. In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  12. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2014.In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  13. NNDSS - Table I. infrequently reported notifiable diseases

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2015. In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  14. NNDSS - Table II. Giardiasis to Haemophilus influenza

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000...

  15. NNDSS - Table II. Shiga toxin to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2015. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  16. NNDSS - Table II. Shiga toxin to Shigellosis

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2016. In this Table, provisional* cases of selected† notifiable diseases (≥1,000 cases reported during the preceding...

  17. Template for Electronic Submission to ACS Journals

    Indian Academy of Sciences (India)

    MENG LIa,*, QIAOQIAO YANGa and RAN FANGb. aDepartment of Orthopaedics, Lanzhou General Hospital of Lanzhou Military District, Lanzhou 730050, P. R. China. bCollege of Chemistry and Chemical Engineering, Lanzhou University, Lanzhou 730000, P. R. China. e-mail: limenglz@126.com. Table of contents. 1.

  18. Managing Restaurant Tables using Constraints

    Science.gov (United States)

    Vidotto, Alfio; Brown, Kenneth N.; Beck, J. Christopher

    Restaurant table management can have significant impact on both profitability and the customer experience. The core of the issue is a complex dynamic combinatorial problem. We show how to model the problem as constraint satisfaction, with extensions which generate flexible seating plans and which maintain stability when changes occur. We describe an implemented system which provides advice to users in real time. The system is currently being evaluated in a restaurant environment.

  19. Supplemental Table S5.xls

    Indian Academy of Sciences (India)

    Weibo Xie

    1, Supplementary table 5B. Target genes of osa-miR399 and osa-miR530. The potential targets were predicted by the program of miRU: Plant microRNA Potential Target Finder at http://bioinfo3.noble.org/miRNA/miRU.htm. 2. 3, Target genes of osa-miR399i. 4. 5, ID, Target Site Alignment, Site, Score, Mismatch, Annotation.

  20. Table Extraction from Web Pages Using Conditional Random Fields to Extract Toponym Related Data

    Science.gov (United States)

    Luthfi Hanifah, Hayyu'; Akbar, Saiful

    2017-01-01

    Table is one of the ways to visualize information on web pages. The abundant number of web pages that compose the World Wide Web has been the motivation of information extraction and information retrieval research, including the research for table extraction. Besides, there is a need for a system which is designed to specifically handle location-related information. Based on this background, this research is conducted to provide a way to extract location-related data from web tables so that it can be used in the development of Geographic Information Retrieval (GIR) system. The location-related data will be identified by the toponym (location name). In this research, a rule-based approach with gazetteer is used to recognize toponym from web table. Meanwhile, to extract data from a table, a combination of rule-based approach and statistical-based approach is used. On the statistical-based approach, Conditional Random Fields (CRF) model is used to understand the schema of the table. The result of table extraction is presented on JSON format. If a web table contains toponym, a field will be added on the JSON document to store the toponym values. This field can be used to index the table data in accordance to the toponym, which then can be used in the development of GIR system.

  1. Field-expedient gynecologic examination table.

    Science.gov (United States)

    Hughey, M J; Patel, T G; Herrold, S B

    1997-10-01

    In field operational environments, the gynecologic health needs of women may be difficult to provide because of the lack of a small, lightweight, durable, inexpensive gynecologic examination table. Such a table already exists, in pieces, in the inventory of most field-deploying units of battalion aid station size or larger. Because the table's existence is not commonly known, we describe the assembly and use of this field-expedient gynecologic examination table.

  2. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    is then added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  3. Collapse of DNA in ac Electric Fields

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W.; Staunton, Rory J.; Ashan, Amir; Austin, Robert H.; Riehn, Robert

    2011-06-01

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  4. Collapse of DNA in ac electric fields.

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W; Staunton, Rory J; Ashan, Amir; Austin, Robert H; Riehn, Robert

    2011-06-17

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  5. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  6. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  7. 21 CFR 890.3750 - Mechanical table.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mechanical table. 890.3750 Section 890.3750 Food... DEVICES PHYSICAL MEDICINE DEVICES Physical Medicine Prosthetic Devices § 890.3750 Mechanical table. (a) Identification. A mechanical table is a device intended for medical purposes that has a flat surface that can be...

  8. The Different Periodic Tables of Dmitrii Mendeleev

    Science.gov (United States)

    Laing, Michael

    2008-01-01

    Between 1869 and 1905 the Russian chemist Dmitrii Mendeleev published several tables with different arrangements of the chemical elements. Four of these are compared with periodic tables by Russian scientists from 1934 and 1969. The difficulties caused by the lanthanoid elements are clearly seen in the table of 1905, which satisfactorily includes…

  9. On Importance of Rows for Decision Tables

    KAUST Repository

    AbouEisha, Hassan M.

    2017-06-21

    In this paper, we propose a method for the evaluation of importance of rows for decision tables. It is based on indirect information about changes in the set of reducts after removing the considered row from the table. We also discuss results of computer experiments with decision tables from UCI Machine Learning Repository.

  10. Cohort Working Life Tables for Older Canadians

    Directory of Open Access Journals (Sweden)

    Frank T. Denton

    2010-12-01

    those based on the period tables, for both men and women, and that is reflected in increased retirement expectancies. For example, a male aged 50 in 1976 could have expected to live three years longer and to have almost four more years in retirement, based on the male cohort table under medium assumptions, as compared with the corresponding period table.

  11. UARS PEM Level 2 VMAG AC V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  12. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  13. Guide to mathematical tables supplement no 1

    CERN Document Server

    Burunova, N M; Fedorova, R M

    1960-01-01

    A Guide to Mathematical Tables is a supplement to the Guide to Mathematical Tables published by the U.S.S.R. Academy of Sciences in 1956. The tables contain information on subjects such as powers, rational and algebraic functions, and trigonometric functions, as well as logarithms and polynomials and Legendre functions. An index listing all functions included in both the Guide and the Supplement is included.Comprised of 15 chapters, this supplement first describes mathematical tables in the following order: the accuracy of the table (that is, the number of decimal places or significant

  14. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  15. Executive Summary - Historical background

    International Nuclear Information System (INIS)

    2005-01-01

    matter physics experiments at the High Flux Reactor of The Laue Langevin Institute and the ISIS spallation source at Rutherford-Appleton. Recently, we very actively entered the ICARUS neutrino collaboration and were invited to the PIERRE AUGER collaboration which will search for the highest energies in the Universe. Having close ties with CERN we are very actively engaged in CROSS-GRID, a large computer network project. To better understand the historical background of the INP development, it is necessary to add a few comments on financing of science in Poland. During the 70's and the 80's, research was financed through the so-called Central Research Projects for Science and Technical Development. The advantage of this system was that state-allocated research funds were divided only by a few representatives of the scientific community, which allowed realistic allocation of money to a small number of projects. After 1989 we were able to purchase commercially available equipment, which led to the closure of our large and very experienced electronic workshop. We also considerably reduced our well equipped mechanical shop. During the 90's the reduced state financing of science was accompanied by a newly established Committee of Scientific Research which led to the creation of a system of small research projects. This precluded the development of more ambitious research projects and led to the dispersion of equipment among many smaller laboratories and universities. A large research establishment, such as our Institute, could not develop properly under such conditions. In all, between 1989 and 2004 we reduced our personnel from about 800 to 470 and our infrastructure became seriously undercapitalised. However, with energetic search for research funds, from European rather than national research programs, we hope to improve and modernize our laboratories and their infrastructure in the coming years

  16. Variable White Dwarf Data Tables

    Energy Technology Data Exchange (ETDEWEB)

    Bradley, P. A.

    1997-12-31

    Below, I give a brief explanation of the information in these tables. In all cases, I list the WD {number_sign}, either from the catalog of McCook {ampersand} Sion (1987) or determined by me from the epoch 1950 coordinates. Next, I list the most commonly used name (or alias), then I list the variable star designation if it is available. If not, I list the constellation name and a V** or?? depending on what the last designated variable star for that constellation is. I present epoch 2000 coordinates for all of the stars, which I precessed from the 1950 ones in most cases. I do not include proper motion effects; this is negligible for all except the largest proper motion DAV stars, such as L 19-2, BPM 37093, B 808, and G 29-38. Even in these cases, the error is no more than 30` in declination and 2 s in right ascension. I culled effective temperatures from the latest work (listed under each table); they are now much more homogeneous than before. I pulled the magnitude estimates from the appropriate paper, and they are mean values integrated over several cycles. The amplitude given is for the height of a typical pulse in the light curve. The periods correspond the dominant ones found in the light curve. In some cases, there is a band of power in a given period range, or the light curve is very complex, and I indicate this in the table. In the references, I generally list the paper with the most comprehensive pulsation analysis for the star in question. In some cases, there is more than one good reference, and I list them as well.

  17. Table-top job analysis

    Energy Technology Data Exchange (ETDEWEB)

    1994-12-01

    The purpose of this Handbook is to establish general training program guidelines for training personnel in developing training for operation, maintenance, and technical support personnel at Department of Energy (DOE) nuclear facilities. TTJA is not the only method of job analysis; however, when conducted properly TTJA can be cost effective, efficient, and self-validating, and represents an effective method of defining job requirements. The table-top job analysis is suggested in the DOE Training Accreditation Program manuals as an acceptable alternative to traditional methods of analyzing job requirements. DOE 5480-20A strongly endorses and recommends it as the preferred method for analyzing jobs for positions addressed by the Order.

  18. The lithotripsy table height: a novel predictor of outcome in shockwave lithotripsy

    OpenAIRE

    Enrique Ossandon,; Recabal, Pedro; Acevedo, Cristian; Flores, Jose Miguel; Marchant, Fernando

    2011-01-01

    BACKGROUND: Outcome of Extracorporeal Shockwave Lithotripsy (SWL) is determined by physical factors that affect stone fragmentation and clearance. PURPOSE: To evaluate the predictive value of the Lithotripsy Table Height (LTH) in SWL outcome. Lithotripsy Table Height (LTH) is a variable that represents skin to therapy head distance, and it is proportional to the energy that reaches the stone. MATERIALS AND METHODS: A prospective study enrolled patients undergoing SWL for radiopaque urinary st...

  19. Peakons and compactons on the background of periodic wave

    Indian Academy of Sciences (India)

    For convenience, here we only give the periodic solution from eqs (7), (5) and solution. (10) in table 1. G = Hy = −2χx ψy. [. 1 sin(χ + ψ) + cos(χ + ψ). ]2. ,. (8) where χ and ψ are arbitrary functions of {x, t} and {y}, respectively. 3. Novel solitary wave structures in the background of Jacobian elliptic waves. All rich localized ...

  20. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  1. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  2. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  3. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    OpenAIRE

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  4. Comportamento Acústico de Fachadas: Isolamento Acústico versus Permeabilidade ao Ar

    OpenAIRE

    Ferreira, Diogo Miguel do Rosário

    2016-01-01

    Nos dias de hoje, o conforto acústico dos edifícios revela-se como um factor muito importante no contexto da comodidade global dos seus habitantes. Para tanto, contribui de forma relevante o isolamento sonoro que as fachadas dos edifícios possam assegurar. Sendo as fachadas constituídas por uma parte opaca e uma outra translúcida, é esta última a que mais condiciona o isolamento acústico que o elemento fachada proporciona, o qual é influenciado tanto pela janela propriamente dita, como pelas ...

  5. The Cryogenic Anti-Coincidence detector for ATHENA X-IFU: pulse analysis of the AC-S7 single pixel prototype

    Science.gov (United States)

    D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.

    2016-07-01

    The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed TESes. The CryoAC development schedule foresees by Q1 2017 the delivery of a Demonstration Model (DM) to the X-IFU FPA development team. The DM is a single-pixel detector that will address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC

  6. A table-top LHC

    CERN Multimedia

    Barbara Warmbein

    2011-01-01

    Many years ago, when ATLAS was no more than a huge empty underground cavern and Russian artillery shell casings were being melted down to become part of the CMS calorimetry system, science photographer Peter Ginter started documenting the LHC’s progress. He was there when special convoys of equipment crossed the Jura at night, when cranes were lowering down detector slices and magnet coils were being wound in workshops. Some 18 years of LHC history have been documented by Ginter, and the result has just come out as a massive coffee table book full of double-page spreads of Ginter’s impressive images.   The new coffee table book, LHC: the Large Hadron Collider. Published by the Austrian publisher Edition Lammerhuber in cooperation with CERN and UNESCO Publishing, LHC: the Large Hadron Collider is an unusual piece in the company’s portfolio. As the publisher’s first science book, LHC: the Large Hadron Collider weighs close to five kilos and comes in a s...

  7. Potential factors impacting season-long expression of Cry1Ac in 13 commercial varieties of Bollgard® cotton

    Directory of Open Access Journals (Sweden)

    John J. Adamczyk, Jr.

    2001-11-01

    Full Text Available Thirteen commercial varieties of transgenic Cry1Ac Bacillus thuringiensis Berliner (Bt cotton were examined across two sites in 2000 for potential factors that impact endotoxin expression. In all cases, two varieties (NuCOTN 33B and DP 458B/RR, Delta and Pineland Co., Scott, MS expressed more Cry1Ac than the other 11 varieties in various plant structures. These two varieties share the same parental background (DP 5415. Furthermore, when the next generation of plants were tested in the greenhouse, the same varietal patterns were exhibited. These data strongly suggest that factors such as parental background had a stronger impact on the expression of Cry1Ac than the environment.

  8. Mapping the gravitational wave background

    OpenAIRE

    Cornish, Neil J.

    2001-01-01

    The gravitational wave sky is expected to have isolated bright sources superimposed on a diffuse gravitational wave background. The background radiation has two components: a confusion limited background from unresolved astrophysical sources; and a cosmological component formed during the birth of the universe. A map of the gravitational wave background can be made by sweeping a gravitational wave detector across the sky. The detector output is a complicated convolution of the sky luminosity ...

  9. JEM-X background models

    DEFF Research Database (Denmark)

    Huovelin, J.; Maisala, S.; Schultz, J.

    2003-01-01

    Background and determination of its components for the JEM-X X-ray telescope on INTEGRAL are discussed. A part of the first background observations by JEM-X are analysed and results are compared to predictions. The observations are based on extensive imaging of background near the Crab Nebula...

  10. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  11. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  12. Environmental regulatory update table, July 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-08-01

    This Environmental Regulatory Update Table (July 1991) provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  13. Environmental Regulatory Update Table, November 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-12-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  14. Environmental Regulatory Update Table, April 1989

    International Nuclear Information System (INIS)

    Houlberg, L.; Langston, M.E.; Nikbakht, A.; Salk, M.S.

    1989-05-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action

  15. Environmental Regulatory Update Table, December 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1992-01-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  16. Environmental regulatory update table, March 1989

    International Nuclear Information System (INIS)

    Houlberg, L.; Langston, M.E.; Nikbakht, A.; Salk, M.S.

    1989-04-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action

  17. Thermodynamic tables to accompany Modern engineering thermodynamics

    CERN Document Server

    Balmer, Robert T

    2011-01-01

    This booklet is provided at no extra charge with new copies of Balmer's Modern Engineering Thermodynamics. It contains two appendices. Appendix C contains 40 thermodynamic tables, and Appendix D consists of 6 thermodynamic charts. These charts and tables are provided in a separate booklet to give instructors the flexibility of allowing students to bring the tables into exams. The booklet may be purchased separately if needed.

  18. Environmental regulatory update table, March 1989

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.; Langston, M.E.; Nikbakht, A.; Salk, M.S.

    1989-04-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  19. Environmental Regulatory Update Table, April 1989

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.; Langston, M.E.; Nikbakht, A.; Salk, M.S.

    1989-05-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  20. Environmental Regulatory Update Table, August 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M., Hawkins, G.T.; Salk, M.S.

    1991-09-01

    This Environmental Regulatory Update Table (August 1991) provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  1. Environmental Regulatory Update Table, September 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-10-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  2. Environmental Regulatory Update Table, October 1991

    Energy Technology Data Exchange (ETDEWEB)

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-11-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  3. BACKGROUNDER

    International Development Research Centre (IDRC) Digital Library (Canada)

    Corey Piccioni

    Saharan Africa at US$4 billion per year for grains alone (World Bank, 2010). Considerable scope exists for research to find effecve ways to reduce food losses while increasing returns through product quality control, market segmentaon,.

  4. Backgrounder

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Center for Mountain Ecosystem Studies, Kunming Institute of Botany of the Chinese Academy of Sciences, China: $1,526,000 to inform effective water governance in the Asian highlands of China, Nepal, and Pakistan. • Ashoka Trust for Research in Ecology and the Environment (ATREE), India: $1,499,300 for research on ...

  5. BACKGROUNDER

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    particularly in urban areas and emerging hunger hotspots. Migration caused by the ... Deltas: Deltas in Africa and South Asia are some of the world's most vulnerable coastal areas because of a critical combination ... rise and land subsidence persist, 5.4 million people in Africa and Asia might be displaced by 2050:. 93% live.

  6. Backgrounder

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    inequalities, and poverty based on rigorous data collection and analysis. ... at how poor urban planning may be contributing to forced evictions and mass relocations, which in turn can lead to violence in the form of ... communities with similar conditions of social exclusion experience different levels of violence. The study will.

  7. BACKGROUNDER

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Through this initiative, four consortia will conduct research in three “hot spots” – regions where demographic trends, socio-economic development pathways, and strong climate signals put large numbers of people and their livelihoods at risk: semi-arid regions, deltas, and Himalayan river basins. The initiative brings ...

  8. Health effects assessment summary tables

    International Nuclear Information System (INIS)

    1999-01-01

    The document is an excellent pointer system to identify current literature or changes in assessment criteria for many chemicals of interest to Superfund. It was prepared for Superfund use by the Environmental Criteria and Assessment Office (ECAO-Cin) in EPA's Office of Health and Environmental Assessment. Chemicals considered are those for which Health Effects Assessment Documents, Health and Environmental Effects Profiles, Health Assessment Documents or Air Quality Criteria Documents have been prepared by ECAO. Radionuclides considered are those believed to be most common at Superfund sites. Tables summarize reference doses (RfDs) for toxicity from subchronic and chronic inhalation, oral exposure, slope factors and unit risk values for carcinogenicity based on lifetime inhalation and oral exposure, and radionuclide carcinogenicity

  9. A periodic table for cancer.

    Science.gov (United States)

    Epstein, Richard J

    2015-01-01

    Cancers exhibit differences in metastatic behavior and drug sensitivity that correlate with certain tumor-specific variables such as differentiation grade, growth rate/extent and molecular regulatory aberrations. In practice, patient management is based on the past results of clinical trials adjusted for these biomarkers. Here, it is proposed that treatment strategies could be fine-tuned upfront simply by quantifying tumorigenic spatial (cell growth) and temporal (genetic stability) control losses, as predicted by genetic defects of cell-cycle-regulatory gatekeeper and genome-stabilizing caretaker tumor suppressor genes, respectively. These differential quantifications of tumor dysfunction may in turn be used to create a tumor-specific 'periodic table' that guides rational formulation of survival-enhancing anticancer treatment strategies.

  10. The periodic table in Flatland

    Energy Technology Data Exchange (ETDEWEB)

    Negadi, T. [Universite d`Oran, Es-Senia (Algeria); Kibler, M. [Universite Claude Bernard, Villeurbanne (France)

    1996-01-05

    The D-dimensional Coulomb system serves as a starting point for generating generalized atomic shells. These shells are ordered according to a generalized Madelung rule in D dimensions. This rule together with an Aujbau Prinzip is applied to produce a D-dimensional periodic table. A model is developed to rationalize the ordering of the shells predicted by the generalized Madelung rule. This model is based on the introduction of a Hamiltonian, invariant under the q-deformed algebra U{sub q}(so(D)), that breaks down the SO(D + 1) dynamical symmetry of the hydrogen atom in D dimensions. The D = 2 case (Flatland) is investigated in some detail. It is shown that the neutral atoms and the (moderately) positive ions correspond to the values q = 0.8 and q = 1, respectively, of the deformation parameter q. 55 refs.

  11. On the Table of Plimpton 322

    OpenAIRE

    ASAI, Teruaki

    2012-01-01

    Plimpton 322 is an Old-Babylonian tablet consisting of a table of Pythagorean triples. In this article, we want to show the way how the table was made and the possible purpose of the table. Roughly speaking, the Old-Babilonians had not selected the Pythagorean triples among many possibilities, but rather took all the possible triples. What is revealed in this article is that the most intriguing aspect of the table (the angles of 45° and 30°) turn out to be a mere coincidence.

  12. Table of specific activities of selected isotopes

    International Nuclear Information System (INIS)

    Shipley, G.

    The bulk of this publication consists of a table of the half-lives, decay modes, and specific activities of isotopes selected for their particular interest to the Environmental Health and Safety Department, LBL. The specific activities were calculated with a PDP 9/15 computer. Also included in the report is a table of stable isotopes, the Th and U decay chains, a chart of the nuclides for elements 101 through 106, the heavy element region of the periodic table, and a specific activity monograph. 5 figures, 2 tables

  13. Fuzzy efficiency optimization of AC induction motors

    Science.gov (United States)

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  14. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    ) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...... impact are analysed with regard to their visual impact reducing design steps. These are used to form the basis for overhead line system design ideas, which are analysed with regard to application of composite materials and components. Composite materials and components, when applied in EHV systems...

  15. Calibration free method for measurement of the AC magnetization loss

    Energy Technology Data Exchange (ETDEWEB)

    Souc, Jan [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Goemoery, Fedor [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Vojenciak, Michal [Department of Power Electrical Systems, University of Zilina, Vel' ky diel, 010 26 Zilina (Slovakia)

    2005-05-01

    A calibration free measurement method for determination of the magnetization loss of superconducting samples exposed to the external AC magnetic field is presented. The idea is based on the measurement of the part of the power which is supplied by the AC source to the AC magnet generating the magnetic field, in which the sample is located. It uses a coil wound in parallel to the AC field magnet as the measurement coil. To achieve the necessary sensitivity, two identical systems are used, each consisting of an AC magnet and a measurement coil, one of them containing the sample and the other left empty. No measurement and/or calculation of the calibration constant is required. To confirm the suitability of this method, the loss of a Cu sample with known dissipation was measured. The applicability to the AC magnetization loss measurements of superconducting tapes is presented.

  16. Assessment and risk reduction of infectious pathogens on chiropractic treatment tables

    Directory of Open Access Journals (Sweden)

    Husbands Chris

    2007-06-01

    Full Text Available Abstract Background To investigate the presence of pathogenic microbes on chiropractic treatment tables in one outpatient teaching clinic. Additional aims were to test inexpensive disinfectants on tables that may kill microbes and suggest infection control measures for chiropractic offices, clinics and classrooms. The aim of the study was to assess the presence of pathogenic microbes on treatment tables in one outpatient teaching clinic and determine a simple behavioral model for infection control including table disinfection and accepted hand washing and sanitizing protocols. Methods 10 treatment tables were selected and sampled for possible microbial flora on face and hand pieces. Samples were cultured on MacConky's agar and mannitol salt agar, labeled and incubated for up to 48 hours. Confirmatory testing of microbes to determine if drug resistant flora were present was performed. Among tables tested, 5 were selected to test disinfectants. One-half of the face piece and 1 hand piece were treated with two different wipes and then post-tested for microbes. Results Pathogenic microbes were present on chiropractic treatment tables including methicillin-resistant Staph aureus. Simple disinfectants neutralized the pathogens. A rudimentary disinfection procedure and infection control measures are suggested based on the findings. Conclusion Pathogenic microbes may be present on chiropractic treatment tables and can be effectively killed with proper disinfecting. Hand washing/sanitizing is an important measure in infection control as is table disinfecting. Rudimentary behavioral changes to improve chiropractic clinic infection control are needed. More comprehensive behavioral models are needed. All teaching clinics and private chiropractic offices should adopt infection control practices including routine table disinfecting and hand sanitizing. Effective measures can be put in place at minimal costs. Accrediting bodies of chiropractic institutions

  17. Background subtraction theory and practice

    CERN Document Server

    Elgammal, Ahmed

    2014-01-01

    Background subtraction is a widely used concept for detection of moving objects in videos. In the last two decades there has been a lot of development in designing algorithms for background subtraction, as well as wide use of these algorithms in various important applications, such as visual surveillance, sports video analysis, motion capture, etc. Various statistical approaches have been proposed to model scene backgrounds. The concept of background subtraction also has been extended to detect objects from videos captured from moving cameras. This book reviews the concept and practice of back

  18. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  19. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  20. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  1. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  2. CREATING INPUT TABLES FROM WAPDEG FOR RIP

    International Nuclear Information System (INIS)

    K.G. Mon

    1998-01-01

    The purpose of this calculation is to create tables for input into RIP ver. 5.18 (Integrated Probabilistic Simulator for Environmental Systems) from WAPDEG ver. 3.06 (Waste Package Degradation) output. This calculation details the creation of the RIP input tables for TSPA-VA REV.00

  3. Johannes Kepler and the Rudolphine Tables

    Indian Academy of Sciences (India)

    Admin

    science in which planetary predictions typically erred by several degrees on the sky; the legacy of the Rudolphine Tables was a prediction scheme nearly 50 times more accurate. For Kepler these tables were the proof of the pudding, the substantiation of his laws of planetary motion. He called them “my chief astronomical ...

  4. 21 CFR 168.180 - Table sirup.

    Science.gov (United States)

    2010-04-01

    ... added for nutritional purposes and artificial sweeteners are not considered to be suitable ingredients... CONSUMPTION SWEETENERS AND TABLE SIRUPS Requirements for Specific Standardized Sweeteners and Table Sirups... percent soluble sweetener solids by weight and is prepared with or without added water. It may contain one...

  5. Online Periodic Table: A Cautionary Note

    Science.gov (United States)

    Izci, Kemal; Barrow, Lloyd H.; Thornhill, Erica

    2013-01-01

    The purpose of this study was (a) to evaluate ten online periodic table sources for their accuracy and (b) to compare the types of information and links provided to users. Limited studies have been reported on online periodic table (Diener and Moore 2011; Slocum and Moore in "J Chem Educ" 86(10):1167, 2009). Chemistry students'…

  6. Relating Functional Groups to the Periodic Table

    Science.gov (United States)

    Struyf, Jef

    2009-01-01

    An introduction to organic chemistry functional groups and their ionic variants is presented. Functional groups are ordered by the position of their specific (hetero) atom in the periodic table. Lewis structures are compared with their corresponding condensed formulas. (Contains 5 tables.)

  7. NNDSS - Table II. Mumps to Rabies, animal

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  8. Solar Cell Efficiency Tables (Version 51)

    Energy Technology Data Exchange (ETDEWEB)

    Levi, Dean H [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Green, Martin A. [University of New South Wales; Hishikawa, Yoshihiro [National Institute of Advanced Industrial Science and Technology (AIST); Dunlop, Ewan D. [European Commission-Joint Research Centre; Hohl-Ebinger, Jochen [Fraunhofer Institute for Solar Energy Systems; Ho-Baillie, Anita W. Y. [University of New South Wales

    2017-12-14

    Consolidated tables showing an extensive listing of the highest independently confirmed efficiencies for solar cells and modules are presented. Guidelines for inclusion of results into these tables are outlined and new entries since July 2017 are reviewed, together with progress over the last 25 years. Appendices are included documenting area definitions and also listing recognised test centres.

  9. Scenario-based table top simulations

    DEFF Research Database (Denmark)

    Broberg, Ole; Edwards, Kasper; Nielsen, J.

    2012-01-01

    This study developed and tested a scenario-based table top simulation method in a user-driven innovation setting. A team of researchers worked together with a user group of five medical staff members from the existing clinic. Table top simulations of a new clinic were carried out in a simple model...

  10. Hanford Site background: Part 1, Soil background for nonradioactive analytes

    International Nuclear Information System (INIS)

    1993-04-01

    The determination of soil background is one of the most important activities supporting environmental restoration and waste management on the Hanford Site. Background compositions serve as the basis for identifying soil contamination, and also as a baseline in risk assessment processes used to determine soil cleanup and treatment levels. These uses of soil background require an understanding of the extent to which analytes of concern occur naturally in the soils. This report documents the results of sampling and analysis activities designed to characterize the composition of soil background at the Hanford Site, and to evaluate the feasibility for use as Sitewide background. The compositions of naturally occurring soils in the vadose Zone have been-determined for-nonradioactive inorganic and organic analytes and related physical properties. These results confirm that a Sitewide approach to the characterization of soil background is technically sound and is a viable alternative to the determination and use of numerous local or area backgrounds that yield inconsistent definitions of contamination. Sitewide soil background consists of several types of data and is appropriate for use in identifying contamination in all soils in the vadose zone on the Hanford Site. The natural concentrations of nearly every inorganic analyte extend to levels that exceed calculated health-based cleanup limits. The levels of most inorganic analytes, however, are well below these health-based limits. The highest measured background concentrations occur in three volumetrically minor soil types, the most important of which are topsoils adjacent to the Columbia River that are rich in organic carbon. No organic analyte levels above detection were found in any of the soil samples

  11. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  12. The slow penetration of the Mendeleev Table in the French school curricula

    International Nuclear Information System (INIS)

    Vigouroux, C.H.

    2012-01-01

    The great influence of the Berthelot's ideas about the non existence of atoms froze the teaching of chemistry in France for quite a long time. It is only after the Second World War that the study of the atom structure appeared in school curricula. The Mendeleev periodic system that sets the relationship between chemical properties and atom structure entered the curriculum even later in 1978. The article shows that the authors of most school manuals had anticipated the change, for in 1966 all the chemistry manuals of the 6. form had a chapter dedicated to the Mendeleev table while the issue was not yet on the syllabus. (A.C.)

  13. Children of ethnic minority backgrounds

    DEFF Research Database (Denmark)

    Johansen, Stine Liv

    2010-01-01

    Children of ethnic minority background balance their everyday life between a cultural background rooted in their ethnic origin and a daily life in day care, schools and with peers that is founded in a majority culture. This means, among other things, that they often will have access to different ...

  14. Tilt table testing in patients with suspected epilepsy1

    DEFF Research Database (Denmark)

    Edfors, R.; Erdal, J.; Rogvi-Hansen, B.

    2008-01-01

    BACKGROUND: Approximately 20-30% of patients with epilepsy are misdiagnosed and syncope often seems to be the mistaken cause. We re-evaluated patients referred to an epilepsy clinic where suspicion of neurally mediated (reflex) syncope were raised using tilt table testing (HUT). METHODS: HUT...... laboratory results and medical records of 120 consecutive patients were reviewed retrospectively over a period of 27 months. RESULTS: HUT was positive in 59 (49%) patients. Seventeen of 38 (45%) patients previously diagnosed with epilepsy and taking antiepileptic drugs were found to be misdiagnosed. Four...

  15. Tilt table testing in patients with suspected epilepsy1

    DEFF Research Database (Denmark)

    Edfors, R.; Erdal, J.; Rogvi-Hansen, B.

    2008-01-01

    BACKGROUND: Approximately 20-30% of patients with epilepsy are misdiagnosed and syncope often seems to be the mistaken cause. We re-evaluated patients referred to an epilepsy clinic where suspicion of neurally mediated (reflex) syncope were raised using tilt table testing (HUT). METHODS: HUT...... of 21 patients with epilepsy (19%) had dual diagnoses of reflex syncope and epilepsy. CONCLUSION: HUT is an informative investigation when suspicions of reflex syncope are raised in patients referred to an epilepsy clinic. Reflex syncope is an important and common differential diagnosis of epilepsy...

  16. Interferometric characterization of joint optical tables

    Science.gov (United States)

    Corzo-Garcia, S. C.; Medina-Lopez, R. J.; Anderson, S.; Carriles, R.; Ruiz-Marquez, A.; Castro-Camus, E.

    2011-08-01

    We present a straight forward and practical method for joining pneumatically floated optical tables with no previous preparation. In order to demonstrate this method we joined two optical tables in an uncentered "T-shape" using twenty four stainless steel plates (SSP), and used a Michelson interferometer to compare the stability of the entire "T"-structure versus one of its parts alone, finding that they both show similar rigidity. We also evaluated the performance of two different master-salve leg configurations by calculating the stress on the joint and confirmed the calculations by Michelson interferometry. In terms of floor vibration damping, it was observed that the performance of the system for the joined "T"-table seemed to be comparable to that of a single segment. This method can significantly reduce costs of large optical tables and will be useful to extend existing optical tables without manufacturer modification.

  17. Cosmic Shear With ACS Pure Parallels. Targeted Portion.

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan i {F775W} we will measure for the first time: the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  18. INTRODUCTION Outline of Round Tables Outline of Round Tables

    Science.gov (United States)

    Abarzhi, Snezhana I.; Sreenivasan, Katepalli R.

    2010-12-01

    The Second International Conference and Advanced School 'Turbulent Mixing and Beyond', TMB-2009, was held at the Abdus Salam International Centre for Theoretical Physics, (ICTP), Trieste, Italy on 27 July-7 August 2009. TMB-2009 united over 180 participants ranging from students to members of the National Academies of Sciences and Engineering, and including researchers at experienced and early stages of their carriers from leading scientific institutions in academia, national laboratories, corporations and industry worldwide. Responding to the community's inquiry and reaffirming the practices established at TMB-2007, two Round Tables were organized for the participants of TMB-2009 on 30 July 2009 and 6 August 2009 in the Oppenheimer Room at the Centre. The goals of the Round Tables were to encourage the information exchange among the members of the interdisciplinary and international TMB community, promote discussions regarding the state-of-the-art in TMB-related scientific areas, identify directions for frontier research, and articulate recommendations for future developments. This article is a summary of the collective work of the Round Table participants (listed alphabetically below by their last names), whose contributions form its substance and, as such, are greatly appreciated. Abarzhi, Snezhana I (University of Chicago, USA) Andrews, Malcolm (Los Alamos National Laboratory, USA) Belotserkovskii, Oleg (Institute for Computer Aided Design of the Russian Academy of Sciences, Russia) Bershadskii, Alexander (ICAR, Israel) Brandenburg, Axel (Nordita, Denmark) Chumakov, Sergei (Stanford University, USA) Desai, Tara (University of Milano-Bicocca, Italy) Galperin, Boris (University of South Florida, USA) Gauthier, Serge (Commissariat à l'Energie Atomique, France) Gekelman, Walter (University of California at Los Angeles, USA) Gibson, Carl (University of California at San Diego, USA) Goddard III, William A (California Institute of Technology, USA) Grinstein, Fernando

  19. Des tables pascales aux tables astronomiques et retour.

    Directory of Open Access Journals (Sweden)

    Max Lejbowicz

    2006-05-01

    Full Text Available L’article étudie la naissance et le développement du calendrier ecclésiastique chrétien, i. e. le comput, depuis les premiers témoignages de la célébration annuelle de la résurrection de Jésus jusqu’aux traductions des tables astronomiques arabes au xiie siècle. Il privilégie les procédures qui aboutissent à la détermination des dates pascales et à leur mise en forme tabulaire. Les analyses sont conduites à partir d’un double point de vue. L’un est scientifique. Il s’appuie sur les données astronomiques retenues par Ptolémée et sur l’apport de la tradition mathématique grecque au calcul par approximations. Les cycles soli-lunaires sont posés à partir des fractions continues et le cycle soli-hebdomadaire à partir du plus petit commun multiple. Le second point de vue est social : l’unification du comput participe à celle de la chrétienté comprise comme une configuration politico-religieuse. Deux conclusions s’imposent. Quelle que soit l’importance que la civilisation médiévale a attribuée au comput, il reste que : 1 / les Pâques sont porteuses de significations irréductibles aux techniques chronométriques qui inscrivent cette fête dans le déroulement de l’année ; 2 / ces techniques ont toutefois marqué profondément les curiosités intellectuelles des Latins et les ont préparé à accueillir avec ferveur les zīj et la numération de position.The article studies the birth and development of the Christian ecclesiastical calendar, i.e. the computus, from the first witnesses to the yearly celebration of the resurrection of Jesus to the translations of arabic astronomical tables in the 12th century. It focuses on the procedures which resulted in determinig the dates of Easter and their being put into tabular form. These analyses were undertaken from two perspectives. One was scientific, relying on the astronomical data preserved by Ptolemy and on the contribution of the Greek mathematical

  20. Radiation on the dining table

    International Nuclear Information System (INIS)

    Rossi, Laura; Watson, Dana; Escandarani, Soledad; Miranda, Andrea; Troncoso, Alcides

    2009-01-01

    Zero tolerance to bacterial contamination means considering the acceptance of 'radiation on the table'. The process of food irradiation has been extensively studied, nevertheless its use remains a matter of some controversy. Despite unanimous agreement within the medical community of the safety of this procedure, occasional concerns arise from the consumers. A common consumer misconception is that irradiation may turn the food 'radioactive'. A significant number of scientific studies on the topic were analyzed. We found no scientific study demonstrating that consumption of irradiated food might pose a risk to consumers. All studies conclude that food irradiation at the appropriate dose required to reduce contamination is safe and does not affect its nutritional value. In order to emphasize the issue we discuss the potential benefit vs harm of irradiation of food contaminated with E. coli 0157: H7. The association of this bacteria with severe disease and death has been clearly established in contrast with the lack of a demonstrated risk due to meat irradiation. We conclude that the risks of food irradiation remains 'unknown' simply because, after four decades of research, none has been identified. In contrast to the risks of acquiring a food transmitted bacterial disease, the risk of irradiation is negligible

  1. Isomers chart; Table des isomeres

    Energy Technology Data Exchange (ETDEWEB)

    Dupont-Gautier, P.; Chantelot, S.; Moisson, N. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-07-01

    The nuclear isomers are nuclides offering the same mass number and the same atomic number, but different energy levels. In the following chart the zero energy ground states are omitted and the metastable isomers, i.e. of non-zero energy, known and of measurable lifetime, are listed. The lower limit of this lifetime was set here to 0.1 x 10{sup -6} s. The various isomers were classified in increasing lifetimes. (authors) [French] Les isomeres nucleaires sont des nucleides presentant le meme nombre de masse et le meme numero atomique, mais des niveaux energetiques differents. Dans la table suivante, on a neglige les etats fondamentaux d'energie nulle et on a recense les isomeres metastables, c'est-a-dire d'energie non nulle, connus et de periode mesurable. La limite inferieure de cette periode a ete fixee ici a 0,1 x 10{sup -6} s. Les differents isomeres ont ete classes par periodes croissantes. (auteurs)

  2. Aluminum as a source of background in low background experiments

    Energy Technology Data Exchange (ETDEWEB)

    Majorovits, B., E-mail: bela@mppmu.mpg.de [MPI fuer Physik, Foehringer Ring 6, 80805 Munich (Germany); Abt, I. [MPI fuer Physik, Foehringer Ring 6, 80805 Munich (Germany); Laubenstein, M. [Laboratori Nazionali del Gran Sasso, INFN, S.S.17/bis, km 18 plus 910, I-67100 Assergi (Italy); Volynets, O. [MPI fuer Physik, Foehringer Ring 6, 80805 Munich (Germany)

    2011-08-11

    Neutrinoless double beta decay would be a key to understanding the nature of neutrino masses. The next generation of High Purity Germanium experiments will have to be operated with a background rate of better than 10{sup -5} counts/(kg y keV) in the region of interest around the Q-value of the decay. Therefore, so far irrelevant sources of background have to be considered. The metalization of the surface of germanium detectors is in general done with aluminum. The background from the decays of {sup 22}Na, {sup 26}Al, {sup 226}Ra and {sup 228}Th introduced by this metalization is discussed. It is shown that only a special selection of aluminum can keep these background contributions acceptable.

  3. Thermodynamic properties of mineral compounds (tables); Proprietes thermodynamiques des composes mineraux (tables)

    Energy Technology Data Exchange (ETDEWEB)

    Perrot, P. [Lille-1 Univ., Lab. de Metallurgie Physique, UMR CNRS 8517, 59 - Villeneuve-d' Ascq (France)

    2005-10-01

    This article presents, in the form of tables, the thermodynamic data necessary for the calculation of equilibrium constants of reactions between mineral compounds (Rb, Re, Ru, S, Sb, Sc, Se, Si, Sm, Sn, Sr, Ta, Tb, Tc, Te, Th, Ti, Tl, Tm, U, V, W, Xe, Y, Yb, Zn, and Zr compounds). Table 1 presents the data recommended by Codata; table 2 gives the minimum informations allowing the calculation of an equilibrium constant in first approximation; table 3 allows to take into consideration the thermal capacities. Finally, table 4 gathers the data relative to species in aqueous solution. (J.S.)

  4. Some Reflections on the Periodic Table and Its Use.

    Science.gov (United States)

    Fernelius, W. Conard

    1986-01-01

    Discusses early periodic tables; effect on the periodic table of atomic numbers; the periodic table in relation to electron distribution in the atoms of elements; terms and concepts related to the table; and the modern basis of the periodic table. Additional comments about these and other topics are included. (JN)

  5. Position of actinide elements in the periodic table : evolution of a generalised form (Preprint no. SSC-33)

    International Nuclear Information System (INIS)

    Nathaniel, T.N.

    1991-01-01

    All the actinides and lanthanides are placed in III group and are shown separately, in the most popular forms of the periodic table, including the latest version of IUPAC. This has been leading to an avoidable debate i.e. whether to place La and Ac or Lu and Lw below Sc and Y in the III-B group. Apart from this, the group characteristic nature of most of the actinides elements, demands that a more appropriate position is to be given to these f block elements. The situation is more complex in the higher periods, in which new elements belonging to g block, h block, ... are to be included. Also, there seems to be no consensus in following a uniform and acceptable subgroup notation. The author arrived at a new form of the periodic table to successfully sort out all these issues. The table is presented. (author). 10 refs., 1 fig

  6. The Cosmic Infrared Background Experiment

    OpenAIRE

    Bock, James; Battle, John; Cooray, Asantha; Kawada, Mitsunobu; Keating, Brian; Lange, Andrew; Lee, Dae-Hea; Matsumoto, Toshio; Matsuura, Shuji; Pak, Soojong; Renbarger, Tom; Sullivan, Ian; Tsumura, Kohji; Wada, Takehiko; Watabe, Toyoki

    2005-01-01

    We are developing a rocket-borne instrument (the Cosmic Infrared Background ExpeRiment, or CIBER) to search for signatures of primordial galaxy formation in the cosmic near-infrared extra-galactic background. CIBER consists of a wide-field two-color camera, a low-resolution absolute spectrometer, and a high-resolution narrow-band imaging spectrometer. The cameras will search for spatial fluctuations in the background on angular scales from 7 arcseconds to 2 degrees over a range of angular sca...

  7. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  8. Muc5ac mucin expression during rat skin development

    Directory of Open Access Journals (Sweden)

    V. Ferretti

    2015-02-01

    Full Text Available Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC, Western blotting (WB and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days after birth when the surface epidermis became negative and the reaction was restricted to secreting sebum cells. In coincidence with IHC findings, WB analysis showed a band at approximately 200KDa at the same periods of development. Results were also confirmed by RT-PCR. Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.Conclusion:  Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development. 

  9. Muc5ac mucin expression during rat skin development.

    Science.gov (United States)

    Ferretti, V; Segal-Eiras, Á; Barbeito, C G; Croce, M V

    2015-02-20

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days after birth when the surface epidermis became negative and the reaction was restricted to secreting sebum cells. In coincidence with IHC findings, WB analysis showed a band at approximately 200KDa at the same periods of development. Results were also confirmed by RT-PCR. Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.   Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.

  10. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  11. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  12. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  13. AC Electrowetting of Polymer Aqueous Drops on Parallel Electrodes

    Science.gov (United States)

    Zhang, Lu; Chetwani, Nishant; Chang, Hsueh-Chia; Zhu, Yingxi Elaine

    2009-03-01

    We have recently observed the strong field dependence of AC-electrowetting of simple electrolyte aqueous drops on parallel gold electrodes, yet the detailed dynamic process of AC-field induced surface wetting remains unclear. In this work, we use fluorescence labeled DNA aqueous solution as a model system to directly visualize the wetting process of aqueous drops under varied AC electric fields by using combined fluorescence microscopy and contact angle goniometer. The electrowetting behavior of DNA aqueous drops is observed at AC-field frequency greater than the reciprocal of the RC time scale for electrode screening. And the onset of AC electrowetting is accompanied by the observed oscillation in drop contour shape and contact line. In addition, the ejection of nanodrops from the parent aqueous drop is observed when the threshold AC-field amplitude is exceeded. A scaling theory based on electrode interfacial screening is developed to quantify the AC-electrowetting behavior with the dependence of AC-field frequency, strength and medium conductivity.

  14. Low frequency ac conduction and dielectric relaxation in poly (N ...

    Indian Academy of Sciences (India)

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

  15. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    possesses an interesting dualism: the periodic ac fields that are least effective in suppress- ing conductance fluctuations by dephasing, turn out to be the most effective in breaking the time-reversal symmetry. An important exception is the periodic ac field that is anti- symmetric with respect to a shift by a half-period τ/2.

  16. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

  17. Ac and dc motor flooding times

    International Nuclear Information System (INIS)

    Crowley, D.A.; Hinton, J.H.

    1988-01-01

    Reactor safety studies, such as the emergency cooling system (ECS) limits analyses and the probabilistic risk assessment, require that the flood-out times be calculated for the ac and dc motors at the -40 foot level. New calculations are needed because dams of an improved design have been installed between the pump room and motor room, and because updated leak rate calculations have shown that the maximum possible leak rate is larger than that which had been previously calculated. The methodology for calculating the motor flood-out times has also been improved. A computer program has been written to calculate flood-out times for various leak rates and sump pump operabilities. For ECS limits analyses, the worst case dc motor flood-out times are 161 and 297 seconds in LKC and P-areas, respectively. These times are for a 135,468 gpm leak that first flows to the motor room and all of the sump pumps are off

  18. Improving Power Quality in AC Supply Grids

    Directory of Open Access Journals (Sweden)

    Piotr Fabijański

    2015-12-01

    Full Text Available This paper describes a digital and actual model of the UPQC (Unified Power Quality Conditioner integrated system for power quality improvement. The UPQC’s design and its connection to an AC supply grid, 1-phase and 3-phase alike, provide effective compensation of unwanted interferences in the waveforms of load supply voltages and non-linear load currents. This article presents an overview of topologies and control strategies. The study of the UPQC confirmed its positive impact on the power quality. The electricity parameters were significantly improved. Total harmonic distortion in supply voltage THDu decreased six-fold to 1.89%, and total harmonic distortion in load current THDi decreased more than ten-fold to 2.38% for a non-linear load (uncontrolled bridge rectifier with load L. Additionally, symmetrisation of supply voltages and reactive power compensation Q of linear load was obtained. The UPQC integrated system for power quality improvement can be used wherever high-quality and PN-EN 50160 standard – compliant electricity is required.

  19. Berkeley Low Background Counting Facility

    Data.gov (United States)

    Federal Laboratory Consortium — Sensitive low background assay detectors and sample analysis are available for non-destructive direct gamma-ray assay of samples. Neutron activation analysis is also...

  20. Botanical Dietary Supplements: Background Information

    Science.gov (United States)

    ... Office of Dietary Supplements Health Professional Other Resources Botanical Dietary Supplements Background Information Have a question? Ask ... on botanical dietary supplements? Disclaimer What is a botanical? A botanical is a plant or plant part ...

  1. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  2. Cosmic microwave background, where next?

    CERN Multimedia

    CERN. Geneva

    2009-01-01

    Ground-based, balloon-borne and space-based experiments will observe the Cosmic Microwave Background in greater details to address open questions about the origin and the evolution of the Universe. In particular, detailed observations the polarization pattern of the Cosmic Microwave Background radiation have the potential to directly probe physics at the GUT scale and illuminate aspects of the physics of the very early Universe.

  3. Estimating COCOM Natural Background Dormancy

    Science.gov (United States)

    2015-04-01

    ER D C/ CR RE L TR -1 5- 7 Phase IV Army Camouflage Development Effort Estimating COCOM Natural Background Dormancy Co ld R eg io ns...ERDC/CRREL TR-15-7 April 2015 Estimating COCOM Natural Background Dormancy Alexis L. Coplin and Charles C. Ryerson Cold Regions Research and...phenological stage, controls color and tex- ture of natural vegetation as it cycles through greenup, verdancy, senes- cence, and dormancy . For the Army

  4. Comparison of the Accuracy and Speed of Transient Mobile A/C System Simulation Models: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Kiss, T.; Lustbader, J.

    2014-03-01

    The operation of air conditioning (A/C) systems is a significant contributor to the total amount of fuel used by light- and heavy-duty vehicles. Therefore, continued improvement of the efficiency of these mobile A/C systems is important. Numerical simulation has been used to reduce the system development time and to improve the electronic controls, but numerical models that include highly detailed physics run slower than desired for carrying out vehicle-focused drive cycle-based system optimization. Therefore, faster models are needed even if some accuracy is sacrificed. In this study, a validated model with highly detailed physics, the 'Fully-Detailed' model, and two models with different levels of simplification, the 'Quasi-Transient' and the 'Mapped- Component' models, are compared. The Quasi-Transient model applies some simplifications compared to the Fully-Detailed model to allow faster model execution speeds. The Mapped-Component model is similar to the Quasi-Transient model except instead of detailed flow and heat transfer calculations in the heat exchangers, it uses lookup tables created with the Quasi-Transient model. All three models are set up to represent the same physical A/C system and the same electronic controls. Speed and results of the three model versions are compared for steady state and transient operation. Steady state simulated data are also compared to measured data. The results show that the Quasi-Transient and Mapped-Component models ran much faster than the Fully-Detailed model, on the order of 10- and 100-fold, respectively. They also adequately approach the results of the Fully-Detailed model for steady-state operation, and for drive cycle-based efficiency predictions

  5. The 2005 CHF look-up table

    International Nuclear Information System (INIS)

    Groeneveld, D.C.; Vasic, A.Z.; Leung, L.K.H.; Durmayaz, A.; Shan, J.Q.; Yang, J.; Cheng, S.C.

    2005-01-01

    Full text of publication follows: CHF Look-up tables have been used widely for the prediction of the Critical Heat Flux (CHF) The CHF look-up table is basically a normalized data bank. The first CHF look-up table was constructed by Doroshchuk et al. (1975), using a limited database of 5 000 data points. This table, and all subsequent tables, contain normalized CHF values for a vertical 8 mm water-cooled tube for various pressures, mass fluxes and qualities. The CHF table development work has since been in progress at various institutions (e.g. CENG-Grenoble, University of Ottawa (UO), Ottawa, IPPE, Obninsk, and AECL, Chalk River) using an ever increasing data base. The 1995 CHF look-up table employs a data base containing about 30 000 CHF points and provides CHF values for an 8 mm ID, water-cooled tube, for 19 pressures, 20 mass fluxes, and 23 qualities. covering the full range of conditions of practical interest. The 2005 CHF LUT is an update to the 1995 LUT and addresses several concerns raised in the literature. The major improvements made are: - enhancement of the quality of the data base of the CHF look-up table (identify outliers, improve screening procedures); - increase in the data base by adding recently obtained data; - employment of greater subdivision of the look-up table by using smaller intervals in the independent parameters (pressure, mass flux and quality) at conditions where the variation in CHF is significant; - improvement of the smoothness of the CHF look-up table. This was done by the use of logarithmic functions for CHF, using optimum Spline functions etc. A discussion of the impact of these changes on the prediction accuracy and table smoothness is presented. It will be shown that the 2005 CHF look-up table is characterized by a significant improvement in accuracy and smoothness. [1] D. Groeneveld is the corresponding author. He is an Adjunct Professor at the University of Ottawa. (authors)

  6. General-purpose radiographic and fluoroscopic table

    International Nuclear Information System (INIS)

    Ishizaki, Noritaka

    1982-01-01

    A new series of diagnostic tables, Model DT-KEL, was developed for general-purpose radiographic and fluoroscopic systems. Through several investigations, the table was so constructed that the basic techniques be general radiography and GI examination, and other techniques be optionally added. The diagnostic tables involve the full series of the type for various purposes and are systematized with the surrounding equipment. A retractable mechanism of grids was adopted first for general use. The fine grids with a density of 57 lines per cm, which was adopted in KEL-2, reduced the X-ray doses by 16 percent. (author)

  7. X-ray table with general positioning

    International Nuclear Information System (INIS)

    Slaby, J.

    1987-01-01

    The X-ray table is designed revolving around the transverse and longitudinal axes of the patient. The X-ray source and the imaging system revolve around the longitudinal axis of the patient and are slidable around the table. They are fitted on an arch shaped into the letter C, which is pivoted on the holder of the imaging system. The table may be used for the most general examination techniques, mainly of the alimentary tract, soft tissues, in angiography, neurology and for isocentric dynamic examinations. (M.D.). l fig

  8. The use of low frequency AC for offshore wind power

    Energy Technology Data Exchange (ETDEWEB)

    Schuette, T.; Stroem, M.; Gustavsson, Bo [Balfour Beatty Rail AB, Vaesteraas (Sweden)

    2001-07-01

    Low frequency AC, that means AC with a frequency well below the usual frequencies 50 or 60 Hz, has today its main use in single phase AC electrified railways in a number of European countries (16 2/3 Hz), USA (25 Hz) and Costa Rica (20 Hz). Offshore wind power is well suited to 'join the club' as low frequency AC has a number of advantages for that use: Low frequency AC better fits the low revolution frequency of wind power rotors. This can either be used for reduction of pole number for direct generation machines or for a reduction of the gear ratio for conventional machines, resulting in simpler, lighter and more reliable gearboxes. Low frequency AC gives rise to lower charging current/reactive power production, which restricts the maximum cable length for 50 - 60 Hz heavily due to the high specific capacitance of power cables. For low frequency AC, cables longer than 100 km are possible, which is necessary for many future offshore wind power sites. Low frequency AC enables for the use of (air insulated) transmission lines at loads well above their characteristic power, often up to their thermal maximum load. This means that weak 50 or 60 Hz lines between the shore and consumers or stronger parts of a national grid can transfer more power when operated with low frequency AC. On all aspects of low frequency AC, profound knowledge has been accumulated the last century in the railway sector and can be made available for wind power.

  9. Gastric perforation in neonates is ac

    African Journals Online (AJOL)

    hi-tech

    2004-01-01

    Jan 1, 2004 ... Background: Gastric perforation in neonates is a catastrophe associated with high morbidity. Most are due to underlying primary pathology. Objectives: To review the management of gastric perforation in neonates in Kwa Zulu. -Natal, South Africa. Design: Retrospective study of consecutive complete data ...

  10. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  11. ACS6, a Hydrogen sulfide-donating derivative of sildenafil, inhibits homocysteine-induced apoptosis by preservation of mitochondrial function

    Directory of Open Access Journals (Sweden)

    Tang Xiao-Qing

    2011-08-01

    Full Text Available Abstract Background The hydrogen sulfide-releasing sildenafil, ACS6, has been demonstrated to inhibit superoxide formation through donating hydrogen sulfide (H2S. We have found that H2S antagonizes homocysteine-induced oxidative stress and neurotoxicity. The aim of the present study is to explore the protection of ACS6 against homocysteine-triggered cytotoxicity and apoptosis and the molecular mechanisms underlying in PC12 cells. Methods Cell viability was determined by Cell Counting Kit-8 assay. Cell apoptosis was observed using the chromatin dye Hoechst 33258 and analyzed by Flow Cytometry after propidium iodide staining. Mitochondrial membrane potential was monitored using the fluorescent dye Rh123. Intracellular reactive oxygen species were determined by oxidative conversion of cell permeable 2',7'-dichlorfluorescein-diacetate to fluorescent 2',7'-dichlorfluorescein. The expression of cleaved caspase-3 and bcl-2 and the accumulation of cytosolic cytochrome c were analyzed by Western blot. Results We show that ACS6 protects PC12 cells against cytotoxicity and apoptosis induced by homocysteine and blocks homocysteine-triggered cytochrome c release and caspase-3 activation. ACS6 treatment results in not only prevention of homocysteine-caused mitochondrial membrane potential (Δψ loss and reactive oxygen species (ROS overproduction but also reversal of Bcl-2 down-expression. Conclusions These results indicate that ACS6 protects PC12 cells against homocysteine-induced cytotoxicity and apoptosis by preservation of mitochondrial function though inhibiting both loss of Δψ and accumulation of ROS as well as modulating the expression of Bcl-2. Our study provides evidence both for a neuroprotective effect of ACS6 and for further evaluation of ACS6 as novel neuroprotectants for Alzheimer's disease associated with homocysteine.

  12. Medicaid Analytic eXtract (MAX) Rx Table Listing

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Statistical Compendium table listing (below) enables users to choose to view Medicaid prescription drug tables for 1999 - 2009, and to select the tables for the...

  13. Life table estimates of adult HIV/AIDS mortality in Addis Ababa ...

    African Journals Online (AJOL)

    Background: With the expansion of antiretroviral treatment in the country, HIV prevalence figures alone, are expected to become insufficient for monitoring the HIV/AIDS epidemic. Objective: To develop life table method for estimating AIDS mortality based on surveillance of deaths at burial sites in Addis Ababa. Methods: An ...

  14. The Periodic Table as a Mnemonic Device for Writing Electronic Configurations.

    Science.gov (United States)

    Mabrouk, Suzanne T.

    2003-01-01

    Presents an interactive method for using the periodic table as an effective mnemonic for writing electronic configurations. Discusses the intrinsic relevance of configurations to chemistry by building upon past analogies. Addresses pertinent background information, describes the hands-on method, and demonstrates its use. Transforms the traditional…

  15. AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

    International Nuclear Information System (INIS)

    McCarthy, Christina B.; Theilmann, David A.

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

  16. Energetics of Table Tennis and Table Tennis-Specific Exercise Testing.

    Science.gov (United States)

    Zagatto, Alessandro Moura; Leite, Jorge Vieira de Mello; Papoti, Marcelo; Beneke, Ralph

    2016-11-01

    To test the hypotheses that the metabolic profile of table tennis is dominantly aerobic, anaerobic energy is related to the accumulated duration and intensity of rallies, and activity and metabolic profile are interrelated with the individual fitness profile determined via table tennis-specific tests. Eleven male experienced table tennis players (22 ± 3 y, 77.6 ± 18.9 kg, 177.1 ± 8.1 cm) underwent 2 simulated table tennis matches to analyze aerobic (W OXID ) energy, anaerobic glycolytic (W BLC ) energy, and phosphocreatine breakdown (W PCr ); a table tennis-specific graded exercise test to measure ventilatory threshold and peak oxygen uptake; and an exhaustive supramaximal table tennis effort to determine maximal accumulated deficit of oxygen. W OXID , W BLC , and W PCr corresponded to 96.5% ± 1.7%, 1.0% ± 0.7%, and 2.5% ± 1.4%, respectively. W OXID was interrelated with rally duration (r = .81) and number of shots per rally (r = .77), whereas match intensity was correlated with WPCr (r = .62) and maximal accumulated oxygen deficit (r = .58). The metabolic profile of table tennis is predominantly aerobic and interrelated with the individual fitness profile determined via table tennis-specific tests. Table tennis-specific ventilatory threshold determines the average oxygen uptake and overall W OXID , whereas table tennis-specific maximal accumulated oxygen deficit indicates the ability to use and sustain slightly higher blood lactate concentration and W BLC during the match.

  17. Description of background data in the SKB database GEOTAB. Version 2

    International Nuclear Information System (INIS)

    Eriksson, E.; Sehlstedt, S.

    1991-03-01

    During the research and development program performed by SKB for the final disposal of spent nuclear fuel, a large quantity of geoscientific data was collected. Most of this data was stored in a database called Geotab. The data is organized into eight groups as follows: Background information; Geological data; Borehole geophysical measurements; Ground surface geophysical measurements; Hydrogeological and meteorological data; Hydrochemical data; Petrophysical measurements and Tracer tests. Except for the case of borehole geophysical data, ground surface geophysical data and petrophysical data, described in the same report, the data in each group is described in a separate SKB report. The present report describes data within the Background data group. This data provides information on the location of areas studied, borehole positions and also some drilling information. Data is normally collected on forms or as notes and this is then stored into the database. The background data group, called BACKGROUND, is divided into several subgroups: BGAREA area background data; BGDRILL drilling information; BGDRILLP drill penetration data; BGHOLE borehole information; BGTABLES number of rows in a table and BGTOLR data table tolerance. A method consist of one or several data tables. In each chapter a method and its data tables are described. (authors)

  18. Extreme charge-trapping by pixels in Hubble's ACS/WFC detectors

    Science.gov (United States)

    Ryon, Jenna E.; Grogin, Norman A.; ACS Team

    2017-06-01

    We investigate the properties of sink pixels in the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detector. These pixels likely contain extra charge traps and therefore appear anomalously low in images with relatively high backgrounds. We identify sink pixels in the average short (0.5-second) dark image from each monthly anneal cycle, which, since January 2015, have been post-flashed to a background of about 60 e-. Sink pixels can affect the pixels immediately above and below them in the same column, resulting in high downstream pixels and low trails of upstream pixels. We determine typical trail lengths for sink pixels of different depths at various background levels. We create a reference image, one for each anneal cycle since January 2015, that will be used by CALACS to flag sink pixels and the adjacent affected pixels in science images.

  19. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the grids......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...

  20. Global patterns of groundwater table depth.

    Science.gov (United States)

    Fan, Y; Li, H; Miguez-Macho, G

    2013-02-22

    Shallow groundwater affects terrestrial ecosystems by sustaining river base-flow and root-zone soil water in the absence of rain, but little is known about the global patterns of water table depth and where it provides vital support for land ecosystems. We present global observations of water table depth compiled from government archives and literature, and fill in data gaps and infer patterns and processes using a groundwater model forced by modern climate, terrain, and sea level. Patterns in water table depth explain patterns in wetlands at the global scale and vegetation gradients at regional and local scales. Overall, shallow groundwater influences 22 to 32% of global land area, including ~15% as groundwater-fed surface water features and 7 to 17% with the water table or its capillary fringe within plant rooting depths.

  1. Toward an Organic Chemist's Periodic Table.

    Science.gov (United States)

    Hall, H. K., Jr.

    1980-01-01

    An analogy between electron transfer reactions of the elements and those of organic molecules is offered. Examples of organic electron transfer reactions are presented. The rationale of constructing an organic chemists' periodic table is also discussed. (HM)

  2. Theodore William Richards and the Periodic Table

    Science.gov (United States)

    Conant, James B.

    1970-01-01

    Discusses the contribution of Theodore Richards to the accurate determination of atomic weights of copper and other elements; his major contribution was to the building of the definitive periodic table of the elements. (BR)

  3. Ecological periodic tables: In principle and practice

    Science.gov (United States)

    The chemical periodic table, the Linnaean system of classification and the Hertzsprung-Russell diagram are iconic information organizing structure in chemistry, biology and astronomy, respectively, because they are simple, exceptionally useful and they foster the expansion of sci...

  4. Boat And Shore Oracle Data Tables

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Oracle Tables To Provide Boat and Shore Data which contains the object of this system is to provide an inventory of vessels that answer two fundamental questions:...

  5. Authenticated hash tables

    DEFF Research Database (Denmark)

    Triandopoulos, Nikolaos; Papamanthou, Charalampos; Tamassia, Roberto

    2008-01-01

    Hash tables are fundamental data structures that optimally answer membership queries. Suppose a client stores n elements in a hash table that is outsourced at a remote server so that the client can save space or achieve load balancing. Authenticating the hash table functionality, i.e., verifying...... the correctness of queries answered by the server and ensuring the integrity of the stored data, is crucial because the server, lying outside the administrative control of the client, can be malicious. We design efficient and secure protocols for optimally authenticating membership queries on hash tables: for any...... fixed constants 0 1/ε, the server can provide a proof of integrity of the answer to a (non-)membership query in constant time, requiring O(nε/logκε--1 n) time to treat updates, yet keeping the communication and verification costs constant. This is the first construction...

  6. The astronomical tables of Giovanni Bianchini

    CERN Document Server

    Chabas, Jose

    2009-01-01

    This book describes and analyses, for the first time, the astronomical tables of Giovanni Bianchini of Ferrara (d. after 1469), explains their context, inserts them into an astronomical tradition that began in Toledo, and addresses their diffusion.

  7. Background and Source Term Identification in Active Neutron Interrogation Methods

    Science.gov (United States)

    2011-03-24

    background source terms during active neutron interrogation. Oxide Percent SiO2 60.6 Al2O3 15.9 CaO 6.4 MgO 4.7 Na2O 3.1 Fe 6.7 K2O 1.8 TiO2 0.7... P2O5 0.1 Table 5. Chemical Properties of Continental Crust Provides the average amount of each element present in the earth’s crust for

  8. Online Periodic Table: A Cautionary Note

    Science.gov (United States)

    Izci, Kemal; Barrow, Lloyd H.; Thornhill, Erica

    2013-08-01

    The purpose of this study was (a) to evaluate ten online periodic table sources for their accuracy and (b) to compare the types of information and links provided to users. Limited studies have been reported on online periodic table (Diener and Moore 2011; Slocum and Moore in J Chem Educ 86(10):1167, 2009). Chemistry students' understanding of periodic table is vital for their success in chemistry, and the online periodic table has the potential to advance learners' understanding of chemical elements and fundamental chemistry concepts (Brito et al. in J Res Sci Teach 42(1):84-111, 2005). The ten sites were compared for accuracy of data with the Handbook of Chemistry and Physics (HCP, Haynes in CRC handbook of chemistry and physics: a ready-reference book of chemical and physical data. CRC Press, Boca Raton 2012). The 10 sites are the most visited periodic table Web sites available. Four different elements, carbon, gold, argon, and plutonium, were selected for comparison, and 11 different attributes for each element were identified for evaluating accuracy. A wide variation of accuracy was found among the 10 periodic table sources. Chemicool was the most accurate information provider with 66.67 % accuracy when compared to the HCP. The 22 types of information including meaning of name and use in industry and society provided by these sites were, also, compared. WebElements, "Chemicool", "Periodic Table Live", and "the Photographic Periodic Table of the Elements" were the most information providers, providing 86.36 % of information among the 10 Web sites. "WebElements" provides the most links among the 10 Web sites. It was concluded that if an individual teacher or student desires only raw physical data from element, the Internet might not be the best choice.

  9. Shaking table testing of mechanical components

    International Nuclear Information System (INIS)

    Jurukovski, D.; Taskov, Lj.; Mamucevski, D.; Petrovski, D.

    1995-01-01

    Presented is the experience of the Institute of Earthquake Engineering and Engineering Seismology, Skopje, Republic of Macedonia in seismic qualification of mechanical components by shaking table testing. Technical data and characteristics for the three shaking tables available at the Institute are given. Also, for characteristic mechanical components tested at the Institute laboratories, basic data such as producer, testing investor, description of the component, testing regulation, testing equipment and final user of the results. (author)

  10. Listing of Available ACE Data Tables

    Energy Technology Data Exchange (ETDEWEB)

    Conlin, Jeremy Lloyd [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-31

    This document is divided into multiple sections. Section 2 lists some of the more frequently used ENDF/B reaction types that can be used with the FM input card. The remaining sections (described below) contain tables showing the available ACE data tables for various types of data. These ACE data libraries are distributed by the Radiation Safety Information Computational Center (RSICC) with MCNP6.

  11. IUPAC Periodic Table of the Isotopes

    Science.gov (United States)

    Holden, N.E.; Coplen, T.B.; Böhlke, J.K.; Wieser, M.E.; Singleton, G.; Walczyk, T.; Yoneda, S.; Mahaffy, P.G.; Tarbox, L.V.

    2011-01-01

    For almost 150 years, the Periodic Table of the Elements has served as a guide to the world of elements by highlighting similarities and differences in atomic structure and chemical properties. To introduce students, teachers, and society to the existence and importance of isotopes of the chemical elements, an IUPAC Periodic Table of the Isotopes (IPTI) has been prepared and can be found as a supplement to this issue.

  12. Electron transport through ac driven graphene p-n junctions

    Science.gov (United States)

    Zhang, Zhi-Qiang; Kang, Yan-Zhuo; Ding, Kai-He

    2018-02-01

    We study the electronic transport through ac driven graphene p-n junctions under a perpendicular magnetic field. It is found that subject to the transversely or longitudinally polarized ac field, in the p-n region, the conductance versus the on-site energy of the right electrode exhibits a characteristic structure with a zero value plateau and the followed oscillation peaks, whose widths are greatly suppressed by the ac field. In the n-n region, the conductance plateaus at G = (n + 1 / 2) (4e2 / h) (n is an integer) shrink for the transversely polarized ac field, whereas accompanied with the addition of the new quantized plateaus at G = n (4e2 / h) for the longitudinally polarized ac field. The combined influence of the ac field with the disorder can trigger a change in the mixing of the hole and electron states at the p-n interface, which leads to a destruction of the plateaus structure in the conductance versus the disorder strength with the emergence of new ones. The influence of the elliptically and circularly polarized ac field on the conductance is also shown.

  13. AC loss characteristics of CORC® cable with a Cu former

    Science.gov (United States)

    Terzioğlu, R.; Vojenčiak, M.; Sheng, J.; Gömöry, F.; Çavuş, T. F.; Belenli, İ.

    2017-08-01

    High-temperature superconductors from the REBCO (RE = rare earth) family have attained industrial production and their performance is continuously being enhanced. However, cabling technology for high-current (kA range) cables for magnet technology is still challenging and there are only few cable concepts available (CORC®, Roebel cable, twisted stack cable). Each of them exhibits different characteristics. In this paper we experimentally investigate CORC® cable produced in-house utilizing a copper tube former. Such a former offers a central cooling channel for partial or complete cable cooling by forced flow of coolant. We focus mainly on AC loss due to transporting AC current, an external applied AC magnetic field and their simultaneous action. In the case of transporting AC current we found indications that a large part of the total loss has its origin in eddy currents due to an axial magnetic field. For the investigation of magnetization AC loss, we prepared several samples with different configurations. In this case we found direct evidence for increasing AC loss due to losses in the metallic former. However, we also found that at low field amplitudes the magnetization AC loss of the complete cable is lower than the loss in the bare former. This is caused by shielding of the magnetic field by a superconductor, which was also confirmed by numerical simulations.

  14. Neutron background estimates in GESA

    Directory of Open Access Journals (Sweden)

    Fernandes A.C.

    2014-01-01

    Full Text Available The SIMPLE project looks for nuclear recoil events generated by rare dark matter scattering interactions. Nuclear recoils are also produced by more prevalent cosmogenic neutron interactions. While the rock overburden shields against (μ,n neutrons to below 10−8 cm−2 s−1, it itself contributes via radio-impurities. Additional shielding of these is similar, both suppressing and contributing neutrons. We report on the Monte Carlo (MCNP estimation of the on-detector neutron backgrounds for the SIMPLE experiment located in the GESA facility of the Laboratoire Souterrain à Bas Bruit, and its use in defining additional shielding for measurements which have led to a reduction in the extrinsic neutron background to ∼ 5 × 10−3 evts/kgd. The calculated event rate induced by the neutron background is ∼ 0,3 evts/kgd, with a dominant contribution from the detector container.

  15. A definition of background independence

    International Nuclear Information System (INIS)

    Gryb, Sean

    2010-01-01

    We propose a definition for background (in)/dependence in dynamical theories of the evolution of configurations that have a continuous symmetry and test this definition on particle models and on gravity. Our definition draws from Barbour's best matching framework developed for the purpose of implementing spatial and temporal relationalism. Among other interesting theories, general relativity can be derived within this framework in novel ways. We study the detailed canonical structure of a wide range of best matching theories and show that their actions must have a local gauge symmetry. When gauge theory is derived in this way, we obtain at the same time a conceptual framework for distinguishing between background-dependent and -independent theories. Gauge invariant observables satisfying Kuchar's criterion are identified and, in simple cases, explicitly computed. We propose a procedure for inserting a global background time into temporally relational theories. Interestingly, using this procedure in general relativity leads to unimodular gravity.

  16. Food Composition Tables of Japan and the Nutrient Table/Database.

    Science.gov (United States)

    Watanabe, Tomoko

    2015-01-01

    A global food composition database has been constructed by the United Nations Food and Agriculture Organization (FAO) based on food composition tables from every country in the world. To improve this database, the FAO has organized the International Network of Food Data Systems (INFOODS). The most recent version of the food composition table for Japan was published by the Ministry of Education, Culture, Sports, Science and Technology and is presented in three books: "Standard Tables of Food Composition Japan-2010-," "Fatty Acid Composition of Foods-2005-," and "Amino Acid Composition of Foods-2010-." The Standard Tables of Food Composition in Japan-2015- (Energy, General Components, Minerals, Vitamins, etc. Section; Fatty Acids Section; Amino Acids Section; Carbohydrates Section) will be published in 2015 and is expected to play an important role as one of the main tables of the East Asia food composition tables.

  17. TableMaker: An Excel Macro for Publication-Quality Tables

    Directory of Open Access Journals (Sweden)

    Marek Hlavac

    2016-04-01

    Full Text Available This article introduces TableMaker, a Microsoft Excel macro that produces publicationquality tables and includes them as new sheets in workbooks. The macro provides an intuitive graphical user interface that allows for the full customization of all table features. It also allows users to save and load table templates, and thus allows layouts to be both reproducible and transferable. It is distributed in a single computer file. As such, the macro is easy to share, as well as accessible to even beginning and casual users of Excel. Since it allows for the quick creation of reproducible and fully customizable tables, TableMaker can be very useful to academics, policy-makers and businesses by making the presentation and formatting of results faster and more efficient.

  18. dc Arc Fault Effect on Hybrid ac/dc Microgrid

    Science.gov (United States)

    Fatima, Zahra

    The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

  19. Generative electronic background music system

    International Nuclear Information System (INIS)

    Mazurowski, Lukasz

    2015-01-01

    In this short paper-extended abstract the new approach to generation of electronic background music has been presented. The Generative Electronic Background Music System (GEBMS) has been located between other related approaches within the musical algorithm positioning framework proposed by Woller et al. The music composition process is performed by a number of mini-models parameterized by further described properties. The mini-models generate fragments of musical patterns used in output composition. Musical pattern and output generation are controlled by container for the mini-models - a host-model. General mechanism has been presented including the example of the synthesized output compositions

  20. Generative electronic background music system

    Energy Technology Data Exchange (ETDEWEB)

    Mazurowski, Lukasz [Faculty of Computer Science, West Pomeranian University of Technology in Szczecin, Zolnierska Street 49, Szczecin, PL (Poland)

    2015-03-10

    In this short paper-extended abstract the new approach to generation of electronic background music has been presented. The Generative Electronic Background Music System (GEBMS) has been located between other related approaches within the musical algorithm positioning framework proposed by Woller et al. The music composition process is performed by a number of mini-models parameterized by further described properties. The mini-models generate fragments of musical patterns used in output composition. Musical pattern and output generation are controlled by container for the mini-models - a host-model. General mechanism has been presented including the example of the synthesized output compositions.

  1. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  2. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Pan Jiarong; Zhang Wei; Lin Min; Zhang Jie; Qiao Yanhong

    2006-01-01

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125 I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  3. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  4. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2015-01-01

    Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

  5. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2014-01-01

    Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

  6. Motion Control and Implementation for an AC Servomotor System

    Directory of Open Access Journals (Sweden)

    L. Canan Dülger

    2007-01-01

    Full Text Available This paper presents a study on trajectory tracking problem for an AC synchronous servomotor. A mathematical model for the system including AC synchronous servomotor, gearbox, and a load is developed to examine the systems dynamic behavior. The system is controlled by a traditional PID (proportional + integral + derivative controller. The required values for the controller settings are found experimentally. Different motion profiles are designed, and trapezoidal ones are implemented. Thus, the experimental validation of the model is achieved using the experimental setup. The simulation and experimental results are presented. The tracking performance of an AC servomotor system is illustrated with proposed PID controller.

  7. Study of ac loss in Bi-2223/Ag tape under the simultaneous action of ac transport current and ac magnetic field shifted in phase

    International Nuclear Information System (INIS)

    Vojenciak, M; Souc, J; Ceballos, J M; Goemoery, F; Klincok, B; Pardo, E; Grilli, F

    2006-01-01

    Investigation of ac loss under the simultaneous action of the transport ac current and the external ac magnetic field is of prime importance for the reliable prediction of dissipation in electric power devices such as motors/generators, transformers and transmission cables. An experimental rig allowing us to perform ac loss measurements in such conditions, on short (10 cm) tape samples of high-temperature superconductor Bi-2223/Ag, was designed and tested. Both the electromagnetic and thermal methods were incorporated, allowing us to combine the better sensitivity of the former and the higher reliability of the latter. Our main aim was to see how the ac loss depends on the phase shift between the transport current and the external magnetic field. Such a shift could have different values in various applications. While in a transformer winding, the maximum phase shift at full load will probably not exceed a few degrees, in a three phase transmission cable in tri-axial configuration it is around 120 0 . Therefore, we explored the whole range of phase shifts from 0 to 360 0 . Surprisingly, the maxima of dissipation did not coincide with zero shift as expected from qualitative considerations

  8. Lamin A/C truncation in dilated cardiomyopathy with conduction disease

    Directory of Open Access Journals (Sweden)

    Huber Jill M

    2003-07-01

    Full Text Available Abstract Background Mutations in the gene encoding the nuclear membrane protein lamin A/C have been associated with at least 7 distinct diseases including autosomal dominant dilated cardiomyopathy with conduction system disease, autosomal dominant and recessive Emery Dreifuss Muscular Dystrophy, limb girdle muscular dystrophy type 1B, autosomal recessive type 2 Charcot Marie Tooth, mandibuloacral dysplasia, familial partial lipodystrophy and Hutchinson-Gilford progeria. Methods We used mutation detection to evaluate the lamin A/C gene in a 45 year-old woman with familial dilated cardiomyopathy and conduction system disease whose family has been well characterized for this phenotype 1. Results DNA from the proband was analyzed, and a novel 2 base-pair deletion c.908_909delCT in LMNA was identified. Conclusions Mutations in the gene encoding lamin A/C can lead to significant cardiac conduction system disease that can be successfully treated with pacemakers and/or defibrillators. Genetic screening can help assess risk for arrhythmia and need for device implantation.

  9. Low Background Micromegas in CAST

    DEFF Research Database (Denmark)

    Garza, J G; Aune, S.; Aznar, F.

    2014-01-01

    Solar axions could be converted into x-rays inside the strong magnetic field of an axion helioscope, triggering the detection of this elusive particle. Low background x-ray detectors are an essential component for the sensitivity of these searches. We report on the latest developments of the Micr......Solar axions could be converted into x-rays inside the strong magnetic field of an axion helioscope, triggering the detection of this elusive particle. Low background x-ray detectors are an essential component for the sensitivity of these searches. We report on the latest developments...... of the Micromegas detectors for the CERN Axion Solar Telescope (CAST), including technological pathfinder activities for the future International Axion Observatory (IAXO). The use of low background techniques and the application of discrimination algorithms based on the high granularity of the readout have led...... to background levels below 10−6 counts/keV/cm2/s, more than a factor 100 lower than the first generation of Micromegas detectors. The best levels achieved at the Canfranc Underground Laboratory (LSC) are as low as 10−7 counts/keV/cm2/s, showing good prospects for the application of this technology in IAXO...

  10. Teaching about Natural Background Radiation

    Science.gov (United States)

    Al-Azmi, Darwish; Karunakara, N.; Mustapha, Amidu O.

    2013-01-01

    Ambient gamma dose rates in air were measured at different locations (indoors and outdoors) to demonstrate the ubiquitous nature of natural background radiation in the environment and to show that levels vary from one location to another, depending on the underlying geology. The effect of a lead shield on a gamma radiation field was also…

  11. Educational Choice. A Background Paper.

    Science.gov (United States)

    Quality Education for Minorities Network, Washington, DC.

    This paper addresses school choice, one proposal to address parental involvement concerns, focusing on historical background, definitions, rationale for advocating choice, implementation strategies, and implications for minorities and low-income families. In the past, transfer payment programs such as tuition tax credits and vouchers were…

  12. Family Background and Educational Choices

    DEFF Research Database (Denmark)

    McIntosh, James; D. Munk, Martin

    enrollments, especially for females. Not only did the educational opportunities for individuals with disadvantaged backgrounds improve absolutely, but their relative position also improved. A similarly dramatic increase in attendance at university for the period 1985-2005 was found for these cohorts when...

  13. Ambient Background Particulate Compositiion Outdoor Natural Background: Interferents/Clutter

    Science.gov (United States)

    2011-08-01

    current generation of point and standoff BW detectors. Data were extracted from 2 long- term environmental background studies, which provide the rationale...cause False Alarms by these non specific biodctectors. The response of biodetection technologies to the naturally occurring bioaerosol interferents...day, and can be affected by regional and local sources. Regional sources and most local emission sources generally become dispersed and mixed

  14. The cosmic infrared background experiment

    Science.gov (United States)

    Bock, James; Battle, John; Cooray, Asantha; Kawada, Mitsunobu; Keating, Brian; Lange, Andrew; Lee, Dae-Hea; Matsumoto, Toshio; Matsuura, Shuji; Pak, Soojong; Renbarger, Tom; Sullivan, Ian; Tsumura, Kohji; Wada, Takehiko; Watabe, Toyoki

    2006-03-01

    The extragalactic background, based on absolute measurements reported by DIRBE and IRTS at 1.2 and 2.2 μm, exceeds the brightness derived from galaxy counts by up to a factor 5. Furthermore, both DIRBE and the IRTS report fluctuations in the near-infrared sky brightness that appear to have an extra-galactic origin, but are larger than expected from local ( z = 1-3) galaxies. These observations have led to speculation that a new class of high-mass stars or mini-quasars may dominate primordial star formation at high-redshift ( z ˜ 10-20), which, in order to explain the excess in the near-infrared background, must be highly luminous but produce a limited amount of metals and X-ray photons. Regardless of the nature of the sources, if a significant component of the near-infrared background comes from first-light galaxies, theoretical models generically predict a prominent near-infrared spectral feature from the redshifted Lyman cutoff, and a distinctive fluctuation power spectrum. We are developing a rocket-borne instrument (the Cosmic Infrared Background ExpeRiment, or CIBER) to search for signatures of primordial galaxy formation in the cosmic near-infrared extra-galactic background. CIBER consists of a wide-field two-color camera, a low-resolution absolute spectrometer, and a high-resolution narrow-band imaging spectrometer. The cameras will search for spatial fluctuations in the background on angular scales from 7″ to 2°, where a first-light galaxy signature is expected to peak, over a range of angular scales poorly covered by previous experiments. CIBER will determine if the fluctuations reported by the IRTS arise from first-light galaxies or have a local origin. In a short rocket flight CIBER has sensitivity to probe fluctuations 100× fainter than IRTS/DIRBE, with sufficient resolution to remove local-galaxy correlations. By jointly observing regions of the sky studied by Spitzer and ASTRO-F, CIBER will build a multi-color view of the near

  15. The Cosmic Infrared Background Experiment

    Science.gov (United States)

    Bock, James; Battle, J.; Cooray, A.; Hristov, V.; Kawada, M.; Keating, B.; Lee, D.; Matsumoto, T.; Matsuura, S.; Nam, U.; Renbarger, T.; Sullivan, I.; Tsumura, K.; Wada, T.; Zemcov, M.

    2009-01-01

    We are developing the Cosmic Infrared Background ExpeRiment (CIBER) to search for signatures of first-light galaxy emission in the extragalactic background. The first generation of stars produce characteristic signatures in the near-infrared extragalactic background, including a redshifted Ly-cutoff feature and a characteristic fluctuation power spectrum, that may be detectable with a specialized instrument. CIBER consists of two wide-field cameras to measure the fluctuation power spectrum, and a low-resolution and a narrow-band spectrometer to measure the absolute background. The cameras will search for fluctuations on angular scales from 7 arcseconds to 2 degrees, where the first-light galaxy spatial power spectrum peaks. The cameras have the necessary combination of sensitivity, wide field of view, spatial resolution, and multiple bands to make a definitive measurement. CIBER will determine if the fluctuations reported by Spitzer arise from first-light galaxies. The cameras observe in a single wide field of view, eliminating systematic errors associated with mosaicing. Two bands are chosen to maximize the first-light signal contrast, at 1.6 um near the expected spectral maximum, and at 1.0 um; the combination is a powerful discriminant against fluctuations arising from local sources. We will observe regions of the sky surveyed by Spitzer and Akari. The low-resolution spectrometer will search for the redshifted Lyman cutoff feature in the 0.7 - 1.8 um spectral region. The narrow-band spectrometer will measure the absolute Zodiacal brightness using the scattered 854.2 nm Ca II Fraunhofer line. The spectrometers will test if reports of a diffuse extragalactic background in the 1 - 2 um band continues into the optical, or is caused by an under estimation of the Zodiacal foreground. We report performance of the assembled and tested instrument as we prepare for a first sounding rocket flight in early 2009. CIBER is funded by the NASA/APRA sub-orbital program.

  16. Deacetylation of H4-K16Ac and heterochromatin assembly in senescence

    Directory of Open Access Journals (Sweden)

    Contrepois Kévin

    2012-08-01

    Full Text Available Abstract Background Cellular senescence is a stress response of mammalian cells leading to a durable arrest of cell proliferation that has been implicated in tumor suppression, wound healing, and aging. The proliferative arrest is mediated by transcriptional repression of genes essential for cell division by the retinoblastoma protein family. This repression is accompanied by varying degrees of heterochromatin assembly, but little is known regarding the molecular mechanisms involved. Results We found that both deacetylation of H4-K16Ac and expression of HMGA1/2 can contribute to DNA compaction during senescence. SIRT2, an NAD-dependent class III histone deacetylase, contributes to H4-K16Ac deacetylation and DNA compaction in human fibroblast cell lines that assemble striking senescence-associated heterochromatin foci (SAHFs. Decreased H4-K16Ac was observed in both replicative and oncogene-induced senescence of these cells. In contrast, this mechanism was inoperative in a fibroblast cell line that did not assemble extensive heterochromatin during senescence. Treatment of senescent cells with trichostatin A, a class I/II histone deacetylase inhibitor, also induced rapid and reversible decondensation of SAHFs. Inhibition of DNA compaction did not significantly affect the stability of the senescent state. Conclusions Variable DNA compaction observed during senescence is explained in part by cell-type specific regulation of H4 deacetylation and HMGA1/2 expression. Deacetylation of H4-K16Ac during senescence may explain reported decreases in this mark during mammalian aging and in cancer cells.

  17. Family Perspectives: Using a Cultural Prism to Understand Families from Asian Cultural Backgrounds

    Science.gov (United States)

    Lee, Suk-Hyang; Turnbull, Ann P.; Zan, Fei

    2009-01-01

    Educators can better serve students who come from diverse cultural backgrounds by understanding the differing cultural values of these students and their families. This article explores different cultural perspectives using a cultural prism approach, focused most specifically on the Korean and Chinese cultures. (Contains 2 tables.)

  18. Vibration transfers to measure the performance of vibration isolated platforms on site using background noise excitation

    NARCIS (Netherlands)

    Segerink, Franciscus B.; Korterik, Jeroen P.; Offerhaus, Herman L.

    2011-01-01

    This article demonstrates a quick and easy way of quantifying the performance of a vibration-isolated platform. We measure the vibration transfer from floor to table using background noise excitation from the floor. As no excitation device is needed, our setup only requires two identical sensors (in

  19. AC impedance technique in PEM fuel cell diagnosis - A review

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, Xiaozi; Wang, Haijiang; Colin Sun, Jian; Zhang, Jiujun [Institute for Fuel Cell Innovation, National Research Council (Canada)

    2007-12-15

    Because the AC impedance technique, also known as electrochemical impedance spectroscopy (EIS), is being utilized by more and more researchers in proton exchange membrane (PEM) fuel cell studies, the technique has developed into a primary tool in such research. In this paper the recent work on PEM fuel cells using the AC impedance technique is reviewed. Both in situ and ex situ impedance measurements are discussed, with primary focus on the in situ measurements. Within the domain of in situ studies, various methods for measuring the impedance of a PEM fuel cell are examined, and typical impedance spectra in several common scenarios are presented. Representative applications of the AC impedance technique in PEM fuel cell research are also discussed. Finally, the necessity of a time domain rapid AC impedance technique is briefly discussed. (author)

  20. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  1. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  2. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  3. Determination of {sup 227}Ac by {alpha}-particle spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Martin, P. [Environmental Research Inst. of the Supervising Scientist, Jabiru, NT (Australia); Hancock, G.J. [Commonwealth Scientific and Industrial Research Organization, Canberra, ACT (Australia). Div. of Water Resources; Paulka, S. [Australian Radiation Lab., Yallambie, VIC (Australia); Akber, R.A. [Queensland Univ. of Technology, Brisbane, QLD (Australia)

    1995-10-01

    A method is described for the determination of {sup 227}Ac concentration in environmental samples. Actinium is separated from the sample digest by co-precipitation with lead sulphate, purified using anion and cation exchange techniques, and electrodeposited onto a stainless-steel disc. The chemical yield is monitored by addition of a {sup 229}Th/{sup 225}Ra/{sup 225}Ac tracer before sample dissolution. {sup 225}Ac recovery is determined from an initial count by measurement of its {alpha}-emitting daughter, {sup 217}At. The disc is then stored for 2-3 months and recounted. The {sup 227}Ac activity is obtained by measurement of the ingrown {sup 227}Th and {sup 223}Ra activities in the 5.38-6.10 MeV region. Co-precipitation with lead sulphate enables the convenient determination of actinium, thorium and radium on the same sample digest. (author).

  4. Initial tests of an AC dipole for the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; /Texas U.; Jansson, A.; /Fermilab; Kopp, S.; /Texas U.; Syphers, M.; /Fermilab

    2006-06-01

    The AC dipole is a device to diagnose transverse motions of a beam. It can achieve large-amplitude oscillations without two inevitable problems of conventional kicker/pinger magnets: decoherence and emittance growth. While not the first synchrotron to operate with an AC dipole, the Tevatron can now make use of its recently upgraded BPM system, providing unprecedented resolution for use with an AC dipole, to measure both linear and nonlinear properties of the accelerator. Plans are to provide AC dipole systems for both transverse degrees of freedom. Preliminary tests have been done using an audio power amplifier with an existing vertical pinger magnet, producing oscillation amplitudes up to 2{sigma} at 150 GeV. In this paper, we will present the configuration of this system. We also show the analysis of a first few data sets, including the direct measurement of beta functions at BPM locations.

  5. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  6. High-Frequency ac Power-Distribution System

    Science.gov (United States)

    Hansen, Irving G.; Mildice, James

    1987-01-01

    Loads managed automatically under cycle-by-cycle control. 440-V rms, 20-kHz ac power system developed. System flexible, versatile, and "transparent" to user equipment, while maintaining high efficiency and low weight. Electrical source, from dc to 2,200-Hz ac converted to 440-V rms, 20-kHz, single-phase ac. Power distributed through low-inductance cables. Output power either dc or variable ac. Energy transferred per cycle reduced by factor of 50. Number of parts reduced by factor of about 5 and power loss reduced by two-thirds. Factors result in increased reliability and reduced costs. Used in any power-distribution system requiring high efficiency, high reliability, low weight, and flexibility to handle variety of sources and loads.

  7. Determining Attributes Contributing to Success in Army Civil Schooling (ACS)

    National Research Council Canada - National Science Library

    Ottinger, Maurice A

    2006-01-01

    ...) in the Army and Defense Comptrollership Program Classes of 1998-2005 at Syracuse University which represent a specialized aspect of ACS where participants follow substantially the same program and earn the same degrees...

  8. Extension to AC Loss Minimisation in High Temperature Superconductors

    National Research Council Canada - National Science Library

    Campbell, Archie

    2004-01-01

    ...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...

  9. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  10. Muc5ac Mucin Expression During Rat Skin Development

    OpenAIRE

    Ferretti, V.; Segal-Eiras, A.; Barbeito, C.G.; Croce, M.V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  11. Comparison of costs and benefits for dc and ac transmission

    Energy Technology Data Exchange (ETDEWEB)

    Stovall, J.P.; Bowles, J.P.; Diemond, C.C.; Eaton, R.A.; Gnadt, P.A.; Heyer, S.V.; Lasseter, R.H.; Lebow, M.A.; Long W.F.; McIver, J.C.

    1987-02-01

    The purpose of the study reported here was to examine generic cost differences between direct current (dc) and alternating current (ac) systems and to identify situations in which dc is clearly advantageous for long distance and bulk power transport. The study was also designed to determine the value of the dc technology when applied to transmission systems. This report presents cost comparisons between ac and dc substations and transmission lines as a function of capacity and voltage. It also presents a comparison of dc versus ac for increasing the capacity of existing corridors. Direct-current link operating stategies for enhancing the performance of the associated ac network are illustrated. Possible opportunities for simplification and cost reduction of dc converter stations are described. Both current and expected future enhancements for ac system operation are also identified to assist in making comparisons between equivalent systems. Information is presented to enable comparisons sufficiently detailed to determine ''cost break-even distance,'' which is the transmission length at which the savings in dc line costs (compared to ac) equals the additional costs of the dc converter stations (compared to ac substations). However, it is emphasized that proper use of the concept requires the inclusion of all costs of implementation of those attributes available in the two technologies which are of sufficient value to the power system to be included in determining equivalent systems. The report attempts to bring together useful cost and performance information on ac and dc power transmission for the use of electric utility system in achieving economic and reliable power system designs when considering system additions, expansions, or modifications.

  12. Response of Magnetic Force Microscopy Probes under AC Magnetic Field

    Science.gov (United States)

    Sungthong, A.; Ruksasakchai, P.; Saengkaew, K.; Cheowanish, I.; Damrongsak, B.

    2017-09-01

    In this paper, magnetic force microscopy (MFM) probes with different coating materials were characterized under AC magnetic field. A perpendicular magnetic write head similar to those used in hard disk drives was employed as the AC magnetic field generator. In order to measure a response of MFM probes to AC magnetic field, a MFM probe under test was scanned, at a scan height of 10 nm, across the surface of the magnetic write head. During MFM imaging, the write head was biased by a sufficient magnitude of AC current, approximately 30 mA. A spectral analysis for a frequency sweep from 1 kHz to 100 MHz was extracted from post-processing MFM images. As expected, a MFM probe coated with hard magnetic alloys, i.e. FePt, has the lowest response to AC magnetic fields. MFM probes coated with soft magnetic alloys, i.e. NiFe and NiCoCr, have a relatively high and flat response across the frequency range. Ni coated MFM probe has the highest response to AC magnetic fields. In addition, CoCr and NiCo coated MFM probes show lower response than NiFe and NiCoCr probes at low frequencies; however, theirs response to AC magnetic field increase for the AC magnetic field with a frequency above 50 kHz. This can be implied that those MFM probes are a good candidate for being used to study the high-frequency performance of perpendicular magnetic write heads. Noting that response of all MFM probes significantly decreased when driven frequencies above 1 MHz due to the limitation of the hardware, i.e. response of quadrant photodiode and op-amp in a pre-amplifier.

  13. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  14. Mixed mobile ion effect on ac conductivity of boroarsenate glasses

    Indian Academy of Sciences (India)

    In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...

  15. AC Calorimetric Design for Dynamic of Biological Materials

    OpenAIRE

    Shigeo Imaizumi

    2006-01-01

    We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

  16. Diagnostics of the Fermilab Tevatron using an AC dipole

    Science.gov (United States)

    Miyamoto, Ryoichi

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f˜20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  17. AC quantum voltmeter for the industry; AC-Quantenvoltmeter fuer die Industrie

    Energy Technology Data Exchange (ETDEWEB)

    Behr, Ralf [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe 2.63 ' ' Josephson-Effekt, Spannung' ' ; Smandek, Bernhard [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe Q.33 ' ' Technologietransfer' '

    2016-09-15

    In a first part difficulties and challenges of the novel operation principle, the ''differential scanning system'' are discussed and explained, how with highest metrological precision the proof of principle succeeded. By common research with other national metrology institutes the concept was consolidated and improved. In a second part it was exemplarically illuminated, how by an efficient dovetailing of European and national promotion programs with different application neighbourhood consolidated knowledge of basic metrological research could be transferred to economy and especially small and medium companies. With an AC quantum voltmeter up to 10 V and 1 kHz already a unique commercial device is available. How the development foreseeable goes on illuminates the final part of the article.

  18. Backgrounds and characteristics of arsonists.

    Science.gov (United States)

    Labree, Wim; Nijman, Henk; van Marle, Hjalmar; Rassin, Eric

    2010-01-01

    The aim of this study was to gain more insight in the backgrounds and characteristics of arsonists. For this, the psychiatric, psychological, personal, and criminal backgrounds of all arsonists (n=25), sentenced to forced treatment in the maximum security forensic hospital "De Kijvelanden", were compared to the characteristics of a control group of patients (n=50), incarcerated at the same institution for other severe crimes. Apart from DSM-IV Axis I and Axis II disorders, family backgrounds, level of education, treatment history, intelligence (WAIS scores), and PCL-R scores were included in the comparisons. Furthermore, the apparent motives for the arson offences were explored. It was found that arsonists had more often received psychiatric treatment, prior to committing their index offence, and had a history of severe alcohol abuse more often in comparison to the controls. The arsonists turned out to be less likely to suffer from a major psychotic disorder. Both groups did not differ significantly on the other variables, among which the PCL-R total scores and factor scores. Exploratory analyses however, did suggest that arsonists may differentiate from non-arsonists on three items of the PCL-R, namely impulsivity (higher scores), superficial charm (lower scores), and juvenile delinquency (lower scores). Although the number of arsonists with a major psychotic disorder was relatively low (28%), delusional thinking of some form was judged to play a role in causing arson crimes in about half of the cases (52%).

  19. 21 CFR 880.6140 - Medical chair and table.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Medical chair and table. 880.6140 Section 880.6140... Devices § 880.6140 Medical chair and table. (a) Identification. A medical chair or table is a device intended for medical purposes that consists of a chair or table without wheels and not electrically powered...

  20. Tests for homogeneity for multiple 2 x 2 contingency tables

    International Nuclear Information System (INIS)

    Carr, D.B.

    1986-01-01

    Frequently data are described by 2 x 2 contingency tables. For example, each 2 x 2 table arises from two dichotomous classifications such as control/treated and respond/did not respond. Multiple 2 x 2 tables result from stratifying the observational units on the basis of other characteristics. For example, stratifying by sex produces separate 2 x 2 tables for males and females. From each table a measure of difference between the response rates for the control and the treated groups is computed. The researcher usually wants to know if the response-rate difference is zero for each table. If the tables are homogeneous, the researcher can generalize from a statement concerning an average to a statement concerning each table. If tables are not homogeneous, homogeneous subsets of the tables should be described separately. This paper presents tests for homogeneity and illustrates their use. 11 refs., 6 tabs

  1. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  2. Radiation guard for x-ray table

    International Nuclear Information System (INIS)

    Collica, C.; Epifano, L.; Farella, R.

    1976-01-01

    A radiation guard suitable for use in conjunction with a diagnostic table and penetrable by the hands of an operator to facilitate moving or examining a patient positioned on a table. In accordance with the invention there is provided a supportive frame mountable at about an edge of the table so as to extend vertically from about the edge, the frame comprising at least a pair of spaced bars. A plurality of strips of flexible radiation shielding material are mounted across the bars in closely spaced relationship, the strips being mounted sufficiently close together to prevent substantial radiation leakage through the frame. The hands of an operator can be inserted between the adjacent strips to manually reposition or examine a patient while protecting most of the operator's body from substantial radiation. 9 claims, 4 drawing figures

  3. The Periodic Round Table (by Gary Katz)

    Science.gov (United States)

    Rodgers, Reviewed By Glen E.

    2000-02-01

    Unwrapping and lifting the Periodic Round Table out of its colorful box is an exciting experience for a professional chemist or a chemistry student. Touted as a "new way of looking at the elements", it is certainly thatat least at first blush. The "table" consists of four sets of two finely finished hardwood discs each with the following elemental symbols and their corresponding atomic numbers pleasingly and symmetrically wood-burned into their faces. The four sets of two discs are 1 1/2, 3, 4 1/2, and 6 in. in diameter, each disc is 3/4 in. thick, and therefore the entire "round table" stands 6 in. high and is 6 in. in diameter at its base. The eight beautifully polished discs (represented below) are held together by center dowels that allow each to be rotated separately.

  4. Thermodynamic tables for nuclear waste isolation

    International Nuclear Information System (INIS)

    Phillips, S.L.; Hale, F.V.; Silvester, L.F.; Siegel, M.D.

    1988-05-01

    Tables of consistent thermodynamic property values for nuclear waste isolation are given. The tables include critically assessed values for Gibbs energy of formation, enthalpy of formation, entropy and heat capacity for minerals; solids; aqueous ions; ion pairs and complex ions of selected actinide and fission decay products at 25 degree C and zero ionic strength. These intrinsic data are used to calculate equilibrium constants and standard potentials which are compared with typical experimental measurements and other work. Recommendations for additional research are given. 13 figs., 23 tabs

  5. A contingency table approach to nonparametric testing

    CERN Document Server

    Rayner, JCW

    2000-01-01

    Most texts on nonparametric techniques concentrate on location and linear-linear (correlation) tests, with less emphasis on dispersion effects and linear-quadratic tests. Tests for higher moment effects are virtually ignored. Using a fresh approach, A Contingency Table Approach to Nonparametric Testing unifies and extends the popular, standard tests by linking them to tests based on models for data that can be presented in contingency tables.This approach unifies popular nonparametric statistical inference and makes the traditional, most commonly performed nonparametric analyses much more comp

  6. Mathematics of Periodic Tables for Benzenoid Hydrocarbons.

    Science.gov (United States)

    Dias, Jerry Ray

    2007-01-01

    The upper and lower bounds for invariants of polyhex systems based on the Harary and Harborth inequalities are studied. It is shown that these invariants are uniquely correlated by the Periodic Table for Benzenoid Hydrocarbons. A modified periodic table for total resonant sextet (TRS) benzenoids based on the invariants of Ds and r(empty) is presented; Ds is the number of disconnections among the empty rings for fused TRS benzenoid hydrocarbons. This work represents a contribution toward deciphering the topological information content of benzenoid formulas.

  7. Submatrices of character tables and basic sets

    DEFF Research Database (Denmark)

    Bessenrodt, Christine; Olsson, Jørn Børling

    2012-01-01

    In this investigation of character tables of nite groups we study basic sets and associated representation theoretic data for complementary sets of conjugacy lasses. For the symmetric groups we nd unexpected properties of characters on restricted sets of conjugacy classes, like beautiful...... combinatorial determinant formulae for submatrices of the character table and Cartan matrices with respect to basic sets; we observe that similar phenomena occur for the transition matrices between power sum symmetric functions to bounded partitions and the k-Schur functions dened by Lapointe and Morse...

  8. [Toothache with a neuropathic background].

    Science.gov (United States)

    Khatchaturian, V; de Wijer, A; Kalaykova, S I; Steenks, M H

    2015-03-01

    A 48-year old woman in good general health was referred to the orofacial pain clinic in a centre for special dentistry with a toothache in the premolar region of the left maxillary quadrant. The complaints had existed for 15 years and various dental treatments, including endodontic treatments, apical surgery, extraction and splint therapy, had not helped to alleviate the complaints. As a result of the fact that anti-epileptic drugs were able to reduce the pain it was concluded that this 'toothache' satisfied the criteria of an atypical odontalgia: 'toothache' with a neuropathic background.

  9. AC susceptibility as a characterization tool for coated conductor tapes

    Science.gov (United States)

    Gömöry, F.; Vojenčiak, M.; Solovyov, M.; Frolek, L.; Šouc, J.; Seiler, E.; Bauer, M.; Falter, M.

    2017-11-01

    The measurement and analysis of magnetic AC susceptibility is a useful tool in the study of superconductor (SC) materials. Exposure of a sample to a magnetic field changing in time generates loops of electrical currents that are detectable in a contactless way with the help of a suitable pick-up system. In this paper the applicability of this technique in the characterization and quality control of coated conductor (CC) tapes is evaluated. First we recollect the essential results of the analytical theory derived for thin SC strips and their extrapolation to strips with finite thickness. From the analytical expressions one can see how the properties of CC tape that are important for application in electric power devices, namely its critical current and AC loss, can be deduced from AC susceptibility data in straightforward way. The main focus of our study is to investigate the influence that various cases of non-uniformities in SC layer exhibit on the magnetic properties examined in an AC regime. Numerical computations were used to explore the consequences of lateral variation in the critical current density. Predictions derived for some model cases were compared with experimental findings. A dedicated experiment was also carried out to demonstrate that a transverse scratch that would be detrimental for DC transport could sneak unobserved through the AC magnetic experiment on a long sample. Our study shows that the analysis of both parts of the complex magnetic susceptibility in place of a mere AC loss determination in a common AC magnetization experiment is worth the additional effort.

  10. AC power flow importance measures considering multi-element failures

    International Nuclear Information System (INIS)

    Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

    2017-01-01

    Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

  11. A Novel Four-Step Commutation for Bidirectional Switch Cells of AC-AC Matrix Converter

    DEFF Research Database (Denmark)

    Guo, Yougui; Zeng, Ping; Blaabjerg, Frede

    2012-01-01

    on or off of output current happens on the second and third steps. Here the second step is equal to the third one. This method is implemented with four steps by programming in VHDL language. First, the special flip-flop, 74AHC16373, is obtained by programming so as to make input sector signals, output...... sector ones and active switching time PWM ones synchronize. Second, the required switching states are flexibly realized in the form of the look-up table by programming in VHDL language for 36 switching combinations of input sectors with output ones. Third, the obtained switching states are judged whether......A novel four-step commutation is proposed with unequal step for each bidirectional switch cell on the basis on analysis of many proposed commutation methods of matrix converter in this paper. The first and fourth step can be shorter than the second or third one because the actual switching...

  12. Background radiation map of Thailand

    International Nuclear Information System (INIS)

    Angsuwathana, P.; Chotikanatis, P.

    1997-01-01

    The radioelement concentration in the natural environment as well as the radiation exposure to man in day-to-day life is now the most interesting topic. The natural radiation is frequently referred as a standard for comparing additional sources of man-made radiation such as atomic weapon fallout, nuclear power generation, radioactive waste disposal, etc. The Department of Mineral Resources commenced a five-year project of nationwide airborne geophysical survey by awarding to Kenting Earth Sciences International Limited in 1984. The original purpose of survey was to support mineral exploration and geological mapping. Subsequently, the data quantity has been proved to be suitable for natural radiation information. In 1993 the Department of Mineral Resources, with the assistance of IAEA, published a Background Radiation Map of Thailand at the scale of 1:1,000,000 from the existing airborne radiometric digital data. The production of Background Radiation Map of Thailand is the result of data compilation and correction procedure developed over the Canadian Shield. This end product will be used as a base map in environmental application not only for Thailand but also Southeast Asia region. (author)

  13. Optical polarization: background and camouflage

    Science.gov (United States)

    Škerlind, Christina; Hallberg, Tomas; Eriksson, Johan; Kariis, Hans; Bergström, David

    2017-10-01

    Polarimetric imaging sensors in the electro-optical region, already military and commercially available in both the visual and infrared, show enhanced capabilities for advanced target detection and recognition. The capabilities arise due to the ability to discriminate between man-made and natural background surfaces using the polarization information of light. In the development of materials for signature management in the visible and infrared wavelength regions, different criteria need to be met to fulfil the requirements for a good camouflage against modern sensors. In conventional camouflage design, the aimed design of the surface properties of an object is to spectrally match or adapt it to a background and thereby minimizing the contrast given by a specific threat sensor. Examples will be shown from measurements of some relevant materials and how they in different ways affect the polarimetric signature. Dimensioning properties relevant in an optical camouflage from a polarimetric perspective, such as degree of polarization, the viewing or incident angle, and amount of diffuse reflection, mainly in the infrared region, will be discussed.

  14. Round-the-table teaching: a novel approach to resuscitation education

    Science.gov (United States)

    McGarvey, Kathryn; Scott, Karen; O'Leary, Fenton

    2014-01-01

    Background Effective cardiopulmonary resuscitation saves lives. Health professionals who care for acutely unwell children need to be prepared to care for a child in arrest. Hospitals must ensure that their staff have the knowledge, confidence and ability to respond to a child in cardiac arrest. RESUS4KIDS is a programme designed to teach paediatric resuscitation to health care professionals who care for acutely unwell children. The programme is delivered in two components: an e–learning component for pre-learning, followed by a short, practical, face-to-face course that is taught using the round-the-table teaching approach. Context Round-the-table teaching is a novel, evidence-based small group teaching approach designed to teach paediatric resuscitation skills and knowledge. Round-the-table teaching uses a structured approach to managing a collapsed child, and ensures that each participant has the opportunity to practise the essential resuscitation skills of airway manoeuvres, bag mask ventilation and cardiac compressions. Innovation Round-the-table teaching is an engaging, non-threatening approach to delivering interdisciplinary paediatric resuscitation education. The methodology ensures that all participants have the opportunity to practise each of the different essential skills associated with the Danger, Response, Send for help, Airway, Breathing, Circulation, Defibrillation or rhythm recognition (DRSABCD) approach to the collapsed child. Implications Round-the-table teaching is based on evidence-based small group teaching methods. The methodology of round-the-table teaching can be applied to any topic where participants must demonstrate an understanding of a sequential approach to a clinical skill. Round-the-table teaching uses a structured approach to managing a collapsed child PMID:25212931

  15. AC propulsion system for an electric vehicle, phase 2

    Science.gov (United States)

    Slicker, J. M.

    1983-01-01

    A second-generation prototype ac propulsion system for a passenger electric vehicle was designed, fabricated, tested, installed in a modified Mercury Lynx vehicle and track tested at the Contractor's site. The system consisted of a Phase 2, 18.7 kw rated ac induction traction motor, a 192-volt, battery powered, pulse-width-modulated, transistorized inverter packaged for under rear seat installation, a 2-axis, 2-speed, automatically-shifted mechanical transaxle and a microprocessor-based powertrain/vehicle controller. A diagnostics computer to assist tuning and fault finding was fabricated. Dc-to-mechanical-system efficiency varied from 78% to 82% as axle speed/torque ranged from 159 rpm/788 nm to 65 rpm/328 nm. Track test efficiency results suggest that the ac system will be equal or superior to dc systems when driving urban cycles. Additional short-term work is being performed under a third contract phase (AC-3) to raise transaxle efficiency to predicted levels, and to improve starting and shifting characteristics. However, the long-term challenge to the system's viability remains inverter cost. A final report on the Phase 2 system, describing Phase 3 modifications, will be issued at the conclusion of AC-3.

  16. Aragonite coating solutions (ACS) based on artificial seawater

    Science.gov (United States)

    Tas, A. Cuneyt

    2015-03-01

    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  17. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  18. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  19. 29 CFR 1915.118 - Tables.

    Science.gov (United States)

    2010-07-01

    ...) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Gear and Equipment for Rigging and Materials Handling § 1915.118 Tables. The provisions of this section apply to ship repairing, shipbuilding and... diameter, inches Number of clips Drop forged Other material Minimum spacing, inches (1) 1/2 3 4 3 5/8 3 4...

  20. Multi-Touch Tables and Collaborative Learning

    Science.gov (United States)

    Higgins, Steve; Mercier, Emma; Burd, Liz; Joyce-Gibbons, Andrew

    2012-01-01

    The development of multi-touch tables, an emerging technology for classroom learning, offers valuable opportunities to explore how its features can be designed to support effective collaboration in schools. In this study, small groups of 10- to 11-year-old children undertook a history task where they had to connect various pieces of information…

  1. Normal yield tables for red alder.

    Science.gov (United States)

    Norman P. Worthington; Floyd A. Johnson; George R. Staebler; William J. Lloyd

    1960-01-01

    Increasing interest in the management of red alder (Alnus rubra) has created a need for reliable yield information. Existing yield tables for red alder have been very useful as interim sources of information, but they are generally inadequate for current and prospective management needs. The advisory committee for the Station's Olympia...

  2. 3D virtual table in anatomy education

    DEFF Research Database (Denmark)

    Dahl, Mads Ronald; Simonsen, Eivind Ortind

    The ‘Anatomage’ is a 3D virtual human anatomy table, with touchscreen functionality, where it is possible to upload CT-scans and digital. Learning the human anatomy terminology requires time, a very good memory, anatomy atlas, books and lectures. Learning the 3 dimensional structure, connections...... and intersections can be supported by technology like the Anatomage....

  3. Symmetry in crystallography understanding the international tables

    CERN Document Server

    Radaelli, Paolo G

    2011-01-01

    A fresh approach to teaching crystallographic symmetry. Rather than being swamped by heavy algebraic notation, the reader is taken through a series of simple and beautiful examples from the visual arts, and taught how to analyse them employing the 'pictorial' diagrams used in the international tables of crystallography.

  4. The periodic table: icon and inspiration.

    Science.gov (United States)

    Poliakoff, Martyn; Tang, Samantha

    2015-03-13

    To start this discussion meeting on the new chemistry of the elements held on 12 May 2014, Martyn Poliakoff, Foreign Secretary of the Royal Society, was invited to give the opening remarks. As a chemist and a presenter of the popular online video channel 'The periodic table of videos', Martyn communicates his personal and professional interest in the elements to the public, who in turn use these videos both as an educational resource and for entertainment purposes. Ever since Mendeleev's first ideas for the periodic table were published in 1869, the table has continued to grow as new elements have been discovered, and it serves as both icon and inspiration; its form is now so well established that it is recognized the world over as a symbol for science. This paper highlights but a few of the varied forms that the table can take, such as an infographic, which can convey the shortage of certain elements with great impact. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  5. Ecological periodic tables for estuarine habitats

    Science.gov (United States)

    Southwood (1977; J Anim Ecol 46: 337-365) compared the situation in ecology to that in chemistry before the development of the periodic table when each fact, for example, the solubility or reactivity of a chemical element, had to be discovered independently and remembered in isol...

  6. Monthly tables of measurements. October 2000

    International Nuclear Information System (INIS)

    2000-10-01

    This report of the O.P.R.I. (Office of Protection against Ionizing Radiations) exposes the principal results concerning the routine monitoring of environmental radioactivity in France: atmospheric dusts, rainwater, surface water, underground water, sewage water, drinking water, food chain (milk, vegetables, fishes), sea water around nuclear sites and other sites. The activities of various radioisotopes are presented in tables. (N.C.)

  7. Trunnion Collar Removal Machine - Gap Analysis Table

    International Nuclear Information System (INIS)

    Johnson, M.

    2005-01-01

    The purpose of this document is to review the existing the trunnion collar removal machine against the ''Nuclear Safety Design Bases for License Application'' (NSDB) [Ref. 10] requirements and to identify codes and standards and supplemental requirements to meet these requirements. If these codes and standards can not fully meet these requirements then a ''gap'' is identified. These gaps will be identified here and addressed using the ''Trunnion Collar Removal Machine Design Development Plan'' [Ref. 15]. The codes and standards, supplemental requirements, and design development requirements for the trunnion collar removal machine are provided in the gap analysis table (Appendix A, Table 1). Because the trunnion collar removal machine is credited with performing functions important to safety (ITS) in the NSDB [Ref. 10], design basis requirements are applicable to ensure equipment is available and performs required safety functions when needed. The gap analysis table is used to identify design objectives and provide a means to satisfy safety requirements. To ensure that the trunnion collar removal machine performs required safety functions and meets performance criteria, this portion of the gap analysis tables supplies codes and standards sections and the supplemental requirements and identifies design development requirements, if needed

  8. Table-top diffuse optical imaging

    NARCIS (Netherlands)

    Sturgeon, K.A.; Bakker, L.P.

    2006-01-01

    This report describes the work done during a six months internshipat Philips Research for a Masters in Electronic and Electrical Engineering. An existing table-top tomography system for measuring lightin phantom breasts was restored. Updated software control and image reconstruction software was

  9. Round table discussion during session 2

    International Nuclear Information System (INIS)

    Mays, C.

    2004-01-01

    The round table discussions of the second session of the FSC Belgium Workshop addressed the following questions: - Do local stakeholders have, internally or externally, all the expertise they need in order to address the issues raised by radioactive waste management projects? - Do institutional stakeholders have all the expertise they need to take local impacts into account? - What kinds of expert input are sought and attained by the different stakeholders? - Were any formal methods used to aid local partnerships perform technology assessments? Or other types of assessment? - How to maintain the knowledge and expertise achieved by the stakeholders? Discussion took place after the plenary presentations, at tables grouping Belgian stakeholders and FSC delegates. As in Session I, most of the round table discussion focussed specifically on the experience of the local partnerships. Many insights were shared about the nature and role of expertise in complex decision making. They are summarised below, on the basis of the feedback provided to the plenary by each round table. Some of these insights can be generalised to other contexts. All in all, a profile emerged of the local partnerships as a unique and effective tool to deal with knowledge issues in managing risk. (author)

  10. Experiences with Interactive Multi-touch Tables

    NARCIS (Netherlands)

    Fikkert, F.W.; Hakvoort, M.; Hakvoort, M.C.; van der Vet, P.E.; Nijholt, Antinus; Nijholt, A.; Reidsma, D.; Reidsma, Dennis; Hondorp, G.H.W.

    2009-01-01

    Interactive multi-touch tables can be a powerful means of communication for collaborative work as well as an engaging environment for competition. Through enticing gameplay we have evaluated user experience on competitive gameplay, collaborative work and musical expression. In addition, we report on

  11. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Science.gov (United States)

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  12. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions

    Science.gov (United States)

    Lockerbie, N. A.; Tokmakov, K. V.

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m-1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain ratio

  13. Constraining radon backgrounds in LZ

    Science.gov (United States)

    Miller, E. H.; Busenitz, J.; Edberg, T. K.; Ghag, C.; Hall, C.; Leonard, R.; Lesko, K.; Liu, X.; Meng, Y.; Piepke, A.; Schnee, R. W.

    2018-01-01

    The LZ dark matter detector, like many other rare-event searches, will suffer from backgrounds due to the radioactive decay of radon daughters. In order to achieve its science goals, the concentration of radon within the xenon should not exceed 2 µBq/kg, or 20 mBq total within its 10 tonnes. The LZ collaboration is in the midst of a program to screen all significant components in contact with the xenon. The four institutions involved in this effort have begun sharing two cross-calibration sources to ensure consistent measurement results across multiple distinct devices. We present here five preliminary screening results, some mitigation strategies that will reduce the amount of radon produced by the most problematic components, and a summary of the current estimate of radon emanation throughout the detector. This best estimate totals < 17.3 mBq, sufficiently low to meet the detector's science goals.

  14. Superconducting shielded core reactor with reduced AC losses

    Science.gov (United States)

    Cha, Yung S.; Hull, John R.

    2006-04-04

    A superconducting shielded core reactor (SSCR) operates as a passive device for limiting excessive AC current in a circuit operating at a high power level under a fault condition such as shorting. The SSCR includes a ferromagnetic core which may be either closed or open (with an air gap) and extends into and through a superconducting tube or superconducting rings arranged in a stacked array. First and second series connected copper coils each disposed about a portion of the iron core are connected to the circuit to be protected and are respectively wound inside and outside of the superconducting tube or rings. A large impedance is inserted into the circuit by the core when the shielding capability of the superconducting arrangement is exceeded by the applied magnetic field generated by the two coils under a fault condition to limit the AC current in the circuit. The proposed SSCR also affords reduced AC loss compared to conventional SSCRs under continuous normal operation.

  15. AC Application of HTS Conductors in Highly Dynamic Electric Motors

    International Nuclear Information System (INIS)

    Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

    2006-01-01

    Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

  16. Reliability of emergency ac power systems at nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Battle, R E; Campbell, D J

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project.

  17. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  18. Objectives and status of development of AC600

    International Nuclear Information System (INIS)

    Zhao Chengkun

    1997-01-01

    AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

  19. Recurrent Security Gaps In 802.11ac Routers

    Directory of Open Access Journals (Sweden)

    Mohammed Farik

    2015-08-01

    Full Text Available Abstract In comparison to earlier IEEE 802.11 standard abgn routers todays popular 802.11ac standard routers have enhanced security. However 802.11ac router still has major security vulnerabilities. The novelty of this paper is that we not only highlight multiple security vulnerabilities in 802.11ac router technologies that still have not been secured since the earlier standards but also present some new ideas with solutions. We believe that our line of thoughts on security vulnerabilities gaps and on new solutions will provide network security researchers router manufacturers and network administrators with new disclosures to redesign even better security mechanisms in routers to counter attacks on networks via routers.

  20. DC and AC conductivity properties of bovine dentine hydroxyapatite (BDHA)

    Science.gov (United States)

    Dumludag, F.; Gunduz, O.; Kılıc, O.; Ekren, N.; Kalkandelen, C.; Ozbek, B.; Oktar, F. N.

    2017-12-01

    Bovine dentine bio-waste may be used as a potential natural source of hydroxyapatite (BDHA), thus extraction of bovine dentin hydroxyapatite (BDHA) from bio-waste is significantly important to fabricate in a simple, economically and environmentally preferable. DC and AC conductivity properties of BDHA were investigated depending on sintering temperature (1000ºC - 1300°C) in air and vacuum (<10-2 mbar) ambient at room temperature. DC conductivity measurements performed between -1 and 1 V. AC conductivity measurements performed in the frequency range of 40 Hz – 100 kHz. DC conductivity results showed that dc conductivity values of the BDHA decrease with increasing sintering temperature in air ambient. It is not observed remarkable/systematic behavior for ac conductivity depending on sintering temperature.

  1. Glucagon-like peptide-1 and the exenatide analogue AC3174 improve cardiac function, cardiac remodeling, and survival in rats with chronic heart failure

    Directory of Open Access Journals (Sweden)

    Polizzi Clara

    2010-11-01

    Full Text Available Abstract Background Accumulating evidence suggests glucagon-like peptide-1 (GLP-1 exerts cardioprotective effects in animal models of myocardial infarction (MI. We hypothesized that chronic treatment with GLP-1 or the exenatide analog AC3174 would improve cardiac function, cardiac remodeling, insulin sensitivity, and exercise capacity (EC in rats with MI-induced chronic heart failure (CHF caused by coronary artery ligation. Methods Two weeks post-MI, male Sprague-Dawley rats were treated with GLP-1 (2.5 or 25 pmol/kg/min, AC3174 (1.7 or 5 pmol/kg/min or vehicle via subcutaneous infusion for 11 weeks. Cardiac function and morphology were assessed by echocardiography during treatment. Metabolic, hemodynamic, exercise-capacity, and body composition measurements were made at study end. Results Compared with vehicle-treated rats with CHF, GLP-1 or AC3174 significantly improved cardiac function, including left ventricular (LV ejection fraction, and end diastolic pressure. Cardiac dimensions also improved as evidenced by reduced LV end diastolic and systolic volumes and reduced left atrial volume. Vehicle-treated CHF rats exhibited fasting hyperglycemia and hyperinsulinemia. In contrast, GLP-1 or AC3174 normalized fasting plasma insulin and glucose levels. GLP-1 or AC3174 also significantly reduced body fat and fluid mass and improved exercise capacity and respiratory efficiency. Four of 16 vehicle control CHF rats died during the study compared with 1 of 44 rats treated with GLP-1 or AC3174. The cellular mechanism by which GLP-1 or AC3174 exert cardioprotective effects appears unrelated to changes in GLUT1 or GLUT4 translocation or expression. Conclusions Chronic treatment with either GLP-1 or AC3174 showed promising cardioprotective effects in a rat model of CHF. Hence, GLP-1 receptor agonists may represent a novel approach for the treatment of patients with CHF or cardiovascular disease associated with type 2 diabetes.

  2. Hybrid AC-High Voltage DC Grid Stability and Controls

    Science.gov (United States)

    Yu, Jicheng

    The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

  3. From the Mendeleev periodic table to particle physics and back to the periodic table

    International Nuclear Information System (INIS)

    Kibler, Maurice R.

    2006-11-01

    We briefly describe in this paper the passage from Mendeleev's chemistry (1869) to atomic physics (in the 1900's), nuclear physics (in the 1932's) and particle physics (from 1953 to 2006). We show how the consideration of symmetries, largely used in physics since the end of the 1920's, gave rise to a new format of the periodic table in the 1970's. More specifically, this paper is concerned with the application of the group SO(4,2)xSU(2) to the periodic table of chemical elements. It is shown how the Madelung rule of the atomic shell model can be used for setting up a periodic table that can be further rationalized via the group SO(4,2)xSU(2) and some of its subgroups. Qualitative results are obtained from this nonstandard table. (author)

  4. From the Mendeleev periodic table to particle physics and back to the periodic table

    Energy Technology Data Exchange (ETDEWEB)

    Kibler, Maurice R. [Universite de Lyon, Institut de Physique Nucleaire, Universite Lyon 1 and CNRS/IN2P3, 43 Bd du 11 Novembre 1918, F-69622 Villeurbanne Cedex (France)

    2006-11-15

    We briefly describe in this paper the passage from Mendeleev's chemistry (1869) to atomic physics (in the 1900's), nuclear physics (in the 1932's) and particle physics (from 1953 to 2006). We show how the consideration of symmetries, largely used in physics since the end of the 1920's, gave rise to a new format of the periodic table in the 1970's. More specifically, this paper is concerned with the application of the group SO(4,2)xSU(2) to the periodic table of chemical elements. It is shown how the Madelung rule of the atomic shell model can be used for setting up a periodic table that can be further rationalized via the group SO(4,2)xSU(2) and some of its subgroups. Qualitative results are obtained from this nonstandard table. (author)

  5. Volume reduction of dry active waste by use of a waste sorting table at the Brunswick nuclear power plant

    International Nuclear Information System (INIS)

    Snead, P.B.

    1988-01-01

    Carolina Power and Light Company's Brunswick nuclear power plant has been using a National Nuclear Corporation Model WST-18 Waste Sorting Table to monitor and sort dry active waste for segregating uncontaminated material as a means of low-level waste volume reduction. The WST-18 features 18 large-area, solid scintillation detectors arranged in a 3 x 6 array underneath a sorting/monitoring surface that is shielded from background radiation. An 11-week study at Brunswick showed that the use of the waste sorting table resulted in dramatic improvements in both productivity (man-hours expended per cubic foot of waste processed) and monitoring quality over the previous hand-probe frisking method. Use of the sorting table since the study has confirmed its effectiveness in volume reduction. The waste sorting table paid for its operation in volume reduction savings alone, without accounting for the additional savings from recovering reusable items

  6. Active Power Regulation based on Droop for AC Microgrid

    DEFF Research Database (Denmark)

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes......In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed...

  7. EXT-II: a second generation advanced ac propulsion system

    Energy Technology Data Exchange (ETDEWEB)

    Bates, B.; Patil, P.B.; Ciccarelli, M.F.

    1986-01-01

    This paper discusses the characteristics of the concept and includes discussion of the system constraints, including traction battery constraints, and brief descriptions of the major subsystems being developed. The components discussed include: the system controller, dc to ac inverter, an internal permanent magnet ac motor and a two-speed automatic transmission with an integral final drive and differential. The motor and transmission are on a common axis and are integrated into one compact unit that is integral with the rear axle of the vehicle.

  8. Productos «Celotex» para acondicionamientos Acústicos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-02-01

    Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.

  9. Patient Adviser What to Do About AC Joint Injuries.

    Science.gov (United States)

    Johnson, R J

    2001-11-01

    The muscles, joints, and bones of the shoulders form a base of support that allows your arms to swing, lift, or throw (figure 1). One of these bones, the collarbone, is also called the clavicle. Above your arm is an extension of the shoulder blade called the acromion. Where these two bones meet at the top of the shoulder is the acromioclavicular (AC) joint. The AC joint is not the shoulder joint. The shoulder joint is where the bone of the upper arm (humerus) meets a shallow socket that is also part of the shoulder blade.

  10. The ac propulsion system for an electric vehicle, phase 1

    Science.gov (United States)

    Geppert, S.

    1981-01-01

    A functional prototype of an electric vehicle ac propulsion system was built consisting of a 18.65 kW rated ac induction traction motor, pulse width modulated (PWM) transistorized inverter, two speed mechanically shifted automatic transmission, and an overall drive/vehicle controller. Design developmental steps, and test results of individual components and the complex system on an instrumented test frame are described. Computer models were developed for the inverter, motor and a representative vehicle. A preliminary reliability model and failure modes effects analysis are given.

  11. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using...

  12. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung

    2005-01-01

    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  13. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  14. The Background of Politeness Universals

    Directory of Open Access Journals (Sweden)

    Ставрос Ассимакопулос

    2014-12-01

    Full Text Available Early accounts of politeness have been widely criticised for adopting a universalist stance while attempting to account for a phenomenon that is clearly culture-dependent. In reaction to this criticism, Leech (2007/2014 has argued for the necessity of politeness universals, on condition that they allow for the investigation of the relevant cultural variation. This paper sets out to provide additional support for Leech’s claim, by pursuing the argument that even though different societies have in principle different politeness values, all members of the same cultural and/or linguistic group typically accept very similar sets of such values. This argument is theoretically supported by resort to Searle’s notion of the Background, as a body of preintentional mental capacities that safeguards the alignment of our intentional states with that of our peers. Given then the systematicity with which we develop a culturally uniform understanding of politeness, the postulation of politeness universals, in Leech’s sense, cannot but be a useful analytical tool when theorising about politeness.

  15. Natural background radiation in Jordan

    International Nuclear Information System (INIS)

    Daoud, M.N.S.

    1997-01-01

    An Airborne Gamma Ray survey has been accomplished for Jordan since 1979. A complete report has been submitted to the Natural Resources Authority along with field and processed data ''digital and analogue''. Natural radioelements concentration is not provided with this report. From the corrected count rate data for each natural radioelement, Concentrations and exposure rates at the ground level were calculated. Contoured maps, showing the exposure rates and the dose rates were created. Both maps reflect the surface geology of Jordan, where the Phosphate areas are very well delineated by high-level contours. In southeastern Jordan the Ordovician sandstone, which contain high percentage of Th (around 2000 ppm in some places) and a moderate percentage of U (about 300 ppm), also show high gamma radiation exposures compared with the surrounding areas. Comparing the values of the exposure rates given in (μR/h) to those obtained from other countries such as United States, Canada, Germany, etc. Jordan shows higher background radiation which reach two folds and even more than those in these countries. More detailed studies should be performed in order to evaluate the radiological risk limits on people who are living in areas of high radiation such that the area of the phosphatic belt which covers a vast area of Jordan high Plateau. (author)

  16. Concerning background from calorimeter ports

    International Nuclear Information System (INIS)

    Digiacomo, N.J.

    1985-01-01

    Any detector system viewing a port or slit in a calorimeter wall will see, in addition to the primary particles of interest, a background of charged and neutral particles and photons generated by scattering from the port walls and by leakage from incompletely contained primary particle showers in the calorimeter near the port. The signal to noise ratio attainable outside the port is a complex function of the primary source spectrum, the calorimeter and port design and, of course, the nature and acceptance of the detector system that views the port. Rather than making general statements about the overall suitability (or lack thereof) of calorimeter ports, we offer here a specific example based on the external spectrometer and slit of the NA34 experiment. This combination of slit and spectrometer is designed for fixed-target work, so that the primary particle momentum spectrum contains higher momentum particles than expected in a heavy ion colliding beam environment. The results are, nevertheless, quite relevant for the collider case

  17. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  18. BOOK REVIEW: The Cosmic Microwave Background The Cosmic Microwave Background

    Science.gov (United States)

    Coles, Peter

    2009-08-01

    With the successful launch of the European Space Agency's Planck satellite earlier this year the cosmic microwave background (CMB) is once again the centre of attention for cosmologists around the globe. Since its accidental discovery in 1964 by Arno Penzias and Robert Wilson, this relic of the Big Bang has been subjected to intense scrutiny by generation after generation of experiments and has gradually yielded up answers to the deepest questions about the origin of our Universe. Most recently, the Wilkinson Microwave Anisotropy Probe (WMAP) has made a full-sky analysis of the pattern of temperature and polarization variations that helped establish a new standard cosmological model, confirmed the existence of dark matter and dark energy, and provided strong evidence that there was an epoch of primordial inflation. Ruth Durrer's book reflects the importance of the CMB for future developments in this field. Aimed at graduate students and established researchers, it consists of a basic introduction to cosmology and the theory of primordial perturbations followed by a detailed explanation of how these manifest themselves as measurable variations in the present-day radiation field. It then focuses on the statistical methods needed to obtain accurate estimates of the parameters of the standard cosmological model, and finishes with a discussion of the effect of gravitational lensing on the CMB and on the evolution of its spectrum. The book apparently grew out of various lecture notes on CMB anisotropies for graduate courses given by the author. Its level and scope are well matched to the needs of such an audience and the presentation is clear and well-organized. I am sure that this book will be a useful reference for more senior scientists too. If I have a criticism, it is not about what is in the book but what is omitted. In my view, one of the most exciting possibilities for future CMB missions, including Planck, is the possibility that they might discover physics

  19. The impact of personal background and school contextual factors on academic competence and mental health functioning across the primary-secondary school transition.

    Directory of Open Access Journals (Sweden)

    Sharmila Vaz

    Full Text Available Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC and mental health functioning (MHF of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.

  20. The impact of personal background and school contextual factors on academic competence and mental health functioning across the primary-secondary school transition.

    Science.gov (United States)

    Vaz, Sharmila; Parsons, Richard; Falkmer, Torbjörn; Passmore, Anne Elizabeth; Falkmer, Marita

    2014-01-01

    Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC) and mental health functioning (MHF) of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.