WorldWideScience

Sample records for ac amplifiers

  1. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  2. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  3. A low-noise ac-bridge amplifier for ballistocardiogram measurement on an electronic weighing scale

    International Nuclear Information System (INIS)

    Ballistocardiography is a non-invasive technique for evaluating cardiovascular health. This note presents an ac-bridge amplifier for low-noise ballistocardiogram (BCG) recording from a modified weighing scale. The strain gauges in a commercial scale were excited by an ac source—square or sine wave—and the differential output voltage resulting from the BCG was amplified and demodulated synchronously with the excitation waveform. A standard BCG amplifier, with a simple dc-bridge excitation, was also built and the performance was compared to both the square- and sine-wave excited ac-bridge amplifiers. The total input-referred voltage noise (rms) integrated over the relevant BCG bandwidth of 0.3–10 Hz was found to be 30 nV (square wave source) or 25 nV (sine-wave source) for the ac-bridge amplifier and 52 nV for the standard amplifier: an improvement of 4.8 dB or 6 dB, respectively. These correspond to input-referred force noise (rms) values of 5 mN, 4 mN and 8.3 mN. The improvement in SNR was also observed in recorded waveforms from a seated subject whose BCG signal was measured with both dc- and ac-bridge circuits. (note)

  4. High power switch mode linear amplifiers for flexible ac transmission system

    Energy Technology Data Exchange (ETDEWEB)

    Mwinyiwiwa, B.; Wolanski, Z.; Ooi, B.T. [McGill Univ., Montreal, Quebec (Canada). Dept. of Electrical Engineering

    1996-10-01

    The Pulse Width Modulation (PWM) technique has been proposed for the force-commutated Shunt and Series VAR Controllers and Unified Power Flow Controllers in Flexible AC Transmission Systems. The PWM converters can be operated as linear amplifiers of constant gain so that treasure trove of linear control system theory can be brought to bear more easily when applying feedback controls. For example, pole-placement and active filtering have been successfully applied in laboratory models. This paper is written as a tutorial describing the stages of signal processing: modulation, amplification and demodulation, without reference to power electronics since the solid-state switches are modelled as ON-OFF switches.

  5. Single conversion audio amplifier and DC-AC converters with high performance and low complexity control scheme

    DEFF Research Database (Denmark)

    Poulsen, Søren; Andersen, Michael Andreas E.

    2004-01-01

    This paper proposes a novel control topology for a mains isolated single conversion audio amplifier and DC-AC converters. The topology is made for use in audio applications, and differs from prior art in terms of significantly reduced distortion as well as lower system complexity. The topology can...

  6. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Science.gov (United States)

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  7. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Science.gov (United States)

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  8. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions

    Science.gov (United States)

    Lockerbie, N. A.; Tokmakov, K. V.

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m-1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain ratio

  9. Fast switching, modular high-voltage DC/AC-power supplies for RF-Amplifiers and other applications

    International Nuclear Information System (INIS)

    A new kind of high voltage high-power Pulse-Step Modulator (PSM) for broadcast transmitters, accelerator sources, for NBI (Neutral Beam Injection for Plasma Heating), gyrotrons and klystrons has been developed. Since its first introduction in 1984 for broadcast transmitters, more than 100 high-power sound broadcast transmitters had been equipped with the first generation of the PSM modulators, using Gate Turn-Off Thyristors (GTOs) as switching elements. Recently, due to faster switching elements and making use of the latest DSP technologies (Digital Signal Processing), the performance data and areas of application could be extended further. In 1994, a precision high voltage source for MW gyrotrons was installed at CRPP in Lausanne. Supplementary very low cost solutions for lower powers but high voltages had been developed. Hence, today, a large area of applications can be satisfied with the family of solutions. The paper describes the principle of operation, the related control systems and refers to some particular applications of the PSM amplifiers, especially the newest developments and corresponding field results

  10. A wideband dc-coupled amplifier

    International Nuclear Information System (INIS)

    A method is described whereby an ac-coupled high-frequency amplifier and a dc-coupled low-frequency amplifier are connected in parallel in order to obtain a dc-coupled wideband amplifier. By using an operational amplifier which compares the output voltage with the input voltage, the low-frequency amplifier contributes to the overall gain only when the gain of the ac-coupled amplifier droops at low frequencies. Thus, no frequency splitting networks are necessary and the excellent low-frequency features of an operational amplifier are added to those of the ac-coupled wideband amplifier. As an example, a low noise amplifier is described which exhibits a hundredfold gain, a bandwidth from dc to 550 MHz, an input bias current of less than 1 nA, and an output voltage range of ±1 V

  11. Spontaneous emission from saturated parametric amplifiers

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Ott, Johan Raunkjær; Steffensen, Henrik;

    2009-01-01

    Noise performance of parametric amplifiers is typically calculated assuming un-depleted operation. However, in many applications especially when applied as regenerative amplifiers in systems based on phase shift keyed modulation schemes, this assumption is not valid. Here we show the impact on ac...... on accumulated spontaneous emission for a parametric amplifier operated in saturation....

  12. Operational amplifiers

    CERN Document Server

    Dostal, Jiri

    1993-01-01

    This book provides the reader with the practical knowledge necessary to select and use operational amplifier devices. It presents an extensive treatment of applications and a practically oriented, unified theory of operational circuits.Provides the reader with practical knowledge necessary to select and use operational amplifier devices. Presents an extensive treatment of applications and a practically oriented, unified theory of operational circuits

  13. Switching-mode Audio Power Amplifiers with Direct Energy Conversion

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2005-01-01

    This paper presents a new class of switching-mode audio power amplifiers, which are capable of direct energy conversion from the AC mains to the audio output. They represent an ultimate integration of a switching-mode power supply and a Class D audio power amplifier, where the intermediate DC bus...

  14. Gain ranging amplifier

    International Nuclear Information System (INIS)

    A gain ranging amplifier system is provided for use in the acquisition of data. Voltage offset compensation is utilized to correct errors in the gain ranging amplifier system caused by thermal drift and temperature dependent voltage offsets, both of which are associated with amplifiers in the gain ranging amplifier system

  15. Portable musical instrument amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Christian, David E. (Danbury, CT)

    1990-07-24

    The present invention relates to a musical instrument amplifier which is particularly useful for electric guitars. The amplifier has a rigid body for housing both the electronic system for amplifying and processing signals from the guitar and the system's power supply. An input plug connected to and projecting from the body is electrically coupled to the signal amplifying and processing system. When the plug is inserted into an output jack for an electric guitar, the body is rigidly carried by the guitar, and the guitar is operatively connected to the electrical amplifying and signal processing system without use of a loose interconnection cable. The amplifier is provided with an output jack, into which headphones are plugged to receive amplified signals from the guitar. By eliminating the conventional interconnection cable, the amplifier of the present invention can be used by musicians with increased flexibility and greater freedom of movement.

  16. High voltage distributed amplifier

    Science.gov (United States)

    Willems, D.; Bahl, I.; Wirsing, K.

    1991-12-01

    A high-voltage distributed amplifier implemented in GaAs MMIC technology has demonstrated good circuit performance over at least two octave bandwidth. This technique allows for very broadband amplifier operation with good efficiency in satellite, active-aperture radar, and battery-powered systems. Also, by increasing the number of FETs, the amplifier can be designed to match different voltage rails. The circuit does require a small amount of additional chip size over conventional distributed amplifiers but does not require power dividers or additional matching networks. This circuit configuration should find great use in broadband power amplifier design.

  17. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  18. Oscillators and operational amplifiers

    DEFF Research Database (Denmark)

    Lindberg, Erik

    2005-01-01

    A generalized approach to the design of oscillators using operational amplifiers as active elements is presented. A piecewise-linear model of the amplifier is used so that it make sense to investigate the eigenvalues of the Jacobian of the differential equations. The characteristic equation...... of the general circuit is derived. The dynamic nonlinear transfer characteristic of the amplifier is investigated. Examples of negative resistance oscillators are discussed....

  19. Single conversion stage amplifier - SICAM

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.

    2005-12-15

    This Ph.D. thesis presents a thorough analysis of the so called SICAM - SIngle Converter stage AMplifier approach to building direct energy conversion audio power amplifiers. The mainstream approach for building isolated audio power amplifiers today consists of isolated DC power supply and Class D amplifier, which essentially represents a two stage solution, where each of the components can be viewed as separate and independent part. The proposed SICAM solution strives for direct energy conversion from the mains to the audio output, by dedicating the operation of the components one to another and integrating their functions, so that the final audio power amplifier represents a single-stage topology with higher efficiency, lower volume, less board space, lower component count and subsequently lower cost. The SICAM approach is both applicable to non-isolated and isolated audio power amplifiers, but the problems encountered in these two cases are different. Non-isolated SICAM solutions are intended for both AC mains-connected and battery-powered devices. In non-isolated mains-connected SICAMs the main idea is to simplify the power supply or even provide integrated power factor correction (PFC) functions, while still maintaining low component stress and good audio performance by generally decreasing the input voltage level to the Class D audio power amplifier. On the other hand, non-isolated battery-powered SICAMs have to cope with the ever changing battery voltage and provide output voltage levels which are both lower and higher than the battery voltage, while still being simple and single-stage energy conversion solutions. In isolated SICAMs the isolation transformer adjusts the voltage level on the secondary side to the desired level, so the main challenges here are decreasing the size of the magnetic core and reducing the number and size of bulky reactive components as much as possible. The main focus of this thesis is directed towards the isolated SICAMs and

  20. Electrospun Amplified Fiber Optics

    OpenAIRE

    Morello, Giovanni; Camposeo, Andrea; Moffa, Maria; Pisignano, Dario

    2015-01-01

    A lot of research is focused on all-optical signal processing, aiming to obtain effective alternatives to existing data transmission platforms. Amplification of light in fiber optics, such as in Erbium-doped fiber amplifiers, is especially important for an efficient signal transmission. However, the complex fabrication methods, involving high-temperature processes performed in highly pure environment, slow down the fabrication and make amplified components expensive with respect to an ideal, ...

  1. RF Power Amplifier Analysis

    Directory of Open Access Journals (Sweden)

    M. Lokay

    1993-04-01

    Full Text Available The special program is presented for the demonstration of RF power transistor amplifiers for the purposes of the high-school education in courses of radio transmitters. The program is written in Turbo Pascal 6. 0 and enables to study the waveforms in selected points of the amplifier and to draw the trajectories of the working point in a plot of output transistor characteristics.

  2. Noise in Optical Amplifiers

    DEFF Research Database (Denmark)

    Jeppesen, Palle

    1997-01-01

    Noise in optical amplifiers is discussed on the basis of photons and electromagntic fields. Formulas for quantum noise from spontaneous emission, signal-spontaneous beat noise and spontaneous-spontaneous beat noise are derived.......Noise in optical amplifiers is discussed on the basis of photons and electromagntic fields. Formulas for quantum noise from spontaneous emission, signal-spontaneous beat noise and spontaneous-spontaneous beat noise are derived....

  3. A broadband dc SQUID based rf amplifier: experimental basics and development concept

    DEFF Research Database (Denmark)

    Prokopenko, G.V.; Shitov, S.V.; Mygind, Jesper

    2002-01-01

    We present a concept of a broadband IF amplifier based on experimental results obtained with a dc SQUID rf amplifier (SQA). The frequency range is broadened by using several SQAs, each one tuned to its own central frequency at both input and output; the numerical simulations are presented. A.......(C) 2002 Elsevier Science B.V. All rights reserved....

  4. Electrospun amplified fiber optics.

    Science.gov (United States)

    Morello, Giovanni; Camposeo, Andrea; Moffa, Maria; Pisignano, Dario

    2015-03-11

    All-optical signal processing is the focus of much research aiming to obtain effective alternatives to existing data transmission platforms. Amplification of light in fiber optics, such as in Erbium-doped fiber amplifiers, is especially important for efficient signal transmission. However, the complex fabrication methods involving high-temperature processes performed in a highly pure environment slow the fabrication process and make amplified components expensive with respect to an ideal, high-throughput, room temperature production. Here, we report on near-infrared polymer fiber amplifiers working over a band of ∼20 nm. The fibers are cheap, spun with a process entirely carried out at room temperature, and shown to have amplified spontaneous emission with good gain coefficients and low levels of optical losses (a few cm(-1)). The amplification process is favored by high fiber quality and low self-absorption. The found performance metrics appear to be suitable for short-distance operations, and the large variety of commercially available doping dyes might allow for effective multiwavelength operations by electrospun amplified fiber optics.

  5. A micropower electrocardiogram amplifier.

    Science.gov (United States)

    Fay, L; Misra, V; Sarpeshkar, R

    2009-10-01

    We introduce an electrocardiogram (EKG) preamplifier with a power consumption of 2.8 muW, 8.1 muVrms input-referred noise, and a common-mode rejection ratio of 90 dB. Compared to previously reported work, this amplifier represents a significant reduction in power with little compromise in signal quality. The improvement in performance may be attributed to many optimizations throughout the design including the use of subthreshold transistor operation to improve noise efficiency, gain-setting capacitors versus resistors, half-rail operation wherever possible, optimal power allocations among amplifier blocks, and the sizing of devices to improve matching and reduce noise. We envision that the micropower amplifier can be used as part of a wireless EKG monitoring system powered by rectified radio-frequency energy or other forms of energy harvesting like body vibration and body heat. PMID:23853270

  6. A vircator amplifier

    International Nuclear Information System (INIS)

    A cavity vircator has demonstrated that formation of a virtual cathode in a cavity can improve microwave production efficiency and narrow the radiation bandwidth. When the virtual cathode radiates the microwave fields grow from noise. For each cavity, there is only one or a limited number of allowable modes for a given frequency. In this paper, a novel device - a vircator amplifier is described. The device consists of a relativistic magnetron and a cavity vircator with both devices powered by a 1 MeV, 3 Ω, 65 ns FWHM pulser. The idea is to inject a signal from the magnetron before and during virtual cathode formation in a cavity. The injected signal should lock the frequency and enhance electron bunching and therefore improve efficiency further. Experiments underway to evaluate the amplifier operating characteristics are discussed. The applicability of vircator amplifiers to the next generation of high-power microwave devices are addressed

  7. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  8. Fourier plane image amplifier

    Science.gov (United States)

    Hackel, L.A.; Hermann, M.R.; Dane, C.B.; Tiszauer, D.H.

    1995-12-12

    A solid state laser is frequency tripled to 0.3 {micro}m. A small portion of the laser is split off and generates a Stokes seed in a low power oscillator. The low power output passes through a mask with the appropriate hole pattern. Meanwhile, the bulk of the laser output is focused into a larger stimulated Brillouin scattering (SBS) amplifier. The low power beam is directed through the same cell in the opposite direction. The majority of the amplification takes place at the focus which is the fourier transform plane of the mask image. The small holes occupy large area at the focus and thus are preferentially amplified. The amplified output is now imaged onto the multichip module where the holes are drilled. Because of the fourier plane amplifier, only about 1/10th the power of a competitive system is needed. This concept allows less expensive masks to be used in the process and requires much less laser power. 1 fig.

  9. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  10. A fully integrated neural recording amplifier with DC input stabilization.

    Science.gov (United States)

    Mohseni, Pedram; Najafi, Khalil

    2004-05-01

    This paper presents a low-power low-noise fully integrated bandpass operational amplifier for a variety of biomedical neural recording applications. A standard two-stage CMOS amplifier in a closed-loop resistive feedback configuration provides a stable ac gain of 39.3 dB at 1 kHz. A subthreshold PMOS input transistor is utilized to clamp the large and random dc open circuit potentials that normally exist at the electrode-electrolyte interface. The low cutoff frequency of the amplifier is programmable up to 50 Hz, while its high cutoff frequency is measured to be 9.1 kHz. The tolerable dc input range is measured to be at least +/- 0.25 V with a dc rejection factor of at least 29 dB. The amplifier occupies 0.107 mm2 in die area, and dissipates 115 microW from a 3 V power supply. The total measured input-referred noise voltage in the frequency range of 0.1-10 kHz is 7.8 microVrms. It is fabricated using AMI 1.5 microm double-poly double-metal n-well CMOS process. This paper presents full characterization of the dc, ac, and noise performance of this amplifier through in vitro measurements in saline using two different neural recording electrodes. PMID:15132510

  11. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  12. Helical Fiber Amplifier

    Science.gov (United States)

    Koplow, Jeffrey P.; Kliner, Dahy; Goldberg, Lew

    2002-12-17

    A multi-mode gain fiber is provided which affords substantial improvements in the maximum pulse energy, peak power handling capabilities, average output power, and/or pumping efficiency of fiber amplifier and laser sources while maintaining good beam quality (comparable to that of a conventional single-mode fiber source). These benefits are realized by coiling the multimode gain fiber to induce significant bend loss for all but the lowest-order mode(s).

  13. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  14. Electronic amplifiers for automatic compensators

    CERN Document Server

    Polonnikov, D Ye

    1965-01-01

    Electronic Amplifiers for Automatic Compensators presents the design and operation of electronic amplifiers for use in automatic control and measuring systems. This book is composed of eight chapters that consider the problems of constructing input and output circuits of amplifiers, suppression of interference and ensuring high sensitivity.This work begins with a survey of the operating principles of electronic amplifiers in automatic compensator systems. The succeeding chapters deal with circuit selection and the calculation and determination of the principal characteristics of amplifiers, as

  15. Simplified design of IC amplifiers

    CERN Document Server

    Lenk, John

    1996-01-01

    Simplified Design of IC Amplifiers has something for everyone involved in electronics. No matter what skill level, this book shows how to design and experiment with IC amplifiers. For experimenters, students, and serious hobbyists, this book provides sufficient information to design and build IC amplifier circuits from 'scratch'. For working engineers who design amplifier circuits or select IC amplifiers, the book provides a variety of circuit configurations to make designing easier.Provides basics for all phases of practical design.Covers the most popular forms for amplif

  16. Wideband amplifier design

    CERN Document Server

    Hollister, Allen L

    2007-01-01

    In this book, the theory needed to understand wideband amplifier design using the simplest models possible will be developed. This theory will be used to develop algebraic equations that describe particular circuits used in high frequency design so that the reader develops a ""gut level"" understanding of the process and circuit. SPICE and Genesys simulations will be performed to show the accuracy of the algebraic models. By looking at differences between the algebraic equations and the simulations, new algebraic models will be developed that include parameters originally left out of the model

  17. Building valve amplifiers

    CERN Document Server

    Jones, Morgan

    2013-01-01

    Building Valve Amplifiers is a unique hands-on guide for anyone working with tube audio equipment--as an electronics hobbyist, audiophile or audio engineer. This 2nd Edition builds on the success of the first with technology and technique revisions throughout and, significantly, a major new self-build project, worked through step-by-step, which puts into practice the principles and techniques introduced throughout the book. Particular attention has been paid to answering questions commonly asked by newcomers to the world of the valve, whether audio enthusiasts tackling their first build or

  18. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    Energy Technology Data Exchange (ETDEWEB)

    Guerra, A.S.; Laitano, R.F.; Petrocchi, A. [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

    1997-09-01

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  19. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    International Nuclear Information System (INIS)

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  20. Universal Signal Conditioning Amplifier

    Science.gov (United States)

    Kinney, Frank

    1997-01-01

    The Technological Research and Development Authority (TRDA) and NASA-KSC entered into a cooperative agreement in March of 1994 to achieve the utilization and commercialization of a technology development for benefiting both the Space Program and U.S. industry on a "dual-use basis". The technology involved in this transfer is a new, unique Universal Conditioning Amplifier (USCA) used in connection with various types of transducers. The project was initiated in partnership with I-Net Corporation, Lockheed Martin Telemetry & Instrumentation (formerly Loral Test and Information Systems) and Brevard Community College. The project consists of designing, miniaturizing, manufacturing, and testing an existing prototype of USCA that was developed for NASA-KSC by the I-Net Corporation. The USCA is a rugged and field-installable self (or remotely)- programmable amplifier that works in combination with a tag random access memory (RAM) attached to various types of transducers. This summary report comprises performance evaluations, TRDA partnership tasks, a project summary, project milestones and results.

  1. DIAMOND AMPLIFIED PHOTOCATHODES.

    Energy Technology Data Exchange (ETDEWEB)

    SMEDLEY,J.; BEN-ZVI, I.; BOHON, J.; CHANG, X.; GROVER, R.; ISAKOVIC, A.; RAO, T.; WU, Q.

    2007-11-26

    High-average-current linear electron accelerators require photoinjectors capable of delivering tens to hundreds of mA average current, with peak currents of hundreds of amps. Standard photocathodes face significant challenges in meeting these requirements, and often have short operational lifetimes in an accelerator environment. We report on recent progress toward development of secondary emission amplifiers for photocathodes, which are intended to increase the achievable average current while protecting the cathode from the accelerator. The amplifier is a thin diamond wafer which converts energetic (few keV) primary electrons into hundreds of electron-hole pairs via secondary electron emission. The electrons drift through the diamond under an external bias and are emitted into vacuum via a hydrogen-terminated surface with negative electron affinity (NEA). Secondary emission gain of over 200 has been achieved. Two methods of patterning diamond, laser ablation and reactive-ion etching (RIE), are being developed to produce the required geometry. A variety of diagnostic techniques, including FTIR, SEM and AFM, have been used to characterize the diamonds.

  2. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  3. Nanoscale electromechanical parametric amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Aleman, Benjamin Jose; Zettl, Alexander

    2016-09-20

    This disclosure provides systems, methods, and apparatus related to a parametric amplifier. In one aspect, a device includes an electron source electrode, a counter electrode, and a pumping electrode. The electron source electrode may include a conductive base and a flexible conductor. The flexible conductor may have a first end and a second end, with the second end of the flexible conductor being coupled to the conductive base. A cross-sectional dimension of the flexible conductor may be less than about 100 nanometers. The counter electrode may be disposed proximate the first end of the flexible conductor and spaced a first distance from the first end of the flexible conductor. The pumping electrode may be disposed proximate a length of the flexible conductor and spaced a second distance from the flexible conductor.

  4. A fast large dynamic range shaping amplifier for particle detector front-end

    Science.gov (United States)

    Rivetti, Angelo; Delaurenti, Paolo

    2007-03-01

    The paper describes a fast shaping amplifier with rail-to-rail output swing. The circuit is based on a CMOS operational amplifier with a class AB output stage. A baseline holder, incorporating a closed-loop unity gain buffer with slew rate limitation, performs the AC coupling with the preamplifier and guarantees a baseline shift smaller than 3 mV for unipolar output pulses of 3 V and 10 MHz rate.

  5. A fast large dynamic range shaping amplifier for particle detector front-end

    International Nuclear Information System (INIS)

    The paper describes a fast shaping amplifier with rail-to-rail output swing. The circuit is based on a CMOS operational amplifier with a class AB output stage. A baseline holder, incorporating a closed-loop unity gain buffer with slew rate limitation, performs the AC coupling with the preamplifier and guarantees a baseline shift smaller than 3 mV for unipolar output pulses of 3 V and 10 MHz rate

  6. Modeling of semiconductor optical amplifiers

    DEFF Research Database (Denmark)

    Mørk, Jesper; Bischoff, Svend; Berg, Tommy Winther;

    We discuss the modelling of semiconductor optical amplifiers with emphasis on their high-speed properties. Applications in linear amplification as well as ultrafast optical signal processing are reviewed. Finally, the possible role of quantum-dot based optical amplifiers is discussed.......We discuss the modelling of semiconductor optical amplifiers with emphasis on their high-speed properties. Applications in linear amplification as well as ultrafast optical signal processing are reviewed. Finally, the possible role of quantum-dot based optical amplifiers is discussed....

  7. A Low-Drift Solid-State d.c. Amplifier

    International Nuclear Information System (INIS)

    This paper describes a solid-state d.c. amplifier developed for low-level current measurement and discusses the design of this system consisting of a parametric modulator, a carrier oscillator, an a.c. amplifier, a demodulator, and an output amplifier. The parametric modulator employing silicon diodes is suitable for amplification of low -level d.c. current, since the input resistance is generally high and the conversion noise is small; In this system, base-emitter junctions of silicon planer transistors are used as parametric diodes, and the modulating frequency and amplitude chosen are 100 kc/s and 100 mV. A conversion gain of this modulator is about 90 dB in current. A crystal oscillator is employed for carrier generation. The a.c. amplifier consists of a directly-coupled a.c. amplifier whose transfer impedance is 1 x 108 Ω, a band-pass amplifier whose voltage gain is about 50 dB, and an emitter follower circuit. A normally connected transistor chopper as the demodulator is followed by a direct-coupled amplifier of low-output impedance hiving gain of 30 dB in order to provide wide dynamic range. Over-all d. c. negative feedback is provided by the feedback resistor. The complete system gives an open-loop transfer impedance of 3 x 1016 Ω and maximum output of ± 15 V. Current drift and voltage drift referred to input are less than 1 x 10-15 A and 0.2 mV respectively in the range of 10 - 35°C, and fluctuation or short-term drift is less than 2 x 10-16 A. This d.c. amplifier can be applied to the picoammeter, the log-N amplifier and various other scientific instruments. (author)

  8. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  9. AC1 Wing

    OpenAIRE

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  10. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  11. International Standardization Activities for Optical Amplifiers

    Institute of Scientific and Technical Information of China (English)

    Haruo Okamura

    2003-01-01

    International standardization activities for Optical Amplifiers at IECTC86 and ITU-T SG15 are reviewed. Current discussions include Optical Amplifier safety guideline, Reliability standard, Rest methods of Noise and PMD, Definitions of Raman amplifier parameters and OA classification.

  12. New Packaging for Amplifier Slabs

    Energy Technology Data Exchange (ETDEWEB)

    Riley, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thorsness, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Suratwala, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Steele, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rogowski, G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-03-18

    The following memo provides a discussion and detailed procedure for a new finished amplifier slab shipping and storage container. The new package is designed to maintain an environment of <5% RH to minimize weathering.

  13. TARC: Carlo Rubbia's Energy Amplifier

    CERN Multimedia

    Laurent Guiraud

    1997-01-01

    Transmutation by Adiabatic Resonance Crossing (TARC) is Carlo Rubbia's energy amplifier. This CERN experiment demonstrated that long-lived fission fragments, such as 99-TC, can be efficiently destroyed.

  14. A Transformer Class E Amplifier

    Directory of Open Access Journals (Sweden)

    Mikolajewski Miroslaw

    2014-12-01

    Full Text Available In a high-efficiency Class E ZVS resonant amplifier a matching and isolation transformer can replace some or even all inductive components of the amplifier thus simplifying the circuit and reducing its cost. In the paper a theoretical analysis, a design example and its experimental verification for a transformer Class E amplifier are presented. In the experimental amplifier with a transformer as the only inductive component in the circuit high efficiency ηMAX = 0.95 was achieved for supply voltage VI = 36 V, maximum output power POMAX = 100 W and the switching frequency f = 300 kHz. Measured parameters and waveforms showed a good agreement with theoretical predictions. Moreover, the relative bandwidth of the switching frequency was only 19% to obtain output power control from 4.8 W to POMAX with efficiency not less than 0.9 in the regulation range.

  15. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  16. A KIND OF NEW AMPLIFIER

    Institute of Scientific and Technical Information of China (English)

    YIN XUN-HE; FENG RU-PENG; REN YONG

    2000-01-01

    Chaotic characteristics in the iteration of logistic map (one-dimensional discrete dynamic system) are simulatedand analyzed. The circuit implementation of a kind of chaotic amplifier model is based on the chaotic characteristicsthat chaos is sensitively dependent on its initial conditions, and the circuit simulation result is given using simulationprogram with integrated circuit emphasis for personal computer (PSPICE), and is compared with linear amplifier.Advantages and disadvantages of such a model are indicated.

  17. Development of three channel linear bipolar high voltage amplifier (±2 KV) for electrostatic steerer

    International Nuclear Information System (INIS)

    Electrostatic steerers and scanners are planned for low energy ion beam facilities at IUAC to steer and scan the ion beam on target. The power supplies for electrostatic steerers are high voltage bipolar DC amplifiers and for scanners are bipolar AC amplifiers. To fulfil the requirements a common unit has been designed and assembled for AC and DC applications. It can be used with electrostatic devices in scanning, steering and sweeping of low energy ion beams at high frequencies to attain uniform implantation. The unit consist of three independent limited bandwidth high voltage, linear bipolar amplifiers (for X-axis, Y-axis and Y1-dog leg plates). The unit has been provided with both local and remote control. (author)

  18. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  19. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  20. Computer Aided Design and Analysis of a 2-4 GHz Broadband Balanced Microstrip Amplifier

    Directory of Open Access Journals (Sweden)

    S. H. Ibrahim

    2012-07-01

    Full Text Available In this paper, a computer-aided design and analysis of a 2-4 GHz broadband balanced microstrip amplifier using a full computer simulation program developed by the author and others is presented. A short and efficient CAD procedure for broadband amplifier design is introduced. The first step is to design an initial narrow-band high gain microstrip amplifier at 3-GHz central frequency. The second step is to optimize the initial lengths and widths of the input and output microstrip-matching circuits to get the broadband amplifier over the range 2-4 GHz. The analysis of both narrow and broadband amplifiers is investigated. In addition, with the design and analysis of a low-pass microstrip filter, the paper introduces the design and analysis of a Lange coupler. The final AC schematic diagram of the designed amplifier with the lengths and widths of microstrip lines is presented.Key Words: Computer-Aided Design and Analysis, Microstrip Amplifier, Microwave Amplifier.

  1. EMI-resilient amplifier circuits

    CERN Document Server

    van der Horst, Marcel J; Linnenbank, André C

    2014-01-01

    This book enables circuit designers to reduce the errors introduced by the fundamental limitations and electromagnetic interference (EMI) in negative-feedback amplifiers.  The authors describe a systematic design approach for application specific negative-feedback amplifiers, with specified signal-to-error ratio (SER).  This approach enables designers to calculate noise, bandwidth, EMI, and the required bias parameters of the transistors used in  application specific amplifiers in order to meet the SER requirements.   ·         Describes design methods that incorporate electromagnetic interference (EMI) in the design of application specific negative-feedback amplifiers; ·         Provides designers with a structured methodology to avoid the use of trial and error in meeting signal-to-error ratio (SER) requirements; ·         Equips designers to increase EMI immunity of the amplifier itself, thus avoiding filtering at the input, reducing the number of components and avoiding detr...

  2. Low-Noise Band-Pass Amplifier

    Science.gov (United States)

    Kleinberg, L.

    1982-01-01

    Circuit uses standard components to overcome common limitation of JFET amplifiers. Low-noise band-pass amplifier employs JFET and operational amplifier. High gain and band-pass characteristics are achieved with suitable choice of resistances and capacitances. Circuit should find use as low-noise amplifier, for example as first stage instrumentation systems.

  3. Gaussian amplifier for nuclear spectrometry

    International Nuclear Information System (INIS)

    One of the major goals of nuclear spectrometry is the determination of the energy spectrum of a radioactive source. To measure this spectrum with electronic instrumentation one need to use a nuclear spectrometry chain of which the amplifier is part of, and whose filter shaping considerably influences the final energy resolution achieved. The amplifier released accomplishes a 7th order Gaussian filter shape with Taylor series approximation synthesized by the Shifted Companion Form and mounted using only electronic components availablein Brazil. The final version has been tested and the results showed a very good performance and the energy resolution achieved was equivalent to the imported models. (Author)

  4. Hermetisk AC-Krets

    OpenAIRE

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  5. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  6. Dielectric waveguide amplifiers and lasers

    NARCIS (Netherlands)

    Pollnau, M.

    2014-01-01

    The performance of semiconductor amplifiers and lasers has made them the preferred choice for optical gain on a micro-chip. In the past few years, we have demonstrated that also rare-earth-ion-doped dielectric waveguides show remarkable performance, ranging from a small-signal gain per unit length o

  7. Thermal recovery of NIF amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Sutton, S.; Marshall, C.; Petty, C.; Smith, L.; van Wonterghem, B.; Mills, S.

    1997-02-01

    The issue of thermal recovery of the NIF amplifiers has taken on increased emphasis as program goals move toward increasing the shot rate to once every four hours. This paper addresses the technical issues associated with achieving thermal recovery in the NIF amplifiers. We identify two temperature related thermal recovery quantities: (1) the difference between the average slab temperature and the temperature of other surfaces in the amplifier cavity, and (2) the temperature difference in the slab over the aperture. The first quantity relates to optical disturbances in the gas column in the system, while the second quantity is associated with optical aberrations in the laser media itself. Calculations and experiments are used to quantify recovery criteria, and develop cooling approaches. The cooling approaches discussed are (1) active cooling of the flashlamps with ambient gas and chilled gas, and (2) active cooling of the slab edge cladding. Calculations indicate that the NIF baseline cooling approach of 20 cfm per lamp ambient temperature gas flow in both the central and side flashlamp cassettes is capable of meeting thermal recovery requirements for an 8 hour shot period, while to achieve a 4 hour shot period requires use of chilled gas and edge cladding cooling. In addition, the effect of changing the amplifier cavity and beamtube fill gas from nitrogen to helium is addressed, showing that a factor of 8 reduction in the sensitivity to thermal disturbances is possible. 6 refs., 9 figs., 1 tab.

  8. Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

    Directory of Open Access Journals (Sweden)

    Pijar Riza Anugerah

    2015-10-01

    Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A(NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

  9. Concurrent Electroencephalography Recording During Transcranial Alternating Current Stimulation (tACS).

    Science.gov (United States)

    Fehér, Kristoffer D; Morishima, Yosuke

    2016-01-01

    Oscillatory brain activities are considered to reflect the basis of rhythmic changes in transmission efficacy across brain networks and are assumed to integrate cognitive neural processes. Transcranial alternating current stimulation (tACS) holds the promise to elucidate the causal link between specific frequencies of oscillatory brain activity and cognitive processes. Simultaneous electroencephalography (EEG) recording during tACS would offer an opportunity to directly explore immediate neurophysiological effects of tACS. However, it is not trivial to measure EEG signals during tACS, as tACS creates a huge artifact in EEG data. Here we explain how to set up concurrent tACS-EEG experiments. Two necessary considerations for successful EEG recording while applying tACS are highlighted. First, bridging of the tACS and EEG electrodes via leaking EEG gel immediately saturates the EEG amplifier. To avoid bridging via gel, the viscosity of the EEG gel is the most important parameter. The EEG gel must be viscous to avoid bridging, but at the same time sufficiently fluid to create contact between the tACS electrode and the scalp. Second, due to the large amplitude of the tACS artifact, it is important to consider using an EEG system with a high resolution analog-to-digital (A/D) converter. In particular, the magnitude of the tACS artifact can exceed 100 mV at the vicinity of a stimulation electrode when 1 mA tACS is applied. The resolution of the A/D converter is of importance to measure good quality EEG data from the vicinity of the stimulation site. By following these guidelines for the procedures and technical considerations, successful concurrent EEG recording during tACS will be realized. PMID:26862814

  10. DOUBLE-BOOST DC-AC CONVERTER WITH SLIDING-MODE CONTROL FOR PORTABLE AUDIO

    DEFF Research Database (Denmark)

    Bolten Maizonave, Gert; Andersen, Michael Andreas E.; Kjærgaard, Claus;

    2009-01-01

    The double-boost topology is studied for operation as a dc-ac converter and single stage audio amplifier. A sliding-mode controller is designed in order to achieve fast enough response for the whole audio frequency range. Symmetric, asymmetric and interleaved operation modes are analyzed....

  11. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  12. High-speed thyristor power amplifier control for the JT-60 poloidal field

    International Nuclear Information System (INIS)

    In undertaking basic research into a high power thyristor amplifier system for the JT-60, we have developed direct computer control employing modern control theory, and have experimented on a small model system. This paper describes how to attain the required high speed and accuracy and the hardware. To simulate the actual system, a model system composed of a flywheel driven a-c generator, a computer-controlled thyristor amplifier and three coupled magnetic field coils was used. From the experimental results, 0.2% static accuracy, 0.5% dynamic accuracy and 3 msec control delay were obtained. (author)

  13. Design and implementation of a wireless (Bluetooth) four channel bio-instrumentation amplifier and digital data acquisition device with user-selectable gain, frequency, and driven reference.

    Science.gov (United States)

    Cosmanescu, Alin; Miller, Benjamin; Magno, Terence; Ahmed, Assad; Kremenic, Ian

    2006-01-01

    A portable, multi-purpose Bio-instrumentation Amplifier and Data AcQuisition device (BADAQ) capable of measuring and transmitting EMG and EKG signals wirelessly via Bluetooth is designed and implemented. Common topologies for instrumentation amplifiers and filters are used and realized with commercially available, low-voltage, high precision operational amplifiers. An 8-bit PIC microcontroller performs 10-bit analog-to-digital conversion of the amplified and filtered signals and controls a Bluetooth transceiver capable of wirelessly transmitting the data to any Bluetooth enabled device. Electrical isolation between patient/subject, circuitry, and ancillary equipment is achieved by optocoupling components. The design focuses on simplicity, portability, and affordability.

  14. Higher order mode optical fiber Raman amplifiers

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Friis, Søren Michael Mørk; Usuga Castaneda, Mario A.;

    2016-01-01

    We review higher order mode Raman amplifiers and discuss recent theoretical as well as experimental results including system demonstrations.......We review higher order mode Raman amplifiers and discuss recent theoretical as well as experimental results including system demonstrations....

  15. Analog circuit design designing high performance amplifiers

    CERN Document Server

    Feucht, Dennis

    2010-01-01

    The third volume Designing High Performance Amplifiers applies the concepts from the first two volumes. It is an advanced treatment of amplifier design/analysis emphasizing both wideband and precision amplification.

  16. Challenges in higher order mode Raman amplifiers

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Nielsen, Kristian; Friis, Søren Michael Mørk;

    2015-01-01

    A higher order Raman amplifier model that take random mode coupling into account ispresented. Mode dependent gain and signal power fluctuations at the output of the higher order modeRaman amplifier are discussed...

  17. Quantum Theory of Laser Amplifiers.

    Science.gov (United States)

    Mander, Gillian Linda

    Available from UMI in association with The British Library. Requires signed TDF. We calculate the input-output characteristics of a below threshold laser amplifier. Expressions are derived for the output second- and fourth-order spectral and temporal correlation functions in terms of the corresponding input quantities, and for the photocount first and second factorial moments for both homodyne and direct detection. The general results are applied to several cases of practical interest, including specific non-classical input states. We show that a maximum of twofold amplification is permitted if squeezing in the input is to survive at the output. Similarly, for preservation of photon antibunching in amplification we show that only very small gains are allowed. The model treated here provides a detailed example of the amplifier noise limitations imposed by quantum mechanics. In particular, we show that minimum noise occurs in a cavity that is asymmetric with respect to the mirror reflectivities. The latter part of this work treats the above threshold laser amplifier. The laser output is back-scattered from a moving target to provide a weak Doppler-shifted signal which re-enters the laser cavity and is amplified. We show that the three-level atomic lasing medium is equivalent to a two-level medium pumped by an inverted bath. We use the methods of quantum statistical analysis to obtain time -evolution equations for the c-number amplitudes of the laser and signal fields. We show that the results may be applied to the below threshold regime for appropriate values of the pump parameter. By considering the amplitude differential gain we show explicitly that the behaviour of the laser around threshold is characteristic of a second -order phase transition. We calculate the output intensity gain appropriate to a heterodyne detection process, and find good agreement between the predicted gain profiles and measured data for both carbon dioxide and argon-ion lasers.

  18. 338-GHz Semiconductor Amplifier Module

    Science.gov (United States)

    Samoska, Lorene A.; Gaier, Todd C.; Soria, Mary M.; Fung, King Man; Rasisic, Vesna; Deal, William; Leong, Kevin; Mei, Xiao Bing; Yoshida, Wayne; Liu, Po-Hsin; Uyeda, Jansen; Lai, Richard

    2010-01-01

    Research findings were reported from an investigation of new gallium nitride (GaN) monolithic millimeter-wave integrated circuit (MMIC) power amplifiers (PAs) targeting the highest output power and the highest efficiency for class-A operation in W-band (75-110 GHz). W-band PAs are a major component of many frequency multiplied submillimeter-wave LO signal sources. For spectrometer arrays, substantial W-band power is required due to the passive lossy frequency multipliers.

  19. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  20. High power regenerative laser amplifier

    Science.gov (United States)

    Miller, J.L.; Hackel, L.A.; Dane, C.B.; Zapata, L.E.

    1994-02-08

    A regenerative amplifier design capable of operating at high energy per pulse, for instance, from 20-100 Joules, at moderate repetition rates, for instance from 5-20 Hertz is provided. The laser amplifier comprises a gain medium and source of pump energy coupled with the gain medium; a Pockels cell, which rotates an incident beam in response to application of a control signal; an optical relay system defining a first relay plane near the gain medium and a second relay plane near the rotator; and a plurality of reflectors configured to define an optical path through the gain medium, optical relay and Pockels cell, such that each transit of the optical path includes at least one pass through the gain medium and only one pass through the Pockels cell. An input coupler, and an output coupler are provided, implemented by a single polarizer. A control circuit coupled to the Pockels cell generates the control signal in timed relationship with the input pulse so that the input pulse is captured by the input coupler and proceeds through at least one transit of the optical path, and then the control signal is applied to cause rotation of the pulse to a polarization reflected by the polarizer, after which the captured pulse passes through the gain medium at least once more and is reflected out of the optical path by the polarizer before passing through the rotator again to provide an amplified pulse. 7 figures.

  1. SPS RF System Amplifier plant

    CERN Multimedia

    1977-01-01

    The picture shows a 2 MW, 200 MHz amplifier plant with feeder lines. The main RF-system of the SPS comprises four cavities: two of 20 m length and two of 16.5 m length. They are all installed in one long straight section (LSS 3). These cavities are of the travelling-wave type operating at a centre frequency of 200.2 MHz. They are wideband, filling time about 700 ns and untuned. The power amplifiers, using tetrodes are installed in a surface building 200 m from the cavities. Initially only two cavities were installed, a third cavity was installed in 1978 and a forth one in 1979. The number of power amplifiers was also increased: to the first 2 MW plant a second 2 MW plant was added and by end 1979 there were 8 500 kW units combined in pairs to feed each of the 4 cavities with up to about 1 MW RF power, resulting in a total accelerating voltage of about 8 MV. See also 7412016X, 7412017X, 7411048X.

  2. Improved charge amplifier using hybrid hysteresis compensation

    Science.gov (United States)

    Amin-Shahidi, Darya; Trumper, David L.

    2013-08-01

    We present a novel charge amplifier, with a robust feedback circuit and a method for compensating piezoelectric actuator's hysteresis at low frequencies. The amplifier uses a modified feedback circuit which improves robustness to the addition of series load impedance such as in cabling. We also describe a hybrid hysteresis compensation method for enabling the charge amplifier to reduce hysteresis at low frequencies. Experimental results demonstrate the utility of the new amplifier design.

  3. European Research on THz Vacuum Amplifiers

    DEFF Research Database (Denmark)

    Brunetti, F.; Cojocarua, C.-S.; de Rossi, A.;

    2010-01-01

    The OPTHER (OPtically Driven TeraHertz AmplifiERs) project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within this project is a consolidation of efforts at the international level from the main players of the Eu...

  4. A High-performance Small Signal Amplifier

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    According to questions in the design of high quality small signal amplifier, this paper gave a new-type high performance small signal amplifier. The paper selected the operational amplifier of ICL Company and designed a new-type circuit with simple, low cost and excellent performance.

  5. Radio frequency amplifier with effective decoupling

    NARCIS (Netherlands)

    Besling, W.F.A.; Bakker, T.W.; Lamy, Y.; Kochupurackal, J.; Roozeboom, F.

    2011-01-01

    A variety of circuits, methods and devices are implemented for radiofrequency amplifiers. According to one such implementation, a radiofrequency amplifier circuit is implemented in a SMD package. The circuit amplifies a radiofrequency signal having a base-band portion and a plurality of carrier sign

  6. low pump power photonic crystal fibre amplifiers

    DEFF Research Database (Denmark)

    Hougaard, Kristian G.; Broeng, Jes; Bjarklev, Anders Overgaard

    2003-01-01

    Designs of low pump power optical amplifiers, based on photonic crystal fibres are presented. The potential of these fibre amplifiers is investigated, and it is demonstrated that such amplifiers may deliver gains of more than 15 dB at 1550 nm with less than 1 mW of optical pump power....

  7. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  8. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  9. Log amplifier with pole-zero compensation

    Science.gov (United States)

    Brookshier, William

    1987-01-01

    A logarithmic amplifier circuit provides pole-zero compensation for improved stability and response time over 6-8 decades of input signal frequency. The amplifier circuit includes a first operational amplifier with a first feedback loop which includes a second, inverting operational amplifier in a second feedback loop. The compensated output signal is provided by the second operational amplifier with the log elements, i.e., resistors, and the compensating capacitors in each of the feedback loops having equal values so that each break point or pole is offset by a compensating break point or zero.

  10. Semiconductor quantum-dot lasers and amplifiers

    DEFF Research Database (Denmark)

    Hvam, Jørn Märcher; Borri, Paola; Ledentsov, N. N.;

    2002-01-01

    -power surface emitting VCSELs. We investigated the ultrafast dynamics of quantum-dot semiconductor optical amplifiers. The dephasing time at room temperature of the ground-state transition in semiconductor quantum dots is around 250 fs in an unbiased amplifier, decreasing to below 50 fs when the amplifier...... is biased to positive net gain. We have further measured gain recovery times in quantum dot amplifiers that are significantly lower than in bulk and quantum-well semiconductor optical amplifiers. This is promising for future demonstration of quantum dot devices with high modulation bandwidth...

  11. HIGH AVERAGE POWER OPTICAL FEL AMPLIFIERS

    International Nuclear Information System (INIS)

    Historically, the first demonstration of the optical FEL was in an amplifier configuration at Stanford University [l]. There were other notable instances of amplifying a seed laser, such as the LLNL PALADIN amplifier [2] and the BNL ATF High-Gain Harmonic Generation FEL [3]. However, for the most part FELs are operated as oscillators or self amplified spontaneous emission devices. Yet, in wavelength regimes where a conventional laser seed can be used, the FEL can be used as an amplifier. One promising application is for very high average power generation, for instance FEL's with average power of 100 kW or more. The high electron beam power, high brightness and high efficiency that can be achieved with photoinjectors and superconducting Energy Recovery Linacs (ERL) combine well with the high-gain FEL amplifier to produce unprecedented average power FELs. This combination has a number of advantages. In particular, we show that for a given FEL power, an FEL amplifier can introduce lower energy spread in the beam as compared to a traditional oscillator. This properly gives the ERL based FEL amplifier a great wall-plug to optical power efficiency advantage. The optics for an amplifier is simple and compact. In addition to the general features of the high average power FEL amplifier, we will look at a 100 kW class FEL amplifier is being designed to operate on the 0.5 ampere Energy Recovery Linac which is under construction at Brookhaven National Laboratory's Collider-Accelerator Department

  12. High temperature charge amplifier for geothermal applications

    Science.gov (United States)

    Lindblom, Scott C.; Maldonado, Frank J.; Henfling, Joseph A.

    2015-12-08

    An amplifier circuit in a multi-chip module includes a charge to voltage converter circuit, a voltage amplifier a low pass filter and a voltage to current converter. The charge to voltage converter receives a signal representing an electrical charge and generates a voltage signal proportional to the input signal. The voltage amplifier receives the voltage signal from the charge to voltage converter, then amplifies the voltage signal by the gain factor to output an amplified voltage signal. The lowpass filter passes low frequency components of the amplified voltage signal and attenuates frequency components greater than a cutoff frequency. The voltage to current converter receives the output signal of the lowpass filter and converts the output signal to a current output signal; wherein an amplifier circuit output is selectable between the output signal of the lowpass filter and the current output signal.

  13. Audio power amplifier design handbook

    CERN Document Server

    Self, Douglas

    2013-01-01

    This book is essential for audio power amplifier designers and engineers for one simple reason...it enables you as a professional to develop reliable, high-performance circuits. The Author Douglas Self covers the major issues of distortion and linearity, power supplies, overload, DC-protection and reactive loading. He also tackles unusual forms of compensation and distortion produced by capacitors and fuses. This completely updated fifth edition includes four NEW chapters including one on The XD Principle, invented by the author, and used by Cambridge Audio. Cro

  14. Cathode-follower power amplifier

    International Nuclear Information System (INIS)

    In circular accelerators and particularly in storage rings it is essential that the total impedance, as seen by the beam, be kept below some critical value. A model of the accelerating system was built using a single-ended cathode-follower amplifier driving a ferrite-loaded cavity. The system operated at 234.5 kHz with a peak output voltage of +-10 kV on the gap. The dynamic output impedance, as measured on the gap, was < 15 ohms

  15. Operation Method for AC Motor Control during Power Interruption in Direct AC/AC Converter System

    Science.gov (United States)

    Shizu, Keiichiro; Azuma, Satoshi

    Direct AC/AC converters have been studied due to their potential use in power converters with no DC-link capacitor, which can contribute to the miniaturization of power converters. However, the absence of a DC-link capacitor makes it difficult to control the AC motor during power interruption. First, this paper proposes a system that realizes AC motor control during power interruption by utilizing a clamp capacitor. In general, direct AC/AC converters have a clamp circuit consisting of a rectifier diode(s) and a clamp capacitor in order to avoid over-voltages. In the proposed system, there is an additional semiconductor switch reverse-parallel to the rectifier diode(s), and the clamp capacitor voltage can be utilized for AC motor control by turning on the additional switch. Second, this paper discusses an operation method for AC motor control and clamp capacitor voltage control during power interruption. In the proposed method “DC-link voltage control”, the kinetic energy in the AC motor is transformed into electrical energy and stored in the clamp capacitor; the clamp capacitor is therefore charged and the capacitor voltage is controlled to remain constant at an instruction value. Third, this paper discusses a switching operation during power interruption. A dead-time is introduced between the operation of turning off all switches on the rectifier side and the operation of turning on the additional switch, which prevents the occurrence of a short circuit between the interrupted power source and the clamp capacitor. Finally, experimental results are presented. During power interruptions, an output current was continuously obtained and the clamp capacitor voltage was maintained to be equal to the instruction value of the capacitor voltage. These results indicate that both AC motor control and capacitor voltage control were successfully achieved by using the proposed system.

  16. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  17. YANG-MILLS FIELD AMPLIFIER

    Directory of Open Access Journals (Sweden)

    Trunev A. P.

    2015-09-01

    Full Text Available The article presents a project of the Yang-Mills amplifier. Amplifier model is a multilayer spherical shell with increasing density towards the center. In the center of the amplifier is the core of high-density material. It is shown that in such a system, the amplitude of the Yang-Mills waves rises from the periphery to the center of several orders of magnitude. The role of the Yang-Mills field in the processes occurring in the nuclei of galaxies, stars and planets is discussed. The data modeling to strengthen the Yang-Mills field in the bowels of the planet, with an atomic explosion, and in some special devices such as the voltaic pile. To describe the mechanism of amplification chromodynamics field used as accurate results in Yang-Mills theory and numerical models developed based on an average and the exact equations as well. Among the exact solutions of the special role played by the centralsymmetric metric describing the contribution of the Yang-Mills field in the speed of recession of galaxies. Among the approximate numerical models can be noted the eight-scalar model we have developed for the simulation of non-linear color oscillations and chaos in the Yang-Mills theory. Earlier models were investigated spatio-temporal oscillations of the YangMills theory in the case of three and eight colors. The results of numerical simulation show that the nonlinear interaction does not lead to a spatial mixing of colors as it might be in the case of turbulent diffusion. Depending on the system parameters there is a suppression of the amplitude of the oscillations the first three by five colors or vice versa. The kinetic energy fluctuations or shared equally between the color components, or dominated by the kinetic energy of repressed groups of colors. In the present study, we found that amplification chromodynamic field leads to a sharp increase in the amplitude of the suppressed color, which can lead to an increase in entropy, excitation of nuclear

  18. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  19. A low-noise transimpedance amplifier for the detection of "Violin-Mode" resonances in advanced Laser Interferometer Gravitational wave Observatory suspensions

    Science.gov (United States)

    Lockerbie, N. A.; Tokmakov, K. V.

    2014-11-01

    This paper describes the design and performance of an extremely low-noise differential transimpedance amplifier, which takes its two inputs from separate photodiodes. The amplifier was planned to serve as the front-end electronics for a highly sensitive shadow-displacement sensing system, aimed at detecting very low-level "Violin-Mode" (VM) oscillations in 0.4 mm diameter by 600 mm long fused-silica suspension fibres. Four such highly tensioned fibres support the 40 kg test-masses/mirrors of the Advanced Laser Interferometer Gravitational wave Observatory interferometers. This novel design of amplifier incorporates features which prevent "noise-gain peaking" arising from large area photodiode (and cable) capacitances, and which also usefully separate the DC and AC photocurrents coming from the photodiodes. In consequence, the differential amplifier was able to generate straightforwardly two DC outputs, one per photodiode, as well as a single high-gain output for monitoring the VM oscillations—this output being derived from the difference of the photodiodes' two, naturally anti-phase, AC photocurrents. Following a displacement calibration, the amplifier's final VM signal output was found to have an AC displacement responsivity at 500 Hz of (9.43 ± 1.20) MV(rms) m-1(rms), and, therefore, a shot-noise limited sensitivity to such AC shadow- (i.e., fibre-) displacements of (69 ± 13) picometres/√Hz at this frequency, over a measuring span of ±0.1 mm.

  20. Transverse pumped laser amplifier architecture

    Science.gov (United States)

    Bayramian, Andrew James; Manes, Kenneth; Deri, Robert; Erlandson, Al; Caird, John; Spaeth, Mary

    2013-07-09

    An optical gain architecture includes a pump source and a pump aperture. The architecture also includes a gain region including a gain element operable to amplify light at a laser wavelength. The gain region is characterized by a first side intersecting an optical path, a second side opposing the first side, a third side adjacent the first and second sides, and a fourth side opposing the third side. The architecture further includes a dichroic section disposed between the pump aperture and the first side of the gain region. The dichroic section is characterized by low reflectance at a pump wavelength and high reflectance at the laser wavelength. The architecture additionally includes a first cladding section proximate to the third side of the gain region and a second cladding section proximate to the fourth side of the gain region.

  1. Locoregional MYCN-amplified neuroblastoma.

    Science.gov (United States)

    Morales La Madrid, Andres; Volchenboum, Samuel; Gastier-Foster, Julie M; Pyatt, Robert; Liu, Don; Pytel, Peter; Lavarino, Cinzia; Rodriguez, Eva; Cohn, Susan L

    2012-10-01

    MYCN-amplification is strongly associated with other high-risk prognostic factors and poor outcome in neuroblastoma. Infrequently, amplification of MYCN has been identified in localized tumors with favorable biologic features. Outcome for these children is difficult to predict and optimal treatment strategies remain unclear. We report a 5-month-old who presented with an MYCN-amplified INSS stage 3, pelvic neuroblastoma. The tumor had favorable histology, hyperdiploidy, and lacked 1p36 and 11q23 aberrations. Although the patient met the criteria for high-risk neuroblastoma, because of the discordant prognostic markers we elected to treat her according to an intermediate-risk protocol. She remains event-free more than 18 months.

  2. Linearisation of RF Power Amplifiers

    DEFF Research Database (Denmark)

    Nielsen, Per Asbeck

    2001-01-01

    This thesis deals with linearisation techniques of RF power amplifiers (PA), PA design techniques and integration of the necessary building blocks in a CMOS technology. The opening chapters introduces the theory of transmitter architectures, RF-signal representation and the principles of digital...... of linearisation systems with focus on polar modulation feedback, and a chip oriented part focusing on integrating of separate building blocks of the system on a chip. The system oriented part of this thesis deals with analog feedback linearisation systems. The Polar modulation feedback system is compared...... that utilize properties of the polar loop are presented. Analysis of the envelope feedback loop shows some fundamental limitations of the loop gain and the loop bandwidth due to the varying PA gain. Based on these observation a set of design guidelines for an envelope feedback loop is given. The guidelines...

  3. Optical latches using optical amplifiers

    Science.gov (United States)

    Li, Wenbo; Hu, Hongyu; Dutta, Niloy K.

    2013-05-01

    Optical latches are important for a wide range of applications including communication systems, optical logic systems, optical random access memory (RAM) and encryption. All optical logic operations using quantum dot (QD) based semiconductor optical amplifier (SOA) and Mach-Zehnder interferometer (MZI) have been studied. The building block of an optical latch such as NAND gate has been fabricated and their operation experimentally demonstrated at ~ 80 GHz. A rate equation model has been developed for the QD-SOA-MZI and it has been used to analyze the Boolean logic operation. The model has been used to analyze the Set-Reset (S-R) latch and the D-Flip-Flop (DFF) devices. The DFF is the basic device for building larger logic circuits. The results show that the latches would work to speeds of ~ 250 Gb/s.

  4. An Implantable CMOS Amplifier for Nerve Signals

    DEFF Research Database (Denmark)

    Nielsen, Jannik Hammel; Lehmann, Torsten

    2001-01-01

    on the amplifier input nodes. The method for signal recovery from noisy nerve signals is presented. A prototype amplifier is realized in a standard digital 0.5 μm CMOS single poly, n-well process. The prototype amplifier features a gain of 80 dB over a 3.6 kHz bandwidth, a CMRR of more than 87 dB and a PSRR...

  5. Enhanced Gain in Photonic Crystal Amplifiers

    DEFF Research Database (Denmark)

    Ek, Sara; Semenova, Elizaveta; Hansen, Per Lunnemann;

    2012-01-01

    study of a 1 QW photonic crystal amplifier. Net gain is achieved which enables laser oscillation in photonic crystal micro cavities. The ability to freely tailor the dispersion in a semiconductor optical amplifier makes it possible to raise the optical gain considerably over a certain bandwidth. These...... results are promising for short and efficient semiconductor optical amplifiers. This effect will also benefit other devices, such as mode locked lasers....

  6. Reflection amplifiers in self-regulated learning

    NARCIS (Netherlands)

    Verpoorten, Dominique

    2012-01-01

    Verpoorten, D. (2012). Reflection amplifiers in self-regulated learning. Doctoral thesis. November, 9, 2012, Heerlen, The Netherlands: Open Universiteit (CELSTEC). Datawyse / Universitaire Pers Maastricht.

  7. Design of an 1800nm Raman amplifier

    DEFF Research Database (Denmark)

    Svane, Ask Sebastian; Rottwitt, Karsten

    2013-01-01

    We present the experimental results for a Raman amplifier that operates at 1810 nm and is pumped by a Raman fiber laser at 1680 nm. Both the pump laser and the Raman amplifier is polarization maintaining. A challenge when scaling Raman amplifiers to longer wavelengths is the increase...... performance of the amplifier is also investigated for both configurations. Our results show an on/off gain exceeding 20 dB at 1810 nm for which the obtained effective noise figure is below 3 dB....

  8. Dynamics of Soliton Cascades in Fiber Amplifiers

    CERN Document Server

    Arteaga-Sierra, F R; Agrawal, Govind P

    2016-01-01

    We study numerically the formation of cascading solitons when femtosecond optical pulses are launched into a fiber amplifier with less energy than required to form a soliton of equal duration. As the pulse is amplified, cascaded fundamental solitons are created at different distances, without soliton fission, as each fundamental soliton moves outside the gain bandwidth through the Raman-induced spectral shifts. As a result, each input pulse creates multiple, temporally separated, ultrashort pulses of different wavelengths at the amplifier output. The number of pulses depends not only on the total gain of the amplifier but also on the width of input pulses.

  9. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  10. ACS after Servicing Mission 4: The WFC Optimization Campaign

    Science.gov (United States)

    Golimowski, David; Cheng, Ed; Loose, Markus; Sirianni, Marco; Lupie, Olivia; Smith, Linda; Arslanian, Steve; Boyce, Kevin; Chapman, George; Chiaberge, Marco; Desjardins, Tyler; Dye, Darryl; Grogin, Norman; Lim, Pey Lian; Lucas, Ray; Maybhate, Aparna; Mil, Kathleen; Mutchler, Max; Ricardo, Raphael; Scott, Barbara; Serrano, Beverly; Suchkov, Anatoly; Waczynski, Augustyn; Welty, Alan; Wheeler, Thomas; Wilson, Erin

    2011-07-01

    The ACS CCD Electronics Box Replacement (CEB-R) installed during SM4 features a Teledyne SIDECAR ASIC that permits optimization of the WFC via adjustment of CCD clock voltages, bias voltages, and pixel transmission timing. A built-in oscilloscope mode allows sensing of the analog signal from each output amplifier. An on-orbit campaign to optimize the performance of the WFC was undertaken at the start of the SMOV period. Initial tests with pre-SM4 default voltages and timing patterns showed that WFC's performance matches or exceeds its pre-failure levels, notwithstanding the expected increases in dark current and hot pixels and the decline in charge-transfer efficiency due to prolonged exposure to HST's radiation environment. The WFC2 CCD exhibited anomalous behavior when operated with nondefault settings of its amplifiers' reset-drain voltage (VOD). The CCD again displayed normal behavior when VOD was restored to its default setting. Consequently, the Optimization Campaign was truncated after two iterations, and ACS science operations commenced with the pre-SM4 default configuration.

  11. Distributed feedback laser amplifiers combining the functions of amplifiers and channel filters

    DEFF Research Database (Denmark)

    Wang, Z.; Durhuus, T.; Mikkelsen, Benny;

    1994-01-01

    A dynamic model for distributed feedback amplifiers, including the mode coupled equations and the carrier rate equation, is established. The presented mode coupled equations have taken into account the interaction between fast changing optical signal and the waveguide with corrugations. By showin...... the possibility of amplifying 100 ps pulses without pulse broadening, we anticipate that a distributed feedback amplifier can be used as a combined amplifier and channel filter in high bit rate transmission systems....

  12. Amplified spontaneous emission and its restraint in a terawatt Ti:sapphire amplifier

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Amplified spontaneous emission (ASE) and its restraint in a femtosecond Ti: sapphire chirped_pulse amplifier were investigated. The noises arising from ASE were effectively filtered out in the spatial, temporal and spectral domain. Pulses as short as 38 fs were amplified to peak power of 1.4 TW. The power ratio between the amplified femtosecond pulse and the ASE was higher than 106:1.

  13. An Implantable CMOS Amplifier for Nerve Signals

    DEFF Research Database (Denmark)

    Nielsen, Jannik Hammel; Lehmann, Torsten

    2003-01-01

    . A continuous-time current-steering offset-compensation technique is utilized in order to minimize the noise contribution and to minimize dynamic impact on the amplifier input nodes. The method for signal recovery from noisy nerve signals is presented. A prototype amplifier is realized in a standard digital 0...

  14. Self-pulsation in Raman fiber amplifiers

    DEFF Research Database (Denmark)

    Pedersen, Martin Erland Vestergaard; Ott, Johan Raunkjær; Rottwitt, Karsten

    2009-01-01

    Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated.......Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated....

  15. Waveguide optical amplifier for telecom applications

    OpenAIRE

    Taccheo, Stefano; Zannin, Marcelo; Ennser, Karin; Careglio, Davide; Solé Pareta, Josep; Aracil Rico, Javier

    2009-01-01

    In this paper we review progress in optical gain clamped waveguide amplifiers for applications to optical communications. We demonstrate that compact waveguide devices may offer advantages compared to standard fiber amplifiers. In particular we focus on the application of gain clamping and optical burst switching networks where physical impairments may occur due to variation of the input power. Peer Reviewed

  16. BROADBAND TRAVELLING WAVE SEMICONDUCTOR OPTICAL AMPLIFIER

    DEFF Research Database (Denmark)

    2010-01-01

    Broadband travelling wave semiconductor optical amplifier (100, 200, 300, 400, 800) for amplification of light, wherein the amplifier (100, 200, 300, 400, 800) comprises a waveguide region (101, 201, 301, 401, 801) for providing confinement of the light in transverse directions and adapted...

  17. Design and performance of the beamlet amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Erlandson, A.C.; Rotter, M.D.; Frank, M.D.; McCracken, R.W.

    1996-06-01

    In future laser systems, such as the National Ignition Facility (NIF), multi-segment amplifiers (MSAs) will be used to amplify the laser beam to the required levels. As a prototype of such a laser architecture, the authors have designed, built, and tested flash-lamp-pumped, Nd:Glass, Brewster-angle slab MSAs for the Beamlet project. In this article, they review the fundamentals of Nd:Glass amplifiers, describe the MSA geometry, discuss parameters that are important in amplifier design, and present our results on the characterization of the Beamlet MSAs. In particular, gain and beam steering measurements show that the Beamlet amplifiers meet all optical performance specifications and perform close to model predictions.

  18. Qubit readout with a directional parametric amplifier

    Science.gov (United States)

    Sliwa, K. M.; Abdo, B.; Narla, A.; Shankar, S.; Hatridge, M.; Frunzio, L.; Schoelkopf, R. J.; Devoret, M. H.

    2014-03-01

    Josephson junction based quantum limited parametric amplifiers play an essential role in superconducting qubit measurements. These measurements necessitate circulators and isolators between the amplifier and qubit to add directionality and/or isolation. Unfortunately, this extra hardware limits both quantum measurement efficiency and experimental scalability. Here we present a quantum-limited Josephson-junction-based directional amplifier (JDA) based on a novel coupling between two nominally identical Josephson parametric converters (JPCs). The device achieves a forward gain of 11 dB with a 15 MHz dynamical bandwidth, but higher gains are possible at the expense of bandwidth. We also present measurements of a transmon qubit made with the JDA, and show minimal measurement back-action despite the absence of any isolator or circulator before the amplifier. These results provide a first step toward realizing on-chip integration of qubits and parametric amplifiers. Work supported by: IARPA, ARO, and NSF.

  19. Detection of Non-Amplified Genomic DNA

    CERN Document Server

    Corradini, Roberto

    2012-01-01

    This book offers a state-of-the-art overview on non amplified DNA detection methods and provides chemists, biochemists, biotechnologists and material scientists with an introduction to these methods. In fact all these fields have dedicated resources to the problem of nucleic acid detection, each contributing with their own specific methods and concepts. This book will explain the basic principles of the different non amplified DNA detection methods available, highlighting their respective advantages and limitations. The importance of non-amplified DNA sequencing technologies will be also discussed. Non-amplified DNA detection can be achieved by adopting different techniques. Such techniques have allowed the commercialization of innovative platforms for DNA detection that are expected to break into the DNA diagnostics market. The enhanced sensitivity required for the detection of non amplified genomic DNA has prompted new strategies that can achieve ultrasensitivity by combining specific materials with specifi...

  20. Ultrafast disk lasers and amplifiers

    Science.gov (United States)

    Sutter, Dirk H.; Kleinbauer, Jochen; Bauer, Dominik; Wolf, Martin; Tan, Chuong; Gebs, Raphael; Budnicki, Aleksander; Wagenblast, Philipp; Weiler, Sascha

    2012-03-01

    Disk lasers with multi-kW continuous wave (CW) output power are widely used in manufacturing, primarily for cutting and welding applications, notably in the automotive industry. The ytterbium disk technology combines high power (average and/or peak power), excellent beam quality, high efficiency, and high reliability with low investment and operating costs. Fundamental mode picosecond disk lasers are well established in micro machining at high throughput and perfect precision. Following the world's first market introduction of industrial grade 50 W picosecond lasers (TruMicro 5050) at the Photonics West 2008, the second generation of the TruMicro series 5000 now provides twice the average power (100 W at 1030 nm, or 60 W frequency doubled, green output) at a significantly reduced footprint. Mode-locked disk oscillators achieve by far the highest average power of any unamplified lasers, significantly exceeding the 100 W level in laboratory set-ups. With robust long resonators their multi-microjoule pulse energies begin to compete with typical ultrafast amplifiers. In addition, significant interest in disk technology has recently come from the extreme light laser community, aiming for ultra-high peak powers of petawatts and beyond.

  1. Theoretical analysis and an improvement method of the bias effect on the linearity of RF linear power amplifiers

    Institute of Scientific and Technical Information of China (English)

    Wu Tuo; Chen Hongyi; Qian Dahong

    2009-01-01

    Based on the Gummel-Poon model of BJT, the change of the DC bias as a function of the AC input signal in RF linear power amplifiers is theoretically derived, so that the linearity of different DC bias circuits can be interpreted and compared. According to the analysis results, a quantitative adaptive DC bias circuit is proposed,which can improve the linearity and efficiency. From the simulation and test results, we draw conclusions on how to improve the design of linear power amplifier.

  2. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  3. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  4. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  5. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  6. Effect of Soliton Propagation in Fiber Amplifiers

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The propagation of optical solitons in fiber amplifiers is discussed by considering a model that includes linear high order dispersion, two-photon absorption, nonlinear high-order dispersion, self-induced Ramam and five-order nonlinear effects. Based on travelling wave method, the solutions of the nonlinear Schrdinger equations, and the influence on soliton propagation as well as high-order effect in the fiber amplifier are discussed in detail. It is found that because of existing five-order nonlinear effect, the solution is not of secant hyperbola type, but shows high gain state of the fiber amplifier which is very favourable to the propagation of solitons.

  7. Quantum electronics maser amplifiers and oscillators

    CERN Document Server

    Fain, V M; Sanders, J H

    2013-01-01

    Quantum Electronics, Volume 2: Maser Amplifiers and Oscillators deals with the experimental and theoretical aspects of maser amplifiers and oscillators which are based on the principles of quantum electronics. It shows how the concepts and equations used in quantum electronics follow from the basic principles of theoretical physics.Comprised of three chapters, this volume begins with a discussion on the elements of the theory of quantum oscillators and amplifiers working in the microwave region, along with the practical achievements in this field. Attention is paid to two-level paramagnetic ma

  8. Laser Cooled High-Power Fiber Amplifier

    OpenAIRE

    Nemova, Galina

    2009-01-01

    A theoretical model for laser cooled continuous-wave fiber amplifier is presented. The amplification process takes place in the Tm3+-doped core of the fluoride ZBLAN (ZrF4-BaF2-LaF3-AlF3-NaF) glass fiber. The cooling process takes place in the Yb3+:ZBLAN fiber cladding. It is shown that for each value of the pump power and the amplified signal there is a distribution of the concentration of the Tm3+ along the length of the fiber amplifier, which provides its athermal operation. The influence ...

  9. Fundamentals of RF and microwave transistor amplifiers

    CERN Document Server

    Bahl, Inder J

    2009-01-01

    A Comprehensive and Up-to-Date Treatment of RF and Microwave Transistor Amplifiers This book provides state-of-the-art coverage of RF and microwave transistor amplifiers, including low-noise, narrowband, broadband, linear, high-power, high-efficiency, and high-voltage. Topics covered include modeling, analysis, design, packaging, and thermal and fabrication considerations. Through a unique integration of theory and practice, readers will learn to solve amplifier-related design problems ranging from matching networks to biasing and stability. More than 240 problems are included to help read

  10. Class D audio amplifier with 4th order output filter and self-oscillating full-state hysteresis based feedback driving capacitive transducers

    DEFF Research Database (Denmark)

    Nielsen, Dennis; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    A practical solution is presented for the design of a non-isolated high voltage DC/AC power converter. The converter is intended to be used as a class D audio amplifier for a Dielectric Electro Active Polymer (DEAP) transducer. A simple and effective hysteretic control scheme for the converter (b...

  11. Sensor/amplifier for weak light sources

    Science.gov (United States)

    Desmet, D. J.; Jason, A. J.; Parr, A. C.

    1980-01-01

    Light sensor/amplifier circuit detects weak light converts it into strong electrical signal in electrically noisy environment. Circuit is relatively simple and uses inexpensive, readily available components. Device is useful in such applications as fire detection and photographic processing.

  12. High Energy Single Frequency Resonant Amplifier Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR phase I project proposes a single frequency high energy resonant amplifier for remote sensing. Current state-of-art technologies can not provide all...

  13. SSTI Clark ACS Technology Demonstrations

    OpenAIRE

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  14. Apuntes de Acústica

    OpenAIRE

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  15. Energy saving in ac generators

    Science.gov (United States)

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  16. Multiple excitation regenerative amplifier inertial confinement system

    International Nuclear Information System (INIS)

    The invention relates to apparatus and methods for producing high intensity laser radiation generation which is achieved through an optical amplifier-storage ring design. One or two synchronized, counterpropagating laser pulses are injected into a regenerative amplifier cavity and amplified by gain media which are pumped repetitively by electrical or optical means. The gain media excitation pulses are tailored to efficiently amplify the laser pulses during each transit. After the laser pulses have been amplified to the desired intensity level, they are either switched out of the cavity by some switch means, as for example an electro-optical device, for any well known laser end uses, or a target means may be injected into the regenerative amplifier cavity in such a way as to intercept simultaneously the counterpropagating laser pulses. One such well known end uses to which this invention is intended is for production of high density and temperature plasmas suitable for generating neutrons, ions and x-rays and for studying matter heated by high intensity laser radiation

  17. Proposal of Switching Power Amplifier Using Small Capacity Linear Amplifier and LC Filter

    Science.gov (United States)

    Kamada, Jo; Funato, Hirohito; Ogasawara, Satoshi

    The higher efficiency and the low noise in output voltage and current has been required in some applications, i.e. audio-video equipment, medical equipment and so on. This paper proposes a power amplifier in which a PWM inverter is used as a main circuit. In the proposed power amplifier, a hybrid filter composed of a simple and general LC filter and a small capacity linear amplifier is connected to the output of the inverter. The linear amplifier is inserted in series to the filter capacitor to improve the filtering effect of the LC filter. Switching ripples and LC resonances are considerably suppressed by controlling the amplifier using the proposed method and a low distortion switching power amplifier is realized. The effects of the proposal circuit are verified by simulations and experiments. As a result, the proposed circuit achieves low noise about THD=0.68% in simulation and THD=1.7% in experiment.

  18. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  19. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  20. High power, high beam quality regenerative amplifier

    Science.gov (United States)

    Hackel, L.A.; Dane, C.B.

    1993-08-24

    A regenerative laser amplifier system generates high peak power and high energy per pulse output beams enabling generation of X-rays used in X-ray lithography for manufacturing integrated circuits. The laser amplifier includes a ring shaped optical path with a limited number of components including a polarizer, a passive 90 degree phase rotator, a plurality of mirrors, a relay telescope, and a gain medium, the components being placed close to the image plane of the relay telescope to reduce diffraction or phase perturbations in order to limit high peak intensity spiking. In the ring, the beam makes two passes through the gain medium for each transit of the optical path to increase the amplifier gain to loss ratio. A beam input into the ring makes two passes around the ring, is diverted into an SBS phase conjugator and proceeds out of the SBS phase conjugator back through the ring in an equal but opposite direction for two passes, further reducing phase perturbations. A master oscillator inputs the beam through an isolation cell (Faraday or Pockels) which transmits the beam into the ring without polarization rotation. The isolation cell rotates polarization only in beams proceeding out of the ring to direct the beams out of the amplifier. The diffraction limited quality of the input beam is preserved in the amplifier so that a high power output beam having nearly the same diffraction limited quality is produced.

  1. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  2. The OPTHER Project: Progress toward the THz Amplifier

    DEFF Research Database (Denmark)

    Paoloni, C; Brunetti, F; Di Carlo, A;

    2011-01-01

    This paper describes the status of the OPTHER (OPtically driven TeraHertz AmplifiERs) project and progress toward the THz amplifier realization. This project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within th...

  3. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  4. Design Of A Doherty Power Amplifier For GSM Systems

    Directory of Open Access Journals (Sweden)

    Saad Wasmi Osman

    2013-04-01

    Full Text Available This paper presents the design and analysis of Doherty power amplifier. The Doherty amplifier is used in  a base station for mobile system because of its high efficiency. The class AB power amplifier used in the configuration of the main and auxiliary amplifier. The result obtained shows that the Doherty power amplifier can be used on a wide band spectrum, the amplifier works at 900MHz and has very good power added efficiency (PAE and gain. The amplifier can also work at 1800MHz at input power greater than 20dBm. 

  5. The Electron Beam Semiconductor (EBS) amplifier

    Science.gov (United States)

    True, R. M.; Baxendale, J. F.

    1980-07-01

    The Electron Beam Semiconductor (EBS) concept has existed for three decades; but only within the last decade has an active, well-defined program been underway to develop devices that can operate as high-power radio frequency(RF) amplifiers, fast risetime switches, and current and voltage pulse amplifiers. This report discusses the test procedures, data and results of reliability testing of RF and video pulse EBS amplifiers at Electronics Research and Development Command (ERADCOM), Fort Monmouth, New Jersey. Also, the experimental analysis of the series connected diode EBS device is described in detail. Finally, the report concludes with a discussion of the state-of-the-art of EBS and future trends of the technology.

  6. Wideband pulse amplifiers for the NECTAr chip

    Energy Technology Data Exchange (ETDEWEB)

    Sanuy, A., E-mail: asanuy@ecm.ub.es [Dept. AM i Dept. ECM, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona. Marti i Franques 1, E08028, Barcelona (Spain); Delagnes, E. [IRFU/DSM/CEA, CE-Saclay, Bat. 141 SEN Saclay, F-91191, Gif-sur-Yvette (France); Gascon, D. [Dept. AM i Dept. ECM, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona. Marti i Franques 1, E08028, Barcelona (Spain); Sieiro, X. [Departament d' Electronica, Universitat de Barcelona. Marti i Franques 1, E08028, Barcelona (Spain); Bolmont, J.; Corona, P. [LPNHE, Universite Paris VI and Universite Paris VII and IN2P3/CNRS, Barre 12-22, 1er etage, 4 place Jussieu, 75252 Paris (France); Feinstein, F. [LUPM, Universite Montpellier II and IN2P3/CNRS, CC072, bat. 13, place Eugene Bataillon, 34095 Montpellier (France); Glicenstein, J-F. [IRFU/DSM/CEA, CE-Saclay, Bat. 141 SEN Saclay, F-91191, Gif-sur-Yvette (France); Naumann, C.L.; Nayman, P. [LPNHE, Universite Paris VI and Universite Paris VII and IN2P3/CNRS, Barre 12-22, 1er etage, 4 place Jussieu, 75252 Paris (France); Ribo, M. [Dept. AM i Dept. ECM, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona. Marti i Franques 1, E08028, Barcelona (Spain); and others

    2012-12-11

    The NECTAr collaboration's FE option for the camera of the CTA is a 16 bits and 1-3 GS/s sampling chip based on analog memories including most of the readout functions. This works describes the input amplifiers of the NECTAr ASIC. A fully differential wideband amplifier, with voltage gain up to 20 V/V and a BW of 400 MHz. As it is impossible to design a fully differential OpAmp with an 8 GHz GBW product in a 0.35 CMOS technology, an alternative implementation based on HF linearized transconductors is explored. The output buffer is a class AB miller operational amplifier, with special non-linear current boost.

  7. An automated test facility for neutronic amplifiers

    International Nuclear Information System (INIS)

    Neutronic amplifiers are used at the Chalk River Laboratory in applications such as neutron flux monitoring and reactor control systems. Routine preventive maintenance of control and safety systems included annual calibration and characterization of the neutronic amplifiers. An investigation into the traditional methods of annual routine maintenance of amplifiers concluded that frequency and phase response measurements in particular were labour intensive and subject to non-repeatable errors. A decision was made to upgrade testing methods and facilities by using programmable test equipment under the control of a computer. In order to verify the results of the routine measurements, expressions for the transfer functions were derived from the circuit diagrams. Frequency and phase responses were then calculated and plotted thus providing a bench-mark to which the test results can be compared. (author)

  8. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  9. Linear Amplifier Model for Optomechanical Systems

    CERN Document Server

    Botter, Thierry; Brahms, Nathan; Schreppler, Sydney; Stamper-Kurn, Dan M

    2011-01-01

    We model optomechanical systems as linear optical amplifiers. This provides a unified treatment of diverse optomechanical phenomena. We emphasize, in particular, the relationship between ponderomotive squeezing and optomechanically induced transparency, two foci of current research. We characterize the amplifier response to quantum and deliberately applied fluctuations, both optical and mechanical. Further, we apply these results to establish quantum limits on external force sensing both on and off cavity resonance. We find that the maximum sensitivity attained on resonance constitutes an absolute upper limit, not surpassed when detuning off cavity resonance. The theory can be extended to a two-sided cavity with losses and limited detection efficiency.

  10. Operational amplifier circuits analysis and design

    CERN Document Server

    Nelson, J C C

    1995-01-01

    This book, a revised and updated version of the author's Basic Operational Amplifiers (Butterworths 1986), enables the non-specialist to make effective use of readily available integrated circuit operational amplifiers for a range of applications, including instrumentation, signal generation and processing.It is assumed the reader has a background in the basic techniques of circuit analysis, particularly the use of j notation for reactive circuits, with a corresponding level of mathematical ability. The underlying theory is explained with sufficient but not excessive, detail. A range of compu

  11. Predistortion of a Bidirectional Cuk Audio Amplifier

    DEFF Research Database (Denmark)

    Birch, Thomas Hagen; Nielsen, Dennis; Knott, Arnold;

    2014-01-01

    Some non-linear amplifier topologies are capable of providing a larger voltage gain than one from a DC source, which could make them suitable for various applications. However, the non-linearities introduce a significant amount of harmonic distortion (THD). Some of this distortion could be reduced...... using predistortion. This paper suggests linearizing a nonlinear bidirectional Cuk audio amplifier using an analog predistortion approach. A prototype power stage was built and results show that a voltage gain of up to 9 dB and reduction in THD from 6% down to 3% was obtainable using this approach....

  12. Beyond nonlinear saturation of backward Raman amplifiers

    Science.gov (United States)

    Barth, Ido; Toroker, Zeev; Balakin, Alexey A.; Fisch, Nathaniel J.

    2016-06-01

    Backward Raman amplification is limited by relativistic nonlinear dephasing resulting in saturation of the leading spike of the amplified pulse. Pump detuning is employed to mitigate the relativistic phase mismatch and to overcome the associated saturation. The amplified pulse can then be reshaped into a monospike pulse with little precursory power ahead of it, with the maximum intensity increasing by a factor of two. This detuning can be employed advantageously both in regimes where the group velocity dispersion is unimportant and where the dispersion is important but small.

  13. Optimization of Pr3+:ZBLAN fiber amplifiers

    DEFF Research Database (Denmark)

    Pedersen, B.; Miniscalco, J. W.; Quimby, R. S.

    1992-01-01

    Experimental parameters have been measured and used in a quantitative model of Pr3+-doped fluorozirconate fiber amplifiers. The optimum cutoff wavelength was determined to be 800 nm and the gain for 400 mW of pump was found to increase from 12 to 34 dB if the NA was increased from 0.15 to 0.......25. Lengthening the metastable state lifetime from 110 to 300 μs would significantly improve amplifier performance while concentration quenching can appreciably degrade it...

  14. Control of AC133/CD133 and impact on human hematopoietic progenitor cells through nucleolin.

    Science.gov (United States)

    Bhatia, S; Reister, S; Mahotka, C; Meisel, R; Borkhardt, A; Grinstein, E

    2015-11-01

    AC133 is a prominent surface marker of CD34+ and CD34- hematopoietic stem/progenitor cell (HSPC) subsets. AC133+ HSPCs contain high progenitor cell activity and are capable of hematopoietic reconstitution. Furthermore, AC133 is used for prospective isolation of tumor-initiating cells in several hematological malignancies. Nucleolin is a multifunctional factor of growing and cancer cells, which is aberrantly active in certain hematological neoplasms, and serves as a candidate molecular target for cancer therapy. Nucleolin is involved in gene transcription and RNA metabolism and is prevalently expressed in HSPCs, as opposed to differentiated hematopoietic tissue. The present study dissects nucleolin-mediated activation of surface AC133 and its cognate gene CD133, via specific interaction of nucleolin with the tissue-dependent CD133 promoter P1, as a mechanism that crucially contributes to AC133 expression in CD34+ HSPCs. In mobilized peripheral blood (MPB)-derived HSPCs, nucleolin elevates colony-forming unit (CFU) frequencies and enriches granulocyte-macrophage CFUs. Furthermore, nucleolin amplifies long-term culture-initiating cells and also promotes long-term, cytokine-dependent maintenance of hematopoietic progenitor cells. Active β-catenin, active Akt and Bcl-2 levels in MPB-derived HSPCs are nucleolin-dependent, and effects of nucleolin on these cells partially rely on β-catenin activity. The study provides new insights into molecular network relevant to stem/progenitor cells in normal and malignant hematopoiesis. PMID:26183533

  15. Mutation of an aminopeptidase N gene is associated with Helicoverpa armigera resistance to Bacillus thuringiensis Cry1Ac toxin.

    Science.gov (United States)

    Zhang, Shaoping; Cheng, Hongmei; Gao, Yulin; Wang, Guirong; Liang, Gemei; Wu, Kongming

    2009-07-01

    A Cry1Ac-resistant strain (Bt-R) of Helicoverpa armigera, with 2971-fold resistance, was derived by selection with Cry1Ac toxin for 75 generations. We used cDNA-amplified fragment length polymorphism analysis to identify those genes differentially expressed in the Cry1Ac-resistant and -susceptible strains, which revealed 212 differentially expressed transcripts among 2000 screened cDNAs. Among these transcript-derived fragments (TDFs), 37 showed some homology to known sequences, including Aminopeptidase N (APN), which is expressed in the midgut epithelium and has been implicated as a Cry1A subfamily receptor in several moths, including H. armigera. We confirmed the TDF by RT-PCR and identified a deletion mutation of apn1 in the Bt-R strain. We expressed the TDF in bacteria. The partial HaAPN1-96S wild-type protein, bound to Cry1Ac on ligand blots, whereas HaAPN1-BtR did not. This suggested that HaAPN1 is a receptor for Bt Cry1Ac and that its deletion mutation is associated with Cry1Ac resistance in H. armigera. The absence of one binding site is responsible for its resistance to Cry1Ac. We developed an allele-specific PCR to monitor whether the apn1 gene in an H. armigera field population produced a similar mutation. No deleted mutants were found in 2250 individuals collected from the field in 2006-2007. PMID:19376227

  16. ACS after SM4: New Life for an Old Workhorse

    Science.gov (United States)

    Golimowski, David; Anderson, Jay; Armstrong, Amber; Arslanian, Steve; Bedin, Luigi; Bohlin, Ralph; Boyce, Kevin; Chapman, George; Cheng, Edward; Chiaberge, Marco; Cox, Colin; Desiardins, Tyler; Dye, Darryl; Ellis, Tracy; Ferguson, Brian; Fruchter, Andrew; Grogin, Norman; Lim, Pey Lian; Loose, Markus; Lucas, Ray; Lupie, Olivia; Mack, Jennifer; Maybhate, Aparna; Mil, Kathleen; Mutchler, Max; Ricardo, Raphael; Scott, Barbara; Serrano, Beverly; Sirianni, Marco; Smith, Linda; Suchkov, Anatoly A.; Waczynski, Augustyn; Welty, Alan; Wheeler, Thomas; Wilson, Erin

    2010-07-01

    The ACS CCD Electronics Box Replacement (CEB-R) installed during SM4 features a Teledyne SIDECAR ASIC that permits optimization of the WFC via adjustment of CCD clock voltages, bias voltages, and pixel transmission timing. An on-orbit campaign to optimize the performance of the WFC was undertaken at the start of the SMOV period. Initial tests with pre-SM4 default voltages and timing patterns showed that WFC's performance matches or exceeds its pre-failure levels, notwithstanding the expected increases in dark current and hot pixels and the decline in charge-transfer efficiency due to prolonged exposure to HST's radiation environment. One WFC CCD exhibited anomalous behavior when operated with nondefault settings of its reset drain voltage. Consequently, the optimization campaign was truncated after two iterations, and ACS science operations commenced with the pre-SM4 default configuration. Several artifacts attributed to the CEB-R appear in post-SM4 WFC images: large-scale but stable bias gradients, low-level but temporally variable horizontal stripes, a signal-dependent bias shift, and amplifier crosstalk. STScI has developed algorithms for the correction or mitigation of these electronic artifacts as well as for the restoration of images affected by continuously degrading CTE. Standalone correction packages are now or will soon be publicly available. These packages will be incorporated into the calacs package of the OPUS data pipeline by September 2011.

  17. Feedback analysis of transimpedance operational amplifier circuits

    DEFF Research Database (Denmark)

    Bruun, Erik

    1993-01-01

    The transimpedance or current feedback operational amplifier (CFB op-amp) is reviewed and compared to a conventional voltage mode op-amp using an analysis emphasizing the basic feedback characteristics of the circuit. With this approach the paradox of the constant bandwidth obtained from CFB op...

  18. Ultra-low Voltage CMOS Cascode Amplifier

    DEFF Research Database (Denmark)

    Lehmann, Torsten; Cassia, Marco

    2000-01-01

    In this paper, we design a folded cascode operational transconductance amplifier in a standard CMOS process, which has a measured 69 dB DC gain, a 2 MHz bandwidth and compatible input- and output voltage levels at a 1 V power supply. This is done by a novel Current Driven Bulk (CDB) technique, wh...

  19. Stereoscopy Amplifies Emotions Elicited by Facial Expressions.

    Science.gov (United States)

    Hakala, Jussi; Kätsyri, Jari; Häkkinen, Jukka

    2015-12-01

    Mediated facial expressions do not elicit emotions as strongly as real-life facial expressions, possibly due to the low fidelity of pictorial presentations in typical mediation technologies. In the present study, we investigated the extent to which stereoscopy amplifies emotions elicited by images of neutral, angry, and happy facial expressions. The emotional self-reports of positive and negative valence (which were evaluated separately) and arousal of 40 participants were recorded. The magnitude of perceived depth in the stereoscopic images was manipulated by varying the camera base at 15, 40, 65, 90, and 115 mm. The analyses controlled for participants' gender, gender match, emotional empathy, and trait alexithymia. The results indicated that stereoscopy significantly amplified the negative valence and arousal elicited by angry expressions at the most natural (65 mm) camera base, whereas stereoscopy amplified the positive valence elicited by happy expressions in both the narrowed and most natural (15-65 mm) base conditions. Overall, the results indicate that stereoscopy amplifies the emotions elicited by mediated emotional facial expressions when the depth geometry is close to natural. The findings highlight the sensitivity of the visual system to depth and its effect on emotions. PMID:27551358

  20. A low-noise transimpedance amplifier for the detection of “Violin-Mode” resonances in advanced Laser Interferometer Gravitational wave Observatory suspensions

    Energy Technology Data Exchange (ETDEWEB)

    Lockerbie, N. A.; Tokmakov, K. V. [SUPA (Scottish Universities Physics Alliance) Department of Physics, University of Strathclyde, 107 Rottenrow, Glasgow G4 0NG (United Kingdom)

    2014-11-15

    This paper describes the design and performance of an extremely low-noise differential transimpedance amplifier, which takes its two inputs from separate photodiodes. The amplifier was planned to serve as the front-end electronics for a highly sensitive shadow-displacement sensing system, aimed at detecting very low-level “Violin-Mode” (VM) oscillations in 0.4 mm diameter by 600 mm long fused-silica suspension fibres. Four such highly tensioned fibres support the 40 kg test-masses/mirrors of the Advanced Laser Interferometer Gravitational wave Observatory interferometers. This novel design of amplifier incorporates features which prevent “noise-gain peaking” arising from large area photodiode (and cable) capacitances, and which also usefully separate the DC and AC photocurrents coming from the photodiodes. In consequence, the differential amplifier was able to generate straightforwardly two DC outputs, one per photodiode, as well as a single high-gain output for monitoring the VM oscillations—this output being derived from the difference of the photodiodes’ two, naturally anti-phase, AC photocurrents. Following a displacement calibration, the amplifier's final VM signal output was found to have an AC displacement responsivity at 500 Hz of (9.43 ± 1.20) MV(rms) m{sup −1}(rms), and, therefore, a shot-noise limited sensitivity to such AC shadow- (i.e., fibre-) displacements of (69 ± 13) picometres/√Hz at this frequency, over a measuring span of ±0.1 mm.

  1. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  2. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  3. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  4. ac electroosmosis in rectangular microchannels.

    Science.gov (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  5. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  6. Tunable microstrip SQUID amplifiers for the Gen 2 Axion Dark Matter eXperiment (ADMX)

    Science.gov (United States)

    O'Kelley, Sean; Hilton, Gene; Clarke, John; ADMX Collaboration

    2016-03-01

    We present a series of tunable microstrip SQUID (Superconducting Quantum Interference Device) amplifiers (MSAs) for installation in ADMX. The axion dark matter candidate is detected via Primakoff conversion to a microwave photon in a high-Q (~100,000) tunable microwave cavity cooled with a dilution refrigerator in a 7-tesla magnetic field. The microwave photon frequency ν is a function of the unknown axion mass, so both the cavity and amplifier must be scanned over a wide frequency range. An MSA is a linear, phase-preserving amplifier consisting of a square washer loop, fabricated from a thin Nb film, incorporating two Josephson tunnel junctions with resistive shunts to prevent hysteresis. The input is coupled via a microstrip made from a square Nb coil deposited over the washer with an intervening insulating layer. Tunability is achieved by terminating the microstrip with GaAs varactors that operate below 100 mK. By varying the varactor capacitance with a bias voltage, the resonant frequency is varied by up to a factor of 2. We demonstrate several devices operating below 100 mK, matched to the discrete operating bands of ADMX at frequencies ranging from 560 MHz to 1 GHz. The MSAs exhibit gains exceeding 20 dB and the associated noise temperatures, measured with a hot/cold load, approach the standard quantum limit (hν/kB) . Supported by DOE Grants DE - FG02 - 97ER41029, DE - FG02 - 96ER40956, DE - AC52 - 07NA27344, DE - AC03 - 76SF00098, and the Livermore LDRD program.

  7. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  8. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  9. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  10. Amplified spontaneous emission spectrum and gain characteristic of a two-electrode semiconductor optical amplifier*

    Institute of Scientific and Technical Information of China (English)

    Wang Hanchao; Huang Lirong; Shi Zhongwei

    2011-01-01

    A two-electrode multi-quantum-well semiconductor optical amplifier is designed and fabricated. The amplified spontaneous emission (ASE) spectrum and gain were measured and analyzed. It is shown that the ASE spectrum and gain characteristic are greatly influenced by the distribution of the injection current density. By changing the injection current density of two electrodes, the full width at half maximum, peak wavelength, peak power of the ASE spectrum and the gain characteristic can be easily controlled.

  11. Increased long-flight activity triggered in beet armyworm by larval feeding on diet containing Cry1Ac protoxin.

    Directory of Open Access Journals (Sweden)

    Xing Fu Jiang

    Full Text Available Evaluating ecological safety and conducting pest risk analysis for transgenic crops are vitally important before their commercial planting. The beet armyworm, Spodoptera exigua, a long-distance migratory insect pest, is not a direct target of transgenic Cry1Ac-expressing cotton in China, but nevertheless it has recently become an important pest. Migrants leaving their natal field arrive in other appropriate habitat far away in a short time, often followed by larval outbreaks. S. exigua has low susceptibility to Cry1Ac. However, our results from laboratory experiments identified (i sublethal effects of Cry1Ac protoxin on larval development rate, larval and pupal weight, and adult lifetime fecundity, and (ii increased long-flight behavior triggered by Cry1Ac which may contribute to larval outbreaks elsewhere. No significant differences in larval mortality, pupation rate, adult emergence rate, longevity, pre-oviposition period, or oviposition period were observed between controls and larvae fed on artificial diet incorporating a low concentration of Cry1Ac protoxin. The negative sublethal effects on some developmental and reproductive traits and lack of effect on others suggest they do not contribute to the observed severity of S. exigua outbreaks after feeding on Cry1Ac cotton. Interestingly, the percentage of long fliers increased significantly when larvae were reared on diet containing either of two low-dose treatments of Cry1Ac, suggesting a possible increased propensity to disperse long distances triggered by Cry1Ac. We hypothesize that negative effects on development and reproduction caused by Cry1Ac in the diet are offset by increased flight propensity triggered by the poor food conditions, thereby improving the chances of escaping adverse local conditions before oviposition. Increased long-flight propensity in turn may amplify the area damaged by outbreak populations. This phenomenon might be common in other migratory insect pests receiving

  12. First lasing of the regenerative amplifier FEL

    International Nuclear Information System (INIS)

    The regenerative amplifier free-electron laser (RAFEL) is a high-gain RF-linac FEL capable of producing high optical power from a compact design. The combination of a high-gain and small optical feedback enables the FEL to reach saturation and produce a high optical power and high extraction efficiency without the risk of optical damage to the mirrors. This paper summarizes the first lasing of the regenerative amplifier FEL and describes recent experimental results. The highest optical energy achieved thus far at 16.3 μm is 1.7 J over a train of 900 micropulses. We infer pulse energy of 1.9 mJ in each 16 ps micropulse, corresponding to a peak power of 120 MW

  13. Behavioral modeling of Digitally Adjustable Current Amplifier

    Directory of Open Access Journals (Sweden)

    Josef Polak

    2015-03-01

    Full Text Available This article presents the digitally adjustable current amplifier (DACA and its analog behavioral model (ABM, which is suitable for both ideal and advanced analyses of the function block using DACA as active element. There are four levels of this model, each being suitable for simulation of a certain degree of electronic circuits design (e.g. filters, oscillators, generators. Each model is presented through a schematic wiring in the simulation program OrCAD, including a description of equations representing specific functions in the given level of the simulation model. The design of individual levels is always verified using PSpice simulations. The ABM model has been developed based on practically measured values of a number of DACA amplifier samples. The simulation results for proposed levels of the ABM model are shown and compared with the results of the real easurements of the active element DACA.

  14. High power single-frequency Innoslab amplifier.

    Science.gov (United States)

    Han, Ke-Zhen; Ning, Jian; Zhang, Bai-Tao; Wang, Yi-Ran; Zhang, Hai-Kun; Nie, Hong-Kun; Sun, Xiao-Li; He, Jing-Liang

    2016-07-10

    A laser diode array (LDA) end-pumped continuous-wave single-frequency Innoslab amplifier has been demonstrated. The Gaussian ray bundle method was used to model the light propagation in the Innoslab amplifier for the first time to the best of our knowledge. With discrete reflectors, the maximum output of 60 W with a linewidth of 44 MHz was achieved under the pump power of 245 W, corresponding to the optical-optical efficiency of 24.5%. The beam quality factor M2 at the output power of 51 W in the horizontal and vertical direction was measured to be 1.4 and 1.3, respectively. The long-term power instability in 2 h was less than 0.25%. PMID:27409308

  15. Fundamentals of fiber lasers and fiber amplifiers

    CERN Document Server

    Ter-Mikirtychev, Valerii (Vartan)

    2014-01-01

    This book covers the fundamental aspects of fiber lasers and fiber amplifiers, and includes a wide range of material from laser physics fundamentals to state-of-the-art topics in this rapidly growing field of quantum electronics. Emphasis is placed on the nonlinear processes taking place in fiber lasers and amplifiers, their similarities, differences to, and their advantages over other solid-state lasers. The reader will learn basic principles of solid-state physics and optical spectroscopy of laser active centers in fibers, main operational laser regimes, and practical recommendations and suggestions on fiber laser research, laser applications, and laser product development. The book will be useful for students, researchers, and professionals who work with lasers, in the optical communications, chemical and biological industries, etc.

  16. Linear control of oscillator and amplifier flows*

    Science.gov (United States)

    Schmid, Peter J.; Sipp, Denis

    2016-08-01

    Linear control applied to fluid systems near an equilibrium point has important applications for many flows of industrial or fundamental interest. In this article we give an exposition of tools and approaches for the design of control strategies for globally stable or unstable flows. For unstable oscillator flows a feedback configuration and a model-based approach is proposed, while for stable noise-amplifier flows a feedforward setup and an approach based on system identification is advocated. Model reduction and robustness issues are addressed for the oscillator case; statistical learning techniques are emphasized for the amplifier case. Effective suppression of global and convective instabilities could be demonstrated for either case, even though the system-identification approach results in a superior robustness to off-design conditions.

  17. Design of an 1800 nm Raman Amplifier

    DEFF Research Database (Denmark)

    Svane, Ask Sebastian; Rottwitt, Karsten

    Different approaches are being explored to increase the capacity of communication systems [1,2], both long and short range systems. One approach is by exploiting new optical wavelength bands, outside the conventional communication window from 1530 nm to 1625 nm. Hollow core fibers have been...... in the pump power requirement and deteriorated noise properties. Here we demonstrate a Raman amplifier designed for signal wavelengths around 1800 nm. The amplification fiber is an OFS PM Raman fiber, and is pumped by a Raman fiber laser emitting at 1680 nm [4]. The amplifier was pumped co......-polarized and backward, with respect to the singal. In Fig. 2 a measured Raman on/off gain exceeding 9 dB for 285 mW of injected pump power is obtained in a 4.35 km long fiber. A broadband supercontinuum source was used as a signal from 1700 nm to 1900 nm....

  18. Noise Gain Features of Fiber Raman Amplifier

    Directory of Open Access Journals (Sweden)

    Georgii S. Felinskyi

    2016-01-01

    Full Text Available The formation dynamics of the optical noise in a silica single mode fiber (SMF as function of the pump power variation in the counter pumped fiber Raman amplifier (FRA is experimentally studied. The ratio between the power of amplified spontaneous emission and the power of incoherent optical noise is quantitatively determined by detailed analysis of experimental data in the pump powers range of 100–300 mW within the full band of Stokes frequencies, including FRA working wavelengths over the C + L transparency windows. It is found out the maximum of Raman gain coefficient for optical noise does not exceed ~60% of corresponding peak at the gain profile maximum of coherent signal. It is shown that the real FRA noise figure may be considerably less than 3 dB over a wide wavelength range (100 nm at a pump power of several hundreds of mW.

  19. Cryogenic cooling for high power laser amplifiers

    Directory of Open Access Journals (Sweden)

    Perin J.P.

    2013-11-01

    Full Text Available Using DPSSL (Diode Pumped Solid State Lasers as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz. The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K–170 K with a heat flux of 1 MW*m−2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser.

  20. Amplifying the Hawking Signal in BECs

    Directory of Open Access Journals (Sweden)

    Roberto Balbinot

    2014-01-01

    Full Text Available We consider simple models of Bose-Einstein condensates to study analog pair-creation effects, namely, the Hawking effect from acoustic black holes and the dynamical Casimir effect in rapidly time-dependent backgrounds. We also focus on a proposal by Cornell to amplify the Hawking signal in density-density correlators by reducing the atoms’ interactions shortly before measurements are made.

  1. Electrically Pumped Vertical-Cavity Amplifiers

    DEFF Research Database (Denmark)

    Greibe, Tine

    2007-01-01

    In this work, the design of electrically pumped vertical cavity semiconductor optical amplifiers (eVCAs) for use in a mode-locked external-cavity laser has been developed, investigated and analysed. Four different eVCAs, one top-emitting and three bottom emitting structures, have been designed...... and discussed. The thesis concludes with recommendations for further work towards the realisation of compact electrically pumped mode-locked vertical externalcavity surface emitting lasers....

  2. Quantum noise in ideal operational amplifiers

    OpenAIRE

    Courty, Jean-Michel; Grassia, Francesca; Reynaud, Serge

    1998-01-01

    We consider a model of quantum measurement built on an ideal operational amplifier operating in the limit of infinite gain, infinite input impedance and null output impedance and with a feddback loop. We evaluate the intensity and voltage noises which have to be added to the classical amplification equations in order to fulfill the requirements of quantum mechanics. We give a description of this measurement device as a quantum network scattering quantum fluctuations from input to output ports.

  3. Charge sensitive amplifies. The state of arts

    Energy Technology Data Exchange (ETDEWEB)

    Mori, Kunishiro [Clear Pulse Co., Tokyo (Japan)

    1996-07-01

    In the radiation detectors, signals are essentially brought with charges produced by radiation, then it is naturally the best way to use a charge sensitive amplifier (CSA) system to extract those signals. The CSA is thought to be the best amplifier suitable to almost all the radiation detectors, if neglecting economical points of view. The CSA has been only applied to special fields like radiation detection because the concept of `charges` is not so universal against the concepts of `voltage` and `current`. The CSA, however, is low in noise and a high speed amplifier and may be applicable not only to radiation measurement but also piezoelectric devices and also bolometers. In this article, noise in the CSA, basic circuit on the CSA, concepts of `equivalent noise charge` (ENC), a method for the ENC, and importance of the `open-loop gain` in the CSA to achieve better performance of it and how to realize in a practical CSA were described. And, characteristics on a counting rate of the CSA, various circuit used in the CSA, and CSAs which are commercially available at present and special purpose CSAs were also introduced. (G.K.)

  4. Microstrip SQUID amplifiers for quantum information science

    Science.gov (United States)

    Defeo, M. P.; Plourde, B. L. T.

    2012-02-01

    Recent progress in SQUID amplifiers suggests that these devices might approach quantum-limited sensitivity in the microwave range, thus making them a viable option for measurement of superconducting quantum systems. In the microstrip SQUID amplifier configuration, gains of around 20dB are possible at frequencies of several hundred MHz, and the gain is limited by the maximum voltage modulation available from the SQUID. One route for increasing the voltage modulation involves using larger resistive shunts, however maintaining non-hysteretic device operation requires smaller junction capacitances than is possible with conventional photolithographically patterned junctions. Operating at higher frequencies requires a shorter input coil which reduces mutual inductance between the coil and washer and therefore gain. We have fabricated microstrip SQUID amplifiers using submicron Al-AlOx-Al junctions and large shunts. The input coil and SQUID washer are optimized for producing high gain at frequencies in the gigahertz range. Recent measurements of gain and noise temperature will be discussed as well as demonstrations of these devices as a first stage of amplification for a superconducting system

  5. The development of DUV chemically amplified resists

    Energy Technology Data Exchange (ETDEWEB)

    Thackeray, J.W.; Fedynyshyn, T.H.; Small, R.D. [Shipley Co. Inc., Marlboro, MA (United States)

    1993-12-31

    The development of deep ultraviolet (DUV) resists has necessitated the introduction of new concepts in resist materials and chemistry. Successful DUV resist systems now employ the concept of chemical amplification. This catalytic reaction leads to a substantial enhancement in the imaging dose. Another benefit of chemical amplified resists is that they allow the design of materials which can be transparent to DUV exposure wavelengths, yet they can still have high sensitivity. Commercial and prototype positive- and negative-tone resists are now readily available and these resists have been used in pilot production to make the most advanced integrated circuits with {le}0.35 {mu}m design rules. At Shipley, we have undertaken to develop both negative- and positive-tone chemically amplified resists for DUV lithography. These resists are capable of high resolution (0.3 {mu}m), fast photospeed ({le}30 mJ/sq. cm), and excellent etch resistance. This presentation will discuss the chemical and lithographic properties of the Shipley negative- and positive-tone DUV chemically amplified resists. General discussion of the importance of activation energy for the catalytic process, catalytic chain length, and environmental stability will be given.

  6. Parallel reservoir computing using optical amplifiers.

    Science.gov (United States)

    Vandoorne, Kristof; Dambre, Joni; Verstraeten, David; Schrauwen, Benjamin; Bienstman, Peter

    2011-09-01

    Reservoir computing (RC), a computational paradigm inspired on neural systems, has become increasingly popular in recent years for solving a variety of complex recognition and classification problems. Thus far, most implementations have been software-based, limiting their speed and power efficiency. Integrated photonics offers the potential for a fast, power efficient and massively parallel hardware implementation. We have previously proposed a network of coupled semiconductor optical amplifiers as an interesting test case for such a hardware implementation. In this paper, we investigate the important design parameters and the consequences of process variations through simulations. We use an isolated word recognition task with babble noise to evaluate the performance of the photonic reservoirs with respect to traditional software reservoir implementations, which are based on leaky hyperbolic tangent functions. Our results show that the use of coherent light in a well-tuned reservoir architecture offers significant performance benefits. The most important design parameters are the delay and the phase shift in the system's physical connections. With optimized values for these parameters, coherent semiconductor optical amplifier (SOA) reservoirs can achieve better results than traditional simulated reservoirs. We also show that process variations hardly degrade the performance, but amplifier noise can be detrimental. This effect must therefore be taken into account when designing SOA-based RC implementations.

  7. Application module of universal amplifier in education process

    OpenAIRE

    CHALOUPEK, Pavel

    2013-01-01

    This thesis deals with the teaching and implementation module for teaching in secondary schools and their role in education. Following the theory being discussed in relation to a valid educational program. Learning amplifier module implemented by the assignment to DPS. The activity of the amplifier module to simulate in Multisim simulation program. Next is made circuitry design in discrete amplifier module. There evaluated the feasibility and simulation of realizations amplifier module in sec...

  8. Noise and saturation properties of semiconductor quantum dot optical amplifiers

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper

    2002-01-01

    We present a detailed theoretical analysis of quantum dot optical amplifiers. Due to the presence of a reservoir of wetting layer states, the saturation and noise properties differ markedly from bulk or QW amplifiers and may be significantly improved.......We present a detailed theoretical analysis of quantum dot optical amplifiers. Due to the presence of a reservoir of wetting layer states, the saturation and noise properties differ markedly from bulk or QW amplifiers and may be significantly improved....

  9. Efficiency of low power audio amplifiers and loudspeakers

    OpenAIRE

    Burrow, SG; Grant, Duncan A

    2001-01-01

    In this paper we look at the load presented to audio amplifiers by real transducers. We consider the power losses in Class-AB and Class-D amplifier topologies, and determine that in order to predict efficiency it is necessary to consider the amplifier/transducer combination. The ability of the class-D amplifier to recycle quadrature load current offers new ways to improve efficiency.

  10. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  11. Intertied ac–ac microgrids with autonomous power import and export

    DEFF Research Database (Denmark)

    Nutkani, Inam Ullah; Loh, Poh Chiang; Wang, Peng;

    2015-01-01

    Intertied ac–ac microgrids offer many potential benefits like flexible frequency and voltage selection, reserve sharing and enhanced supply reliability. Operating them is however challenging due to their larger size and presence of more power converters with different responsibilities. These comp......Intertied ac–ac microgrids offer many potential benefits like flexible frequency and voltage selection, reserve sharing and enhanced supply reliability. Operating them is however challenging due to their larger size and presence of more power converters with different responsibilities....... These complexities can further be amplified when reliance on fast communication links is not permitted. To address these concerns, a new autonomous droop scheme is proposed here for managing intertied microgrids in either the islanded or grid-connected mode. The scheme prioritizes various power generation/transfer...

  12. Matched wideband low-noise amplifiers for radio astronomy.

    Science.gov (United States)

    Weinreb, S; Bardin, J; Mani, H; Jones, G

    2009-04-01

    Two packaged low noise amplifiers for the 0.3-4 GHz frequency range are described. The amplifiers can be operated at temperatures of 300-4 K and achieve noise temperatures in the 5 K range (radio astronomy systems or as i.f. amplifiers following superconducting mixers operating in the millimeter and submillimeter frequency range. PMID:19405681

  13. Digital system provides superregulation of nanosecond amplifier-discriminator circuit

    Science.gov (United States)

    Forges, K. G.

    1966-01-01

    Feedback system employing a digital logic comparator to detect and correct amplifier drift provides stable gain characteristics for nanosecond amplifiers used in counting applications. Additional anticoincidence logic enables application of the regulation circuit to the amplifier and discriminator while they are mounted in an operable circuit.

  14. The Dynamics of Semiconductor Optical Amplifiers – Modeling and Applications

    DEFF Research Database (Denmark)

    Mørk, Jesper; Nielsen, Mads Lønstrup; Berg, Tommy Winther

    2003-01-01

    The importance of semiconductor optical amplifiers is discussed. A semiconductor optical amplifier (SOA) is a semiconductor laser with anti-reflection coated facets that amplifies an injected light signal by means of stimulated emission. SOAs have a number of unique properties that open up...

  15. Fiber optical parametric amplifiers in optical communication systems

    DEFF Research Database (Denmark)

    Marhic, Michel E.; Andrekson, Peter A.; Petropoulos, Periklis;

    2015-01-01

    The prospects for using fiber optical parametric amplifiers (OPAs) in optical communication systems are reviewed. Phase-insensitive amplifiers (PIAs) and phase-sensitive amplifiers (PSAs) are considered. Low-penalty amplification at/or near 1 Tb/s has been achieved, for both wavelength- and time...

  16. Polarization of Tapered Semiconductor Travelling-Wave Amplifiers

    Institute of Scientific and Technical Information of China (English)

    焦明星; 张书练; 梁晋文

    2001-01-01

    The polarization of a tapered semi-conductor travelling-wave amplifier has been investigated with the transfer matrix method based on convective equation. It is shown that the apparent polarization mode competition exists, and polarization-independent tapered semiconductor travellingwave amplifiers can be obtained through the optimization of amplifier parameters.

  17. Analysis of multipass laser amplifier systems for storage laser media

    International Nuclear Information System (INIS)

    The performance characteristics of single pass and multipass storage laser amplifiers are presented and compared. The effects of the multipass amplifier parameters on the extraction characteristics are examined. For a wide range of conditions the multipass amplifier is found to provide high energy gain and high efficiency simultaneously. This is a significant advantage over the single pass laser amplifier. Finally, three specific storage laser amplifier systems, flashlamp pumped V:MgF2, XeF laser pumped Tm:Glass, and photolytically pumped Selenium, are examined. The performance characteristics for each of the three systems are calculated and compared

  18. Analysis of multipass laser amplifier systems for storage laser media

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, J.F.

    1980-03-25

    The performance characteristics of single pass and multipass storage laser amplifiers are presented and compared. The effects of the multipass amplifier parameters on the extraction characteristics are examined. For a wide range of conditions the multipass amplifier is found to provide high energy gain and high efficiency simultaneously. This is a significant advantage over the single pass laser amplifier. Finally, three specific storage laser amplifier systems, flashlamp pumped V:MgF/sub 2/, XeF laser pumped Tm:Glass, and photolytically pumped Selenium, are examined. The performance characteristics for each of the three systems are calculated and compared.

  19. Characterization of a Common-Gate Amplifier Using Ferroelectric Transistors

    Science.gov (United States)

    Hunt, Mitchell; Sayyah, Rana; MacLeod, Todd C.; Ho, Fat D.

    2011-01-01

    In this paper, the empirical data collected through experiments performed using a FeFET in the common-gate amplifier circuit is presented. The FeFET common-gate amplifier was characterized by varying all parameters in the circuit, such as load resistance, biasing of the transistor, and input voltages. Due to the polarization of the ferroelectric layer, the particular behavior of the FeFET common-gate amplifier presents interesting results. Furthermore, the differences between a FeFET common-gate amplifier and a MOSFET common-gate amplifier are examined.

  20. Characterization of a Common-Source Amplifier Using Ferroelectric Transistors

    Science.gov (United States)

    Hunt, Mitchell; Sayyah, Rana; MacLeond, Todd C.; Ho, Pat D.

    2010-01-01

    This paper presents empirical data that was collected through experiments using a FeFET in the established common-source amplifier circuit. The unique behavior of the FeFET lends itself to interesting and useful operation in this widely used common-source amplifier. The paper examines the effect of using a ferroelectric transistor for the amplifier. It also examines the effects of varying load resistance, biasing, and input voltages on the output signal and gives several examples of the output of the amplifier for a given input. The difference between a commonsource amplifier using a ferroelectric transistor and that using a MOSFET is addressed.

  1. Low power RF amplifier circuit for ion trap applications

    Science.gov (United States)

    Noriega, J. R.; García-Delgado, L. A.; Gómez-Fuentes, R.; García-Juárez, A.

    2016-09-01

    A low power RF amplifier circuit for ion trap applications is presented and described. The amplifier is based on a class-D half-bridge amplifier with a voltage mirror driver. The RF amplifier is composed of an RF class-D amplifier, an envelope modulator to ramp up the RF voltage during the ion analysis stage, a detector or amplitude demodulation circuit for sensing the output signal amplitude, and a feedback amplifier that linearizes the steady state output of the amplifier. The RF frequency is set by a crystal oscillator and the series resonant circuit is tuned to the oscillator frequency. The resonant circuit components have been chosen, in this case, to operate at 1 MHz. In testings, the class-D stage operated at a maximum of 78 mW at 1.1356 MHz producing 225 V peak.

  2. K-band FET amplifier for satellite downlink

    Science.gov (United States)

    Goel, J.; Cheung, R. P.

    1984-01-01

    State-of-the-art performance is demonstrated with solid-state amplifiers in K-band. The amplifier provides 8.2 watts of power with 39 dB gain over a frequency band of 1.4 GHz. Nonlinearity analyses of solid-state amplifiers suggest that system performance can be improved significantly by using an FET amplifier. Preliminary investigations reveal that the solid-state amplifiers can be space-qualified and can be expected to replace the TWTA in many communication links in the near future. It is pointed out that with improvements in device technology, the power, bandwidth and efficiency of solid-state amplifiers using FETs can be further improved. With FETs operating at a junction temperature of less than 125 C, solid-state amplifiers are inherently reliable, indicating a ten-year mean time to failure.

  3. Investigations of electronic amplifiers supplying a piezobimorph actuator

    Science.gov (United States)

    Milecki, Andrzej; Regulski, Roman

    2016-10-01

    Piezoelectric bending actuators, also known as bimorphs, are characterized by very good dynamic properties and by displacements in a range of a few millimeters. Therefore these actuators are used in a wide range of applications. However their usage is limited because they require supplying amplifiers with output voltage of about 200 V, which are rather expensive. This paper presents investigation results of such amplifiers with high voltage output. The model of a piezobending actuator is proposed and implemented in Matlab-Simulink software in order to simulate the behavior of the actuator supplied by the amplifiers. The simulation results are presented and compared with investigation results of high voltage amplifier used for supplying a piezoactuator. The influence of current limitation of operational amplifier on the actuator current is tested. Finally, a low cost audio power amplifier is proposed to control the piezobender actuator (as a cheaper alternative to the high-voltage amplifier) and its investigations results are presented in the paper.

  4. Time amplifying techniques towards atomic time resolution

    Institute of Scientific and Technical Information of China (English)

    LI JingZhen

    2009-01-01

    High speed imaging technology has opened applications in many fields,such as collision,detonating,high voltage discharge,disintegration and transfer of phonon and exciton in solid,photosynthesis primitive reaction,and electron dynamics inside atom shell.In principle,all of the transient processes need to be explained theoretically and,st the same time,the time amplifying technique is required for observations of these processes.The present review concerns the atomic time amplifying mechanism of optical information and the extremely-high speed imaging methods,which are expressed in terms of the short time amplifying techniques.It is well-known that for extremely-high speed imaging with the converter tube,the temporal resolution is in the order of sub-picosecond of the streak imaging,and the imaging frequency is 6×10~8-5×10~9 fps(frame per second)of the frame imaging.On the other hand,for the tubeless extremely-high speed imaging,the imaging frequency is 10~7-10~(14) fps,and its mechanism of forming high speed and framing could involve a lot of factors of the light under investigation,for instance,light speed,light parallelism,the parameters of light wave such as amplitude,phase,polarization and wavelength,and even quantum properties of photon.In the cascaded system of electromagnetic wave and particle wave,it is possible to simultaneously realize extremely-high resolution in time and space,which is higher than a kite resolution.Then it would be possible to break the limit of the Heisenberg uncertainty relation of the optical frequency band.

  5. Time amplifying techniques towards atomic time resolution

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    High speed imaging technology has opened applications in many fields,such as collision,detonating, high voltage discharge,disintegration and transfer of phonon and exciton in solid,photosynthesis primitive reaction,and electron dynamics inside atom shell.In principle,all of the transient processes need to be explained theoretically and,at the same time,the time amplifying technique is required for observations of these processes.The present review concerns the atomic time amplifying mechanism of optical information and the extremely-high speed imaging methods,which are expressed in terms of the short time amplifying techniques.It is well-known that for extremely-high speed imaging with the converter tube,the temporal resolution is in the order of sub-picosecond of the streak imaging,and the imaging frequency is 6×10 8 ―5×10 9 fps(frame per second)of the frame imaging.On the other hand,for the tubeless extremely-high speed imaging,the imaging frequency is 10 7 ―10 14 fps,and its mechanism of forming high speed and framing could involve a lot of factors of the light under investigation,for instance,light speed,light parallelism,the parameters of light wave such as amplitude,phase,polari- zation and wavelength,and even quantum properties of photon.In the cascaded system of electro- magnetic wave and particle wave,it is possible to simultaneously realize extremely-high resolution in time and space,which is higher than a kite resolution.Then it would be possible to break the limit of the Heisenberg uncertainty relation of the optical frequency band.

  6. High sensitivity amplifier/discriminator for PWC's

    International Nuclear Information System (INIS)

    The facility support group at Fermilab is designing and building a general purpose beam chamber for use in several locations at the laboratory. This pwc has 128 wires per plane spaced 1 mm apart. An initial production of 25 signal planes is anticipated. In proportional chambers, the size of the signal depends exponentially on the charge stored per unit of length along the anode wire. As the wire spacing decreases, the capacitance per unit length decreases, thereby requiring increased applied voltage to restore the necessary charge per unit length. In practical terms, this phenomenon is responsible for difficulties in constructing chambers with less than 2 mm wire spacing. 1 mm chambers, therefore, are frequently operated very near to their breakdown point and/or a high gain gas containing organic compounds such as magic gas is used. This argon/iso-butane mixture has three drawbacks: it is explosive when exposed to the air, it leaves a residue on the wires after extended use and is costly. An amplifier with higher sensitivity would reduce the problems associated with operating chambers with small wire spacings and allow them to be run a safe margin below their breakdown voltage even with an inorganic gas mixture such as argon/CO2, this eliminating the need to use magic gas. Described here is a low cost amplifier with a usable threshold of less than 0.5 μA. Data on the performance of this amplifier/discriminator in operation on a prototype beam chamber are given. This data shows the advantages of the high sensitivity of this design

  7. Undulations from amplified low frequency surface waves

    CERN Document Server

    Coutant, Antonin

    2012-01-01

    We study the scattering of gravity waves in longitudinal stationary flows. When the flow velocity becomes supercritical, counterflow propagating waves are amplified in such a way that, in the zero-frequency limit, the free surface develops an undu- lation, i.e., a zero-frequency wave of large amplitude with nodes located at specific places. From this, we show that the unperturbed flat surface is unstable against perturbations of arbitrary small amplitude. We then show that this instability also appears when treating low frequency waves by a stochastic ensemble. The relation between the generation of undulations and black hole radiation (the Hawking effect) is discussed.

  8. Envelope tracking power amplifiers for wireless communications

    CERN Document Server

    Wang, Zhancang

    2014-01-01

    Envelope tracking technology is seen as the most promising efficiency enhancement technology for RF power amplifiers for 4G and beyond wireless communications. More and more organizations are investing and researching on this topic with huge potential in academic and commercial areas.This is the first book on the market to offer complete introduction, theory, and design considerations on envelope tracking for wireless communications. This resource presents you with a full introduction to the subject and covers underlying theory and practical design considerations.

  9. A cryo-amplifier working in a double loop-flux locked loop scheme for SQUID readout of TES detectors

    Science.gov (United States)

    Torrioli, Guido; Bastia, Paolo; Piro, Luigi; Macculi, Claudio; Colasanti, Luca

    2010-07-01

    In this paper we report on a novel SQUID readout scheme, called Double Loop-Flux Locked loop (DL-FLL), that we are investigating in the frame of ASI and ESA technological development contracts. This scheme is based on the realization of a cryogenic amplifier which is used in order to readout TES detectors in the Frequency Division Multiplexing technique, where high loop-gain is required up to few MHz. Loop-gain in feedback systems is, usually, limited by the propagation delay of the signals traveling in the loop because of the distance between the feedback loop elements. This problem is particularly evident in the case of SQUID systems, where the elements of the feedback loop are placed both at cryogenic and room temperature. To solve this issue we propose a low power dissipation cryo-amplifier capable to work at cryogenic temperatures so that it can be placed close to the SQUID realizing a local cryogenic loop. The adoption of the DL-FLL scheme allows to simplify considerably the cryo-amplifier which, being AC-coupled, don't require the features of a precision DC-coupled amplifier and can be made with a limited number of electronic components and with a consequent reduction of power dissipation.

  10. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  11. Silicon on Insulator MESFETs for RF Amplifiers.

    Science.gov (United States)

    Wilk, Seth J; Balijepalli, Asha; Ervin, Joseph; Lepkowski, William; Thornton, Trevor J

    2010-03-01

    CMOS compatible, high voltage SOI MESFETs have been fabricated using a standard 3.3V CMOS process without any changes to the process flow. A 0.6μm gate length device operates with a cut-off frequency of 7.3GHz and a maximum oscillation frequency of 21GHz. There is no degradation in device performance up to its breakdown voltage, which greatly exceeds that of CMOS devices on the same process. Other figures of merit of relevance to RF front-end design are presented, including the maximum stable gain and noise figure. An accurate representation of the device in SPICE has been developed using the commercially available TOM3 model. Using the SOI MESFET model, a source degenerated low noise RF amplifier targeting operation near 1GHz has been designed. The amplifier was fabricated on a PCB board and operates at 940MHz with a minimum NF of 3.8dB and RF gain of 9.9dB while only consuming 5mW of DC power. PMID:20657816

  12. Design criteria for ultrafast optical parametric amplifiers

    Science.gov (United States)

    Manzoni, C.; Cerullo, G.

    2016-10-01

    Optical parametric amplifiers (OPAs) exploit second-order nonlinearity to transfer energy from a fixed frequency pump pulse to a variable frequency signal pulse, and represent an easy way of tuning over a broad range the frequency of an otherwise fixed femtosecond laser system. OPAs can also act as broadband amplifiers, transferring energy from a narrowband pump to a broadband signal and thus considerably shortening the duration of the pump pulse. Due to these unique properties, OPAs are nowadays ubiquitous in ultrafast laser laboratories, and are employed by many users, such as solid state physicists, atomic/molecular physicists, chemists and biologists, who are not experts in ultrafast optics. This tutorial paper aims at providing the non-specialist reader with a self-consistent guide to the physical foundations of OPAs, deriving the main equations describing their performance and discussing how they can be used to understand their most important working parameters (frequency tunability, bandwidth, pulse energy/repetition rate scalability, control over the carrier-envelope phase of the generated pulses). Based on this analysis, we derive practical design criteria for OPAs, showing how their performance depends on the type of the nonlinear interaction (crystal type, phase-matching configuration, crystal length), on the characteristics of the pump pulse (frequency, duration, energy, repetition rate) and on the OPA architecture.

  13. Ultrastable low-noise current amplifier

    CERN Document Server

    Drung, Dietmar; Becker, Ulrich; Scherer, Hansjörg; Ahlers, Franz Josef

    2014-01-01

    An ultrastable low-noise current amplifier (ULCA) is presented. The ULCA is a non-cryogenic instrument based on specially designed operational amplifiers and resistor networks. It involves two stages, the first providing a 1000-fold current gain and the second performing a current-to-voltage conversion via an internal 1 MOhm reference resistor or, optionally, an external standard resistor. The ULCA's transfer coefficient is extremely stable versus time, temperature and current amplitude within the full dynamic range of +/-5 nA. A low noise level of 2.4 fA/sqrt(Hz) helps to keep averaging times low at small input currents. A cryogenic current comparator is used to calibrate both input current gain and output transresistance, providing traceability to the quantum Hall effect. Typically, within one day after calibration, the uncertainty contribution from short-term fluctuations of the transresistance is below one part in 10^7. The long-term stability is expected to be better than one part in 10^5 over a year. A ...

  14. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  15. Electromechanical and Dynamic Characterization of In-House-Fabricated Amplified Piezo Actuator

    Directory of Open Access Journals (Sweden)

    P. K. Panda

    2012-01-01

    Full Text Available A diamond-shaped amplified piezo actuator (APA fabricated using six multilayered piezo stacks with maximum displacement of 173 μm at 175 V and the amplification factor of 4.3. The dynamic characterization of the actuator was carried out at different frequencies (100 Hz–1 kHz and at different AC voltages (20 V–40 V. The actuator response over this frequency range was found neat, without attenuation of the signal. Numerical modeling of multilayered stack actuator was carried out using empirical equations, and the electromechanical analysis was carried out using ABAQUS software. The block force of the APA was 81 N, calculated by electromechanical analysis. This is similar to that calculated by dynamic characterization method.

  16. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  17. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  18. A tunable microstrip SQUID amplifier for the Axion Dark Matter eXperiment (ADMX)

    Science.gov (United States)

    O'Kelley, Sean; Hansen, Jorn; Weingarten, Elan; Mueck, Michael; Hilton, Gene; Clarke, John

    2014-03-01

    We describe a microstrip SQUID (Superconducting QUantum Interference Device) amplifier (MSA) used as the photon detector in the Axion Dark Matter eXperiment (ADMX). Cooled to 100 mK or lower, an optimized MSA approaches the quantum limit of detection. The axion dark matter is detected via Primakoff conversion to a microwave photon in a high-Q (~ 105) tunable microwave cavity, currently cooled to about 1.6 K, in the presence of a 7-tesla magnetic field. The MSA consists of a square loop of thin Nb film, incorporating two Josephson tunnel junctions with resistive shunts to prevent hysteresis in the current-voltage characteristic. The microstrip is a square Nb coil deposited over an intervening insulating layer. Since the photon frequency is determined by the unknown axion mass, the cavity and amplifier must be tunable over a broad frequency range. Tunability is achieved by terminating the microstrip with a GaAs varactor diode with a voltage-controlled capacitance that enables us to vary the resonance from nearly 1/2 to 1/4 of a wavelength. With the SQUID current-biased in the voltage state, we demonstrate a gain of typically 20 dB over nearly one octave, 415 MHz to 800 MHz. Supported by DOE Grants DE-FG02-97ER41029, DE-FG02-96ER40956, DE-AC52-07NA27344, DE-AC03-76SF00098, NSF grants PHY-1067242 and PHY-1306729, and the Livermore LDRD program.

  19. Improved tunable microstrip SQUID amplifiers for the Axion Dark Matter eXperiment

    Science.gov (United States)

    O'Kelley, Sean; Hansen, Jørn; Hilton, Gene; Mol, Jan-Michael; Clarke, John; ADMX Collaboration

    2015-04-01

    We describe a series of tunable microstrip SQUID (Superconducting QUantum Interference Device) amplifiers (MSAs) used as the photon detector in the Axion Dark Matter eXperiment (ADMX). Cooled to 100mK or lower, an optimized MSA approaches the quantum limit of detection. The axion dark matter candidate would be detected via Primakoff conversion to a microwave photon in a high-Q (~ 105) tunable microwave cavity, cooled to 1.6 K or lower, in the presence of a 7-tesla magnetic field. The MSA consists of a square loop of thin Nb film, incorporating two resistively shunted Josephson tunnel junctions biased to the voltage state, flux-coupled to a resonant microstrip. The photon frequency is determined by the unknown axion mass, so the cavity and amplifier must be tunable over a broad frequency range. MSA tunability is achieved by terminating the microstrip with a GaAs varactor diode that operates at cryogenic temperatures. This voltage-controlled capacitance enables us to vary the resonant microstrip mode from nearly λ/2 to λ/4. We demonstrate gains exceeding 20 dB, at frequencies above 900 MHz. With proper design of the microwave environment, a noise temperature of 1/2 to 1/4 of the physical temperature is demonstrated. Supported by DOE Grants DE-FG02-97ER41029, DE-FG02-96ER40956, DE- AC52-07NA27344, DE-AC03-76SF00098, NSF Grant 1067242, and the Livermore LDRD program.

  20. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    OpenAIRE

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  1. AC Read-Out Circuits for Single Pixel Characterization of TES Microcalorimeters and Bolometers

    Science.gov (United States)

    Gottardi, L.; van de Kuur, J.; Bandler, S.; Bruijn, M.; de Korte, P.; Gao, J. R.; den Hartog, R.; Hijmering, R. A.; Hoevers, H.; Koshropanah, P.; Kilbourne, C.; Lindemann, M. A.; Parra Borderias, M.; Ridder, M.

    2011-01-01

    SRON is developing Frequency Domain Multiplexing (FDM) for the read-out of transition edge sensor (TES) soft x-ray microcalorimeters for the XMS instrument of the International X-ray Observatory and far-infrared bolometers for the SAFARI instrument on the Japanese mission SPICA. In FDM the TESs are AC voltage biased at frequencies from 0.5 to 6 MHz in a superconducting LC resonant circuit and the signal is read-out by low noise and high dynamic range SQUIDs amplifiers. The TES works as an amplitude modulator. We report on several AC bias experiments performed on different detectors. In particular, we discuss the results on the characterization of Goddard Space Flight Center x-ray pixels and SRON bolometers. The paper focuses on the analysis of different read-out configurations developed to optimize the noise and the impedance matching between the detectors and the SQUID amplifier. A novel feedback network electronics has been developed to keep the SQUID in flux locked loop, when coupled to superconducting high Q circuits, and to optimally tune the resonant bias circuit. The achieved detector performances are discussed in view of the instrument requirement for the two space missions.

  2. Direct coupled amplifiers using field effect transistors

    International Nuclear Information System (INIS)

    The concept of the uni-polar field effect transistor (P.E.T.) was known before the invention of the bi-polar transistor but it is only recently that they have been made commercially. Being produced as yet only in small quantities, their price imposes a restriction on use to circuits where their peculiar properties can be exploited to the full. One such application is described here where the combination of low voltage drift and relatively low input leakage current are necessarily used together. One of the instruments used to control nuclear reactors has a logarithmic response to the mean output current from a polarised ionisation chamber. The logarithmic signal is then differentiated electrically, the result being displayed on a meter calibrated to show the reactor divergence or doubling time. If displayed in doubling time the scale is calibrated reciprocally. Because of the wide range obtained in the logarithmic section and the limited supply voltage, an output of 1 volt per decade change in ionisation current is used. Differentiating this gives a current of 1.5 x 10-8 A for p.s.D. (20 sec. doubling time) in the differentiating amplifier. To overcome some of the problems of noise due to statistical variations in input current, the circuit design necessitates a resistive path to ground at the amplifier input of 20 M.ohms. A schematic diagram is shown. 1. It is evident that a zero drift of 1% can be caused by a leakage current of 1.5 x 10-10 A or an offset voltage of 3 mV at the amplifier input. Although the presently used electrometer valve is satisfactory from the point of view of grid current, there have been sudden changes in grid to grid voltage (the valve is a double triode) of up to 10 m.V. It has been found that a pair of F.E.T's. can be used to replace the electrometer valve so long as care is taken in correct balance of the two devices. An investigation has been made into the characteristics of some fourteen devices to see whether those with very different

  3. Design and development of switch mode power supply for 3.0 kW solid state RF amplifier

    International Nuclear Information System (INIS)

    A 3 kW Solid State Amplifier (SSA) has been indigenously designed and developed for a 37.8 MHz re- buncher of The Rare Ion Beam (RIB) facility at VECC. This power amplifier of 3.0 kW at 37.8 MHz has been designed and developed with combining of four amplifier modules of 800 W. The maximum requirement of voltage and current to drive the each amplifier module is 50 V and 30 A. A DC power supply (rated 55V/150A) has been designed and developed indigenously at VECC Kolkata for biasing of this amplifier system. This is current/voltage controlled (cv/cc) switched mode power supply, it works on the principle of pulse width modulation technique using buck converter topology and regulated by using PI controller with require phase and gain margin. In this power supply three phase line voltage (415V, 50Hz.) is fed to three phase step down transformer to achieve 55 volt AC, this AC voltage rectified with 3-phase full wave rectifier and filtered with LC filter to get around 74V DC. The rectified output is switched at high frequency (20 KHz) by buck converter circuit by using IGBT as a switching element to get pulsating DC. LC filter is used for smoothing the pulsating DC to obtain 55V DC at output. The voltage regulation is achieved by comparing the sampled output voltage with stable reference voltage. The error signal is fed to the built in error amplifier of PWM IC (SG 3525) which in terms varies the duty cycle depending upon error signal, which drive IGBT through Opto-isolator (TLP 250). For current control a shunt resistance is used as a feedback in series with the load. The simulation is performed in MATLAB and PSIM both in order to utilize the high end computational mechanics from MATLAB and special power electronics featured of PSIM. The experimental result is presented for the verification of mathematical analysis. In this paper, circuit topology, function of system components, key system specifications and experimental result of power supply are discussed. (author)

  4. Eddy Current Rail Inspection Using AC Bridge Techniques.

    Science.gov (United States)

    Liu, Ze; Koffman, Andrew D; Waltrip, Bryan C; Wang, Yicheng

    2013-01-01

    AC bridge techniques commonly used for precision impedance measurements have been adapted to develop an eddy current sensor for rail defect detection. By using two detection coils instead of just one as in a conventional sensor, we can balance out the large baseline signals corresponding to a normal rail. We have significantly enhanced the detection sensitivity of the eddy current method by detecting and demodulating the differential signal of the two coils induced by rail defects, using a digital lock-in amplifier algorithm. We have also explored compensating for the lift-off effect of the eddy current sensor due to vibrations by using the summing signal of the detection coils to measure the lift-off distance. The dominant component of the summing signal is a constant resulting from direct coupling from the excitation coil, which can be experimentally determined. The remainder of the summing signal, which decreases as the lift-off distance increases, is induced by the secondary eddy current. This dependence on the lift-off distance is used to calibrate the differential signal, allowing for a more accurate characterization of the defects. Simulated experiments on a sample rail have been performed using a computer controlled X-Y moving table with the X-axis mimicking the train's motion and the Y-axis mimicking the train's vibrational bumping. Experimental results demonstrate the effectiveness of the new detection method. PMID:26401427

  5. Gender Differences on the Use of Amplifiers in Academic Writings

    Institute of Scientific and Technical Information of China (English)

    申利芬

    2012-01-01

      This study aims to investigate the use of amplifiers in term of gender and disciplinary groups in academic research arti⁃cles, which is based on the British Academic Written English Corpus (BAWE).18 amplifiers were examined across two dimen⁃sions:gender and disciplinary groups. The results show amplifiers are more common in males’ academic writings than in those of females in general, amplifiers are used more often in AH discipline. However, not all amplifiers show significant gender differ⁃ences between men and women. Six words show a significant difference between male and female writers:pretty, by far, perfect⁃ly, quite, a great deal, totally, which are used more often by males. However, the interesting is in LS discipline, most amplifiers are used more often by female than male writers and males tend to use by far more frequently than females.

  6. ANALYSIS OF INTERNALLY GENERATED NOISE OF BIOELECTRIC AMPLIFIERS

    Institute of Scientific and Technical Information of China (English)

    Mashhour Mustafa; Bani Amer

    2003-01-01

    This paper deals with internally generated noise of bioelectric amplifiers that are usually used for processing of bioelectric events. The main purpose of this paper is to present a procedure for analysis of the effects of internal noise generated by the active circuits and to evaluate the output noise of the author's new designed bioelectric amplifier that caused by internal effects to the amplifier circuit itself in order to compare it with the noise generated by conventional amplifiers. The obtained analysis results of internally generated noise showed that the total output noise of bioelectric active circuits does not increase when some of their resistors have a larger value. This behavior is caused by the different transfer functions for the signal and the respective noise sources associated with these resistors. Moreover, the new designed bioelectric amplifier has an output noise less than that for conventional amplifiers. The obtained analysis results were also experimentally verified and the final conclusions were drawn.

  7. Measurement of microdosimetric spectra using an amplifier with logarithmic response

    International Nuclear Information System (INIS)

    A 3-1/2 decade logarithmic pulse amplifier was developed for use in microdosimetry. A block diagram of the instrument is given. The input shaping amplifier is designed to accept output pulses from a charge sensitive preamplifier with a maximum full scale amplitude of 8 volts. Output of the shaping amplifier is a bipolar, positive lobe leading RC shaped pulse with a maximum linear range approximately 200 millivolts. Following the logarithmic converter is a voltage amplifier which is used to increase the signal level before it is applied through the linear gate to the output buffer-amplifier. The signal at the output connector is a positive pulse compatible with most conventional pulse height analyzers. The gain of the linear amplifier is adjustable over 10 to 1 range by means of front panel controls

  8. Josephson parametric amplifiers for the ADMX-HF experiment

    Science.gov (United States)

    Malnou, Maxime; Palken, Daniel; Hilton, Gene; Vale, Leila; Lehnert, Konrad

    2016-03-01

    Dark matter search in the ADMX-HF experiment aims at detecting power generated by the axion-photon conversion, of a few hundred of yoctowatts, in the 4 - 12 GHz band. The sensitivity of detection directly depends on the amplifier noise temperature, and therefore requires state of the art microwave amplifiers. In contrast to amplifiers with dissipation on-chip, superconducting Josephson parametric amplifiers (JPA) reach and even circumvent the quantum limit. Over the past years, we have developed JPAs fabricated with arrays of superconducting quantum interference devices. Their gain, bandwidth and tunability are particularly well suited for efficient amplification in the band of interest. In this talk we will present numerical modeling of the behavior of our amplifiers, along with the first results from new designs that cover the 4-12 GHz band. Finally, we will present the ongoing work to increase the gain-bandwidth product and gain stability of our amplifiers.

  9. Low-noise amplifiers for satellite communications

    Science.gov (United States)

    Whelehan, J.

    1984-02-01

    It is pointed out that over the past several years significant advances have been made in the overall capability of both microwave and mm-wave receivers. This is particularly apparent in the telecom market. Integral parts of advanced receiver technology are low-noise receivers. The advances currently being achieved in low-noise technology are partly based on developments in GaAs semiconductor technology. The development of high-cutoff-frequency beam lead mixer diodes has led to the development of mm-wave low-noise mixers with excellent low-noise capability. The advanced techniques are now being employed in field-deployable systems. Low noise is an important factor in satellite communications applications. Attention is given to C-band fixed satellite service, C-band parametric amplifiers, C-band FET, and X band, the Ku band, and the 30/20 GHz band.

  10. Gain Characteristics of Fiber Optical Parametric Amplifier

    Institute of Scientific and Technical Information of China (English)

    高明义; 姜淳; 胡卫生

    2004-01-01

    The theory model of fiber optical parametric amplifier (FOPA) was introduced, which is based on optical nonlinear effect. And then numerical simulation was done to analyze and discuss the gain spectral characteristics of one-pump and two-pump FOPA. The results show that for one-pump FOPA, when pump wavelength is near to fiber zero-dispersion wavelength(ZDW), the gain flatness is better, and with the increase of the pump power, fiber length and its nonlinear coefficient, the gain value will increase while the gain bandwidth will become narrow. For two-pump FOPA, when the pump central wavelength is near to fiber ZDW, the gain flatness is better. Moreover, by decreasing the space of two pumps wavelength, the gain flatness can be improved. Finally, some problems existing in FOPA were addressed.

  11. The spectacular human nose: An amplifier of individual quality?

    OpenAIRE

    Åse Kristine Rognmo Mikalsen; Ivar Folstad; Nigel Gilles Yoccoz; Bruno Laeng

    2014-01-01

    Amplifiers are signals that improve the perception of underlying differences in quality. They are cost free and advantageous to high quality individuals, but disadvantageous to low quality individuals, as poor quality is easier perceived because of the amplifier. For an amplifier to evolve, the average fitness benefit to the high quality individuals should be higher than the average cost for the low quality individuals. The human nose is, compared to the nose of most other primates, extraordi...

  12. Thermodynamic indistinguishability and field state fingerprint of quantum optical amplifiers

    OpenAIRE

    Perl, Yossi; Band, Yehuda B.; Boukobza, Erez

    2016-01-01

    Dissipation tends to wash out dynamical features observed at early evolution times. In this paper we analyze a resonant single--atom two--photon quantum optical amplifier both dynamically and thermodynamically. A detailed thermodynamic balance shows that the non--linear amplifier is thermodynamically equivalent to the linear amplifier discussed in (Phys. Rev. A, 74 (2006), 063822). However, by calculating the Wigner quasi--probability distribution for various initial field states, we show tha...

  13. Modeling and design techniques for RF power amplifiers

    CERN Document Server

    Raghavan, Arvind; Laskar, Joy

    2008-01-01

    The book covers RF power amplifier design, from device and modeling considerations to advanced circuit design architectures and techniques. It focuses on recent developments and advanced topics in this area, including numerous practical designs to back the theoretical considerations. It presents the challenges in designing power amplifiers in silicon and helps the reader improve the efficiency of linear power amplifiers, and design more accurate compact device models, with faster extraction routines, to create cost effective and reliable circuits.

  14. A high performance switching audio amplifier using sliding mode control

    OpenAIRE

    Pillonnet, Gael; Cellier, Rémy; Abouchi, Nacer; Chiollaz, Monique

    2008-01-01

    International audience The switching audio amplifiers are widely used in various portable and consumer electronics due to their high efficiency, but suffers from low audio performances due to inherent nonlinearity. This paper presents an integrated class D audio amplifier with low consumption and high audio performances. It includes a power stage and an efficient control based on sliding mode technique. This monolithic class D amplifier is capable of delivering up to 1W into 8Ω load at les...

  15. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  16. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  17. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  18. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  19. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... COMMISSION ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission (``Commission...''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b)(2) of the..., owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  20. Saturation effects in degenerate phase sensitive fiber optic parametric amplifiers

    OpenAIRE

    Kakande J.; Parmigiani F.; Slavik R.; Gruner-Nielsen L.; Jakobsen D.; Herstrom S.; Petropoulos P.; Richardson D.J.

    2010-01-01

    We experimentally study saturation effects in degenerate phase sensitive amplifiers, revealing and explaining a gain regime suitable for all-optical signal processing functions such as phase regeneration.

  1. Parametric Amplifiers for Microwave Kinectic Inductance Detector (MKID) Readout Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Find numerical solutions to the non-linear partial differential equations describing our amplifier transmission lines. Optimize periodic choke structure to block...

  2. Dual Band High Efficiency Power Amplifier Based on CRLH Lines

    Directory of Open Access Journals (Sweden)

    D. Segovia-Vargas

    2009-12-01

    Full Text Available In this paper we propose the use of Composite Right/Left Hand (CRLH and Extended Composite Right/Left Hand (ECRLH transmission lines for the design of dual band high efficiency power amplifiers working in CE class. The harmonic termination can be synthesized using the meta-lines is particularly suitable for CE class amplifiers, which have a termination not as sensitive to the third harmonic as F class amplifier. This paper presents the design procedure and the design equations. The nonlinear phase response of a CRLH and ECRLH transmission line has been utilized to design arbitrary dual-band amplifiers.

  3. Nylon Sleeve for Cavity Amplifier Holds Tuning Despite Heat

    Science.gov (United States)

    Derr, Lloyd

    1964-01-01

    The problem: Detuning of cavity amplifiers with change in temperature. This results in deterioration of the performance of the amplifier at its design frequency. In cavity amplifiers and filters it is desirable that constant performance be maintained regardless of thermal changes. These changes often cause an "off resonance shift" in a cavity filter and a deterioration of performance in a cavity amplifier. The solution: Mount the tuning probe in a nylon sleeve. Thermal expansion and contraction of the nylon nullifies unwanted capacitive and inductive changes in the resonant elements.

  4. Compensation of pulse-distortion in saturated laser amplifiers.

    Science.gov (United States)

    Schimpf, Damian N; Ruchert, Clemens; Nodop, Dirk; Limpert, Jens; Tünnermann, Andreas; Salin, Francois

    2008-10-27

    We derive an expression describing pre-compensation of pulse-distortion due to saturation effects in short pulse laser-amplifiers. The analytical solution determines the optimum input pulse-shape required to obtain any arbitrary target pulse-shape at the output of the saturated laser-amplifier. The relation is experimentally verified using an all-fiber amplifier chain that is seeded by a directly modulated laser-diode. The method will prove useful in applications of high power, high energy laser-amplifier systems that need particular pulse-shapes to be efficient, e.g. micromachining and scientific laser-matter-interactions. PMID:18958044

  5. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  6. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  7. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  8. X-Band, 17-Watt Solid-State Power Amplifier

    Science.gov (United States)

    Mittskus, Anthony; Stone, Ernest; Boger, William; Burgess, David; Honda, Richard; Nuckolls, Carl

    2005-01-01

    An advanced solid-state power amplifier that can generate an output power of as much as 17 W at a design operating frequency of 8.4 GHz has been designed and constructed as a smaller, lighter, less expensive alternative to traveling-wave-tube X-band amplifiers and to prior solid-state X-band power amplifiers of equivalent output power. This amplifier comprises a monolithic microwave integrated circuit (MMIC) amplifier module and a power-converter module integrated into a compact package (see Figure 1). The amplifier module contains an input variable-gain amplifier (VGA), an intermediate driver stage, a final power stage, and input and output power monitors (see Figure 2). The VGA and the driver amplifier are 0.5-m GaAs-based metal semiconductor field-effect transistors (MESFETs). The final power stage contains four parallel high-efficiency, GaAs-based pseudomorphic high-electron-mobility transistors (PHEMTs). The gain of the VGA is voltage-variable over a range of 10 to 24 dB. To provide for temperature compensation of the overall amplifier gain, the gain-control voltage is generated by an operational-amplifier circuit that includes a resistor/thermistor temperature-sensing network. The driver amplifier provides a gain of 14 dB to an output power of 27 dBm to drive the four parallel output PHEMTs, each of which is nominally capable of putting out as much as 5 W. The driver output is sent to the input terminals of the four parallel PHEMTs through microstrip power dividers; the outputs of these PHEMTs are combined by microstrip power combiners (which are similar to the microstrip power dividers) to obtain the final output power of 17 W.

  9. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  10. Ferroelectric Field-Effect Transistor Differential Amplifier Circuit Analysis

    Science.gov (United States)

    Phillips, Thomas A.; MacLeod, Todd C.; Ho, Fat D.

    2008-01-01

    There has been considerable research investigating the Ferroelectric Field-Effect Transistor (FeFET) in memory circuits. However, very little research has been performed in applying the FeFET to analog circuits. This paper investigates the use of FeFETs in a common analog circuit, the differential amplifier. The two input Metal-Oxide-Semiconductor (MOS) transistors in a general MOS differential amplifier circuit are replaced with FeFETs. Resistors are used in place of the other three MOS transistors. The FeFET model used in the analysis has been previously reported and was based on experimental device data. Because of the FeFET hysteresis, the FeFET differential amplifier has four different operating modes depending on whether the FeFETs are positively or negatively polarized. The FeFET differential amplifier operation in the different modes was analyzed by calculating the amplifier voltage transfer and gain characteristics shown in figures 2 through 5. Comparisons were made between the FeFET differential amplifier and the standard MOS differential amplifier. Possible applications and benefits of the FeFET differential amplifier are discussed.

  11. Phase Sensitive Amplifier Based on Ultrashort Pump Pulses

    CERN Document Server

    Gershikov, Alexander

    2016-01-01

    We demonstrate a narrow band phase sensitive amplifier in the pump degenerate configuration which employs ps pump pulses. Control of the amplifier bandwidth is achieved via changes of the pump spectral width. A phase sensitive gain between -6 and 6 decibels, with an overall system gain of 28dB was demonstrated.

  12. Externally pumped millimeter-wave Josephson-junction parametric amplifier

    DEFF Research Database (Denmark)

    Levinsen, M.T; Pedersen, Niels Falsig; Sørensen, Ole;

    1980-01-01

    A unified theory of the singly and doubly degenerate Josephson-junction parametric amplifier is presented. Experiments with single junctions on both amplifier modes at frequencies 10, 35, and 70 GHz are discussed. Low-noise temperature (∼100 K, single sideband (SSB)) and reasonable gain (∼8 dB) w...

  13. Efficient performance simulation of class D amplifier output stages

    DEFF Research Database (Denmark)

    Nyboe, Flemming; Risbo, Lars; Andreani, Pietro

    2005-01-01

    Straightforward simulation of amplifier distortion involves transient simulation of operation on a sine wave input signal, and a subsequent FFT of the output voltage. This approach is very slow on class D amplifiers, since the switching behavior forces simulation time steps that are many orders...

  14. Saturation and noise properties of quantum-dot optical amplifiers

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper

    2004-01-01

    Based on extensive numerical calculations, quantum-dot (QD) amplifiers are predicted to offer higher output power and lower noise figure compared to bulk as well as quantum well amplifiers. The underlying physical mechanisms are analyzed in detail, leading to the identification of a few key requi...

  15. Subjective test of class D amplifiers without output filter

    DEFF Research Database (Denmark)

    Agerkvist, Finn T.; Fenger, Lars M.

    2004-01-01

    This paper presents the results of subjective listening tests designed to determine whether the output filter on class D amplifiers used in active loudspeakers can be omitted without audible errors occurring. The frequency range of the amplifiers was limited to 0-3 kHz corresponding to a woofer...

  16. External Peltier Cooler For Low-Noise Amplifier

    Science.gov (United States)

    Soper, Terry A.

    1990-01-01

    Inexpensive Peltier-effect cooling module made of few commercially available parts used to reduce thermal noise in microwave amplifier. Retrofitted to almost any microwave low-noise amplifier or receiver preamplifier used in communication, telemetry, or radar. Includes copper or aluminum cold plate held tightly against unit to be cooled by strap-type worm-gear clamps.

  17. Design and Analysis of Hybrid CMOS SRAM Sense Amplifier

    Directory of Open Access Journals (Sweden)

    Karishma Bajaj

    2012-03-01

    Full Text Available Sense amplifiers are one of the very important peripheral components of CMOS memories. In a Hybrid Sense amplifier both current and voltage sensing techniques are used which makes it a better selection than a conventional current or voltage sense amplifiers. The hybrid sense amplifier works in three phases-Offset cancellation (200ps, Access phase (500ps and Evaluation phase. The offset cancellation is done simultaneously with word line decoding, so as to speed up the process. The sensing range of the hybrid sense amplifier is improved from 1.18mV to 92mV. Also hybrid sense amplifier consumes very low energy of about 6.84fj. This sense amplifier is analyzed with a column of 512 SRAM cells at 180nm technology node and compared to CMOS conventional voltage sense amplifier. The circuit consumes an average power of 1.57 µW with a negligible offset of 149.3µV.

  18. Gain characteristics of a saturated fiber optic parametric amplifier

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Lorenzen, Michael Rodas; Noordegraaf, Danny;

    2008-01-01

    In this work we discuss saturation performance of a fiber optic parametric amplifier. A simple numerical model is described and applied to specific cases. A system experiment using a saturated amplifier illustrates a 4 dB improvement in required signal to noise ratio for a fixed bit error ratio....

  19. Power Amplifier Design for E-band Wireless System Communications

    DEFF Research Database (Denmark)

    Hadziabdic, Dzenan; Krozer, Viktor; Johansen, Tom Keinicke

    2008-01-01

    a power amplifier design satisfying the E-band system specifications. The designed power amplifier achieves a maximum output power of ges 20 dBm with a state-of-the-art power-added efficiency of 15%. The power is realized using InP DHBT technology. To the best of our knowledge it is the highest output...

  20. Series-Tuned High Efficiency RF-Power Amplifiers

    DEFF Research Database (Denmark)

    Vidkjær, Jens

    2008-01-01

    An approach to high efficiency RF-power amplifier design is presented. It addresses simultaneously efficiency optimization and peak voltage limitations when transistors are pushed towards their power limits.......An approach to high efficiency RF-power amplifier design is presented. It addresses simultaneously efficiency optimization and peak voltage limitations when transistors are pushed towards their power limits....

  1. Optically amplifying planar glass waveguides: Laser on a chip

    DEFF Research Database (Denmark)

    Guldberg-Kjær, Søren Andreas

    The objective of this work was to devlop optically amplifying planar wavguides, using erbium-doped germano-silicate glass films deposited by PECVD (Plasma Enhanced Chemical Vapour Deposition). The waveguides should exhibit enough gain to be useful as optical amplifiers in integrated planar lightw...

  2. Implantable neurotechnologies: a review of integrated circuit neural amplifiers.

    Science.gov (United States)

    Ng, Kian Ann; Greenwald, Elliot; Xu, Yong Ping; Thakor, Nitish V

    2016-01-01

    Neural signal recording is critical in modern day neuroscience research and emerging neural prosthesis programs. Neural recording requires the use of precise, low-noise amplifier systems to acquire and condition the weak neural signals that are transduced through electrode interfaces. Neural amplifiers and amplifier-based systems are available commercially or can be designed in-house and fabricated using integrated circuit (IC) technologies, resulting in very large-scale integration or application-specific integrated circuit solutions. IC-based neural amplifiers are now used to acquire untethered/portable neural recordings, as they meet the requirements of a miniaturized form factor, light weight and low power consumption. Furthermore, such miniaturized and low-power IC neural amplifiers are now being used in emerging implantable neural prosthesis technologies. This review focuses on neural amplifier-based devices and is presented in two interrelated parts. First, neural signal recording is reviewed, and practical challenges are highlighted. Current amplifier designs with increased functionality and performance and without penalties in chip size and power are featured. Second, applications of IC-based neural amplifiers in basic science experiments (e.g., cortical studies using animal models), neural prostheses (e.g., brain/nerve machine interfaces) and treatment of neuronal diseases (e.g., DBS for treatment of epilepsy) are highlighted. The review concludes with future outlooks of this technology and important challenges with regard to neural signal amplification.

  3. Frequency-Offset Cartesian Feedback Based on Polyphase Difference Amplifiers

    OpenAIRE

    Zanchi, Marta G.; Pauly, John M.; Scott, Greig C

    2010-01-01

    A modified Cartesian feedback method called “frequency-offset Cartesian feedback” and based on polyphase difference amplifiers is described that significantly reduces the problems associated with quadrature errors and DC-offsets in classic Cartesian feedback power amplifier control systems.

  4. Ultrafast Dynamics of Quantum-Dot Semiconductor Optical Amplifiers

    DEFF Research Database (Denmark)

    Poel, Mike van der; Hvam, Jørn Märcher

    2007-01-01

    We report on a series of experiments on the dynamical properties of quantum-dot semiconductor optical amplifiers. We show how the amplifier responds to one or several ultrafast (170 fs) pulses in rapid succession and our results demonstrate applicability and ultimate limitations to application...

  5. Variable-Voltage Class-E Power Amplifiers

    NARCIS (Netherlands)

    Acar, Mustafa; Annema, Anne Johan; Nauta, Bram

    2007-01-01

    The Class-E power amplifier is widely used due to its high efficiency, resulting from switching at zero voltage and zero slope of the switch voltage. In this paper, we extend general analytical solutions for the Class-E power amplifier to the ideal single-ended Variable-Voltage Class-E (Class-EVV) p

  6. Optimisation of High-Power Amplifiers using non linear models

    NARCIS (Netherlands)

    Hek, A.P. de; Bogaart, F.L.M. van den

    1999-01-01

    This paper identifies the areas where the use of non-linear simulations for the design of high-power amplifiers is useful. The identified areas are: operating class selection, determination source and load impedance for matching network design, overall amplifier simulations and stability analysis un

  7. A Power Efficient Audio Amplifier Combining Switching and Linear Techniques

    NARCIS (Netherlands)

    Zee, van der R.A.R.; Tuijl, van A.J.M.

    1998-01-01

    Integrated Class D audio amplifiers are very power efficient, but require an external filter which prevents further integration. Also due to this filter, large feedback factors are hard to realise, so that the load influences the distortion- and transfer characteristics. The amplifier presented in t

  8. An RF Power Amplifier in a Digital CMOS Process

    DEFF Research Database (Denmark)

    Nielsen, Per Asbeck; Fallesen, Carsten

    2002-01-01

    A two stage class B power amplifier for 1.9 GHz is presented. The amplifier is fabricated in a standard digital EPI-CMOS process with low resistivity substrate. The measured output power is 29 dBm in a 50 Omega load. A design method to find the large signal parameters of the output transistor...

  9. Models of reduced-noise, probabilistic linear amplifiers

    Science.gov (United States)

    Combes, Joshua; Walk, Nathan; Lund, A. P.; Ralph, T. C.; Caves, Carlton M.

    2016-05-01

    We construct an amplifier that interpolates between a nondeterministic, immaculate linear amplifier and a deterministic, ideal linear amplifier and beyond to nonideal linear amplifiers. The construction involves cascading an immaculate linear amplifier that has amplitude gain g1 with a (possibly) nonideal linear amplifier that has gain g2. With respect to normally ordered moments, the device has output noise μ2(G2-1 ) where G =g1g2 is the overall amplitude gain and μ2 is a noise parameter. When μ2≥1 , our devices realize ideal (μ2=1 ) and nonideal (μ2>1 ) linear amplifiers. When 0 ≤μ2devices work effectively only over a restricted region of phase space and with some subunity success probability p✓. We investigate the performance of our μ2 amplifiers in terms of a gain-corrected probability-fidelity product and the ratio of input to output signal-to-noise ratios corrected for success probability.

  10. Advances in Solid Core Photonic Bandgap Fiber Amplifiers

    DEFF Research Database (Denmark)

    Alkeskjold, Thomas Tanggaard; Laurila, Marko; Petersen, Sidsel Rübner;

    2012-01-01

    We present recent development of photonic crystal fiber amplifiers containing photonic bandgap structures for enhanced spectral and modal filtering functionality.......We present recent development of photonic crystal fiber amplifiers containing photonic bandgap structures for enhanced spectral and modal filtering functionality....

  11. Amplifying Islam : Pluralism, Secularism, and Religious Sounds in The Netherlands

    NARCIS (Netherlands)

    Tamimi Arab, P.

    2015-01-01

    This dissertation is an ethnographic study of the amplified azan, the Islamic call to prayer, in the Netherlands, adding a sonic dimension to analyses of the politics of Islamic aesthetics in the western world. Often rejected by opponents as noise pollution, facilitating the amplified azan is an exa

  12. PHEMT Distributed Power Amplifier Adopting Broadband Impedance Transformer

    DEFF Research Database (Denmark)

    Narendra, K.; Limiti, E.; Paoloni, C.;

    2013-01-01

    A non-uniform drain line distributed power amplifier (DPA) employing a broadband impedance transformer is presented. The DPA is based on GaAs PHEMT technology. The impedance transformer employs asymmetric coupled lines and transforms a low output impedance of the amplifier to a standard 50 Ω...

  13. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  14. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  15. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  16. Pulse laser imaging amplifier for advanced ladar systems

    Science.gov (United States)

    Khizhnyak, Anatoliy; Markov, Vladimir; Tomov, Ivan; Murrell, David

    2016-05-01

    Security measures sometimes require persistent surveillance of government, military and public areas Borders, bridges, sport arenas, airports and others are often surveilled with low-cost cameras. Their low-light performance can be enhanced with laser illuminators; however various operational scenarios may require a low-intensity laser illumination with the object-scattered light intensity lower than the sensitivity of the Ladar image detector. This paper discusses a novel type of high-gain optical image amplifier. The approach enables time-synchronization of the incoming and amplifying signals with accuracy <= 1 ns. The technique allows the incoming signal to be amplified without the need to match the input spectrum to the cavity modes. Instead, the incoming signal is accepted within the spectral band of the amplifier. We have gauged experimentally the performance of the amplifier with a 40 dB gain and an angle of view 20 mrad.

  17. A Review of High Voltage Drive Amplifiers for Capacitive Actuators

    DEFF Research Database (Denmark)

    Huang, Lina; Zhang, Zhe; Andersen, Michael A. E.

    2012-01-01

    This paper gives an overview of the high voltage amplifiers, which are used to drive capacitive actuators. The amplifiers for both piezoelectric and DEAP (dielectric electroactive polymer) actuator are discussed. The suitable topologies for driving capacitive actuators are illustrated in detail, ......, including linear as well as switched mode amplifiers. In the past much attention has been paid on the driver for piezoelectric actuator. As DEAP is a type of new material, there is not much literature reference for it.......This paper gives an overview of the high voltage amplifiers, which are used to drive capacitive actuators. The amplifiers for both piezoelectric and DEAP (dielectric electroactive polymer) actuator are discussed. The suitable topologies for driving capacitive actuators are illustrated in detail...

  18. New design of sense amplifier for EEPROM memory

    Institute of Scientific and Technical Information of China (English)

    Dong-sheng LIU; Xue-cheng ZOU; Qiong YU; Fan ZHANG

    2009-01-01

    We present a new sense amplifier circuit for EEPROM memory. The topology of the sense amplifier uses a voltage sensing method, having low cost and low power consumption as well as high reliability. The sense amplifier was implemented in an EEPROM realized with an SMIC 0.35-μm 2P3M CMOS embedded EEPROM process. Under the condition that the power supply is 3.3 V, simulation results showed that the charge time is 35 ns in the proposed sense amplifier, and that the maximum average current consumption during the read period is 40 μA. The novel topology allows the circuit to function with power sup-plies as low as 1.4 V. The sense amplifier has been implemented in 2-kb EEPROM memory for RFID tag IC applications, and has a silicon area of only 240 μm2.

  19. Highly Stable,Diode-Pumped Nd:YLF Regenerative Amplifier

    Institute of Scientific and Technical Information of China (English)

    WANG Jiang-Feng; LI Xue-Chun; WEI Hui; ZHU Jian-Qiang

    2008-01-01

    We present the design and experimental results for a diode pumped Nd:YLF regenerative amplifier applied to amplify a nanosecond laser pulse.Numerical simulation shows that the maximum output energy and the best stability can be obtained when the regenerative amplifier operates in a saturated mode for all pulse duration and temporal profiles.Using extra post-pulse is a good method to decrease the square-pulse distortion caused by gain saturation effect.The amplifier shows output energy of 4.2mJ with a total energy gain of more than 107 and output energy stability of better than 1% rms.When extra post-pulse is added,square-pulse distortion is decreased from 1.33 to 1.17 for the amplifier that is seeded with an optical pulse of 3 ns.

  20. Coupled Lines Filters for Broadband Impedance Matching of Microwave Amplifiers

    Directory of Open Access Journals (Sweden)

    Mohammed Lahsaini

    2014-08-01

    Full Text Available In this paper we present a broadband matching technique for the design of low noise amplifiers. This technique is based on the use of coupled lines filters and quarter wave transformers for the adaptation and stabilization of these amplifiers, presenting the theory and the design process of these circuits. The type of transistors used for modeling this amplifier is the HEMT of Alpha Industries®. The results we found show that this amplifier is unconditionally stable with a satisfactory gain of about 20 dB and good impedance matching across the band of interest [10-12] GHz. The amplifier modeled in this work can be integrated in satellite receiving systems and radar systems.

  1. Digital Lock-in Amplifier Based on Microcontroller

    Institute of Scientific and Technical Information of China (English)

    An-li TAO; Guo-dong XU; Ke-xue LUO; Gang-ling ZHANG

    2010-01-01

    A method of implementing high cost-effective and highly integrated digital lock-in amplifier with microcontroller is discussed. And the digital lock-in amplifier is more suitable for measuring low-frequency weak signal.Digital signal sequence is obtained through sampling signal measured over an integer number of signal periods, but digital reference sequence is acquired through mathematical operation, then digital phase sensitive detection can be implemented by calculating the cross-correlation function of digital signal sequence and digital reference sequence.In addition, the frequency response and phase character of the digital lock-in amplifier is analyzed. Finally, the designed digital lock-in amplifier is achieved. Experimental results show that the digital lock-in amplifier can be used for measuring weak signal with low ignal-to-noise ratio.

  2. Quantum Dot Semiconductor Optical Amplifiers - Physics and Applications

    DEFF Research Database (Denmark)

    Berg, Tommy Winther

    2004-01-01

    This thesis describes the physics and applications of quantum dot semiconductor optical amplifiers based on numerical simulations. These devices possess a number of unique properties compared with other types of semiconductor amplifiers, which should allow enhanced performance of semiconductor...... respects is comparable to those of fiber amplifiers. The possibility of inverting the optically active states to a large degree is essential in order to achieve this performance. Optical signal processing through cross gain modulation and four wave mixing is modeled and described. For both approaches...... and QW devices and to experiments on quantum dot amplifiers. These comparisons outline the qualitative differences between the different types of amplifiers. In all cases focus is put on the physical processes responsible the differences....

  3. Single Ion Quantum Lock-In Amplifier

    CERN Document Server

    Kotler, Shlomi; Glickman, Yinnon; Keselman, Anna; Ozeri, Roee

    2011-01-01

    We report on the implementation of a quantum analog to the classical lock-in amplifier. All the lock-in operations: modulation, detection and mixing, are performed via the application of non-commuting quantum operators on the electronic spin state of a single trapped Sr+ ion. We significantly increase its sensitivity to external fields while extending phase coherence by three orders of magnitude, to more than one second. With this technique we measure magnetic fields with sensitivity of 25 pT/sqrt(Hz) and light shifts with an uncertainty below 140 mHz after 1320 seconds of averaging. These sensitivities are limited by quantum projection noise and, to our knowledge, are more than two orders of magnitude better than with other single-spin probe technologies. In fact, our reported sensitivity is sufficient for the measurement of parity non-conservation, as well as the detection of the magnetic field of a single electronic-spin one micrometer from an ion-detector with nanometer resolution. As a first application ...

  4. Efficient and Compact Optical Amplifier Using EYDF

    Directory of Open Access Journals (Sweden)

    Sulaiman Wadi Harun

    2010-09-01

    Full Text Available An efficient Erbium/Ytterbium doped fiber amplifier (EYDFA is demonstrated using a 1058nm pumping wavelength, where the amplification is assisted by energy transfer between Yb and Er ions. The energy transfer increases the limit of erbium doping concentration that is imposed by concentration quenching in Erbium-doped fiber (EDF. Therefore, the gain and noise figure are severely degraded with 1480 nm pumping, where the energy transfer cannot be achieved. The use of optical isolator improves the small signal gain and noise figure by about 4.8 dB and 1.6 dB, respectively. By employing a double-pass configuration, a higher gain can be obtained with an expense of a noise figure penalty. The gain improvement of 17.0 dB is obtained at 20 mW and -50 dBm of pump and input signal powers. This shows that the double-pass configuration is an important aspect to consider when designing an efficient EYDFA.

  5. Status Report on the Energy Amplifier

    CERN Document Server

    Rubbia, Carlo

    1994-01-01

    0ne year after its first presentation,the Energy Amplifier (EA) Project holds its promises for a environmentally acceptable form of energy extraction from nuclei, namely to eliminate or at least greatly reduce(i) the environmental impact of the long-lived highly radioactive waste;(ii) the possibility of diversions toward military applications;(iii) the risks of an accidental divergence related to the critical operation of the chain reaction and (iv) make a more efficient use of a fuel which is less radio-toxic to extract and more abundant on Earth than Uranium. In these respects the EA (or equivalent scenarios from Los Alamos and elsewhere) is comparable in performance to Thermonuclear Fusion. Bot h approches offer pratically unl;imited fuel resources: the energetic content of Lithium on the Earth's crust needed by Fusion is estimated to be seven times the one of Thorium and they are both adequate for millions of years of very intensived utilisation.However the EA can be built economically,in a variety of siz...

  6. Gold Nanoparticle Labels Amplify Ellipsometric Signals

    Science.gov (United States)

    Venkatasubbarao, Srivatsa

    2008-01-01

    The ellipsometric method reported in the immediately preceding article was developed in conjunction with a method of using gold nanoparticles as labels on biomolecules that one seeks to detect. The purpose of the labeling is to exploit the optical properties of the gold nanoparticles in order to amplify the measurable ellipsometric effects and thereby to enable ultrasensitive detection of the labeled biomolecules without need to develop more-complex ellipsometric instrumentation. The colorimetric, polarization, light-scattering, and other optical properties of nanoparticles depend on their sizes and shapes. In the present method, these size-and-shape-dependent properties are used to magnify the polarization of scattered light and the diattenuation and retardance of signals derived from ellipsometry. The size-and-shape-dependent optical properties of the nanoparticles make it possible to interrogate the nanoparticles by use of light of various wavelengths, as appropriate, to optimally detect particles of a specific type at high sensitivity. Hence, by incorporating gold nanoparticles bound to biomolecules as primary or secondary labels, the performance of ellipsometry as a means of detecting the biomolecules can be improved. The use of gold nanoparticles as labels in ellipsometry has been found to afford sensitivity that equals or exceeds the sensitivity achieved by use of fluorescence-based methods. Potential applications for ellipsometric detection of gold nanoparticle-labeled biomolecules include monitoring molecules of interest in biological samples, in-vitro diagnostics, process monitoring, general environmental monitoring, and detection of biohazards.

  7. Fishing amplifies forage fish population collapses

    Science.gov (United States)

    Essington, Timothy E.; Moriarty, Pamela E.; Froehlich, Halley E.; Hodgson, Emma E.; Koehn, Laura E.; Oken, Kiva L.; Siple, Margaret C.; Stawitz, Christine C.

    2015-01-01

    Forage fish support the largest fisheries in the world but also play key roles in marine food webs by transferring energy from plankton to upper trophic-level predators, such as large fish, seabirds, and marine mammals. Fishing can, thereby, have far reaching consequences on marine food webs unless safeguards are in place to avoid depleting forage fish to dangerously low levels, where dependent predators are most vulnerable. However, disentangling the contributions of fishing vs. natural processes on population dynamics has been difficult because of the sensitivity of these stocks to environmental conditions. Here, we overcome this difficulty by collating population time series for forage fish populations that account for nearly two-thirds of global catch of forage fish to identify the fingerprint of fisheries on their population dynamics. Forage fish population collapses shared a set of common and unique characteristics: high fishing pressure for several years before collapse, a sharp drop in natural population productivity, and a lagged response to reduce fishing pressure. Lagged response to natural productivity declines can sharply amplify the magnitude of naturally occurring population fluctuations. Finally, we show that the magnitude and frequency of collapses are greater than expected from natural productivity characteristics and therefore, likely attributed to fishing. The durations of collapses, however, were not different from those expected based on natural productivity shifts. A risk-based management scheme that reduces fishing when populations become scarce would protect forage fish and their predators from collapse with little effect on long-term average catches. PMID:25848018

  8. Implementation of envelope tracking for RF solid state amplifiers

    Science.gov (United States)

    Larter, Thomas Leigh

    The Facility for Rare Isotope Beams (FRIB) is currently in its development stages at Michigan State University. The facility uses a large linear accelerator system to accelerate ionized particles which are then collided with other particles in the hopes of finding rare isotopes of elements. This accelerating action depends on several systems to function, with one of the major systems being superconducting cavity structures. These cavities are driven by high-power RF amplifiers which account for a large portion of the accelerator's power consumption. It is important to maximize the efficiency of these amplifiers in order to keep energy costs for the facility low. One of the ways to increase efficiency is to choose an amplifier topology that is highly efficient. A study was done for FRIB testing the prospect of using amplifiers with the envelope tracking (ET) topology. An amplifier's efficiency relies on its output power and the power supplied to it, which are in turn directly related to the output signal voltage and supply rail voltage. In an ET RF amplifier, the supply voltage is made to closely follow the envelope of the output signal voltage. This tracking action allows the RF amplifier to operate with much improved efficiency at low power levels and nearly constant efficiency at high power levels. The ET tests performed for FRIB attempted to verify the validity of ET efficiency gains for RF amplifiers. These tests included the characterization of an RF amplifier, development and verification of an ET control algorithm, and implementation of an ET test bench using FRIB equipment. These tests should attest to the purported increase in efficiency possible with ET and prove that the power consumption budget for the FRIB will benefit from the use of such amplifiers.

  9. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  10. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  11. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  12. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  13. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  14. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  15. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  16. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  17. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  18. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  19. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  20. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  1. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  2. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  3. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  4. Direct solar-pumped iodine laser amplifier

    Science.gov (United States)

    Han, Kwang S.; Hwang, In Heon; Kim, Khong Hon; Stock, Larry V.

    1988-01-01

    A XeCl laser pumped iodine laser oscillator was developed which will be incorporated into the Master Oscillator Power Amplifier (MOPA) system. The developed XeCl laser produces output energy of about 60 mJ per pulse. The pulse duration was about 10 nsec. The kinetic model for the solar-pumped laser was refined and the algorithm for the calculation of a set of rate equations was improved to increase the accuracy and the efficiency of the calculation. The improved algorithm was applied to explain the existing experimental data taken from a flashlamp pumped iodine laser for three kinds of lasants, i-C3F7I, n-C4F9I, and t-C4F9I. Various solid laser materials were evaluated for solar-pumping. The materials studied were Nd:YAG, Nd:YLF, and Cr:Nd:GSGG crystals. The slope efficiency of 0.17 percent was measured for the Nd:YLF near the threshold pump intensity which was 211 solar constants (29W/sq cm). The threshold pump intensity of the Nd:YAG was measured to be 236 solar constants (32W/sq cm) and the near-threshold slope efficiency was 0.12 percent. True CW laser operation of Cr:Nd:GSGG was possible only at pump intensities less than or equal to 1,500 solar constants (203 W/sq cm). This fact was attributed to the high thermal focusing effect of the Cr:Nd:GSGG rod.

  5. Ambient temperature cadmium zinc telluride radiation detector and amplifier circuit

    International Nuclear Information System (INIS)

    A low noise, low power consumption, compact, ambient temperature signal amplifier for a Cadmium Zinc Telluride (CZT) radiation detector is disclosed. The amplifier can be used within a larger system (e.g., including a multi-channel analyzer) to allow isotopic analysis of radionuclides in the field. In one embodiment, the circuit stages of the low power, low noise amplifier are constructed using integrated circuit (IC) amplifiers , rather than discrete components, and include a very low noise, high gain, high bandwidth dual part preamplification stage, an amplification stage, and an filter stage. The low noise, low power consumption, compact, ambient temperature amplifier enables the CZT detector to achieve both the efficiency required to determine the presence of radionuclides and the resolution necessary to perform isotopic analysis to perform nuclear material identification. The present low noise, low power, compact, ambient temperature amplifier enables a CZT detector to achieve resolution of less than 3% full width at half maximum at 122 keV for a Cobalt-57 isotope source. By using IC circuits and using only a single 12 volt supply and ground, the novel amplifier provides significant power savings and is well suited for prolonged portable in-field use and does not require heavy, bulky power supply components. 9 figs

  6. A modular positive feedback-based gene amplifier

    Directory of Open Access Journals (Sweden)

    Bhalerao Kaustubh D

    2010-02-01

    Full Text Available Abstract Background Positive feedback is a common mechanism used in the regulation of many gene circuits as it can amplify the response to inducers and also generate binary outputs and hysteresis. In the context of electrical circuit design, positive feedback is often considered in the design of amplifiers. Similar approaches, therefore, may be used for the design of amplifiers in synthetic gene circuits with applications, for example, in cell-based sensors. Results We developed a modular positive feedback circuit that can function as a genetic signal amplifier, heightening the sensitivity to inducer signals as well as increasing maximum expression levels without the need for an external cofactor. The design utilizes a constitutively active, autoinducer-independent variant of the quorum-sensing regulator LuxR. We experimentally tested the ability of the positive feedback module to separately amplify the output of a one-component tetracycline sensor and a two-component aspartate sensor. In each case, the positive feedback module amplified the response to the respective inducers, both with regards to the dynamic range and sensitivity. Conclusions The advantage of our design is that the actual feedback mechanism depends only on a single gene and does not require any other modulation. Furthermore, this circuit can amplify any transcriptional signal, not just one encoded within the circuit or tuned by an external inducer. As our design is modular, it can potentially be used as a component in the design of more complex synthetic gene circuits.

  7. High Power Amplifier and Power Supply

    Science.gov (United States)

    Duong, Johnny; Stride, Scot; Harvey, Wayne; Haque, Inam; Packard, Newton; Ng, Quintin; Ispirian, Julie Y.; Waian, Christopher; Janes, Drew

    2008-01-01

    A document discusses the creation of a high-voltage power supply (HVPS) that is able to contain voltages up to -20 kV, keep electrical field strengths to below 200 V/mil (approximately equal to 7.87 kV/mm), and can provide a 200-nanosecond rise/fall time focus modulator swinging between cathode potential of 16.3 kV and -19.3 kV. This HVPS can protect the 95-GHz, pulsed extended interaction klystron (EIK) from arcs/discharges from all sources, including those from within the EIK fs vacuum envelope. This innovation has a multi-winding pulse transformer design, which uses new winding techniques to provide the same delays and rise/fall times (less than 10 nanoseconds) at different potential levels ranging from -20 kV to -16 kV. Another feature involves a high-voltage printed-wiring board that was corona-free at -20 kV DC with a 3- kV AC swing. The corona-free multilayer high-voltage board is used to simulate fields of less than 200 V/mil (approximately equal to 7.87 kV/mm) at 20 kV DC. Drive techniques for the modulator FETs (field-effect transistors) (four to 10 in a series) were created to change states (3,000-V swing) without abrupt steps, while still maintaining required delays and transition times. The packing scheme includes a potting mold to house a ten-stage modulator in the space that, in the past, only housed a four-stage modulator. Problems keeping heat down were solved using aluminum oxide substrate in the high-voltage section to limit temperature rise to less than 10 while withstanding -20 kV DC voltage and remaining corona-free.

  8. I-V curve of Bi-2223/Ag tapes in overload conditions determined from AC transport data

    International Nuclear Information System (INIS)

    The influence of dynamics on the dissipation at electrical charge transport in superconductors can be investigated by comparing the resistive part of AC transport loss with the prediction deduced from DC I-V curve. The complication is that in the AC regime a hysteretic loss is present, generating a voltage that is similar to that produced by the I-V curve. We present how the signal due to hysteresis loss can be eliminated from the total voltage measured with AC transport current, and the DC I-V curve deduced from its fundamental and higher harmonics can be constructed. The experiments were performed on two samples prepared from the same tape. The voltage was monitored using contact as well as contact-less method. Its harmonics (up to 7th) were decomposed to the parts that are out of phase and in phase with transport current, using a lock-in amplifier. The experiments were focused on the over critical current regime up to AC currents with amplitudes 3 times exceeding the tape critical current. We show how from these data the basic parameters characterising the I-V curve of the composite tape, i.e. its critical current, the slope and the normal state resistivity, can be determined

  9. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  10. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  11. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  12. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  13. Optimization and Performance Analysis of Bulk-Driven Differential Amplifier

    Directory of Open Access Journals (Sweden)

    Antarpreet kaur

    2014-04-01

    Full Text Available In recent years, there has been an increasing demand for high-speed digital circuits at low power consumption. This paper presents a design of input stage of Operational Amplifier i.e cascode differential amplifier using a standard 65nm CMOS Technology.A comparison betweem gate-driven, bulk-driven and cascode bulk driven bulk-driven differential amplifier is described. The Results demonstrate that CMMR is 83.98 dB, 3-dB Bandwidth is 1.04 MHz. The circuit dissipate power of 28uWunder single supply of 1.0V.

  14. Amplifier circuit operable over a wide temperature range

    Science.gov (United States)

    Kelly, Ronald D.; Cannon, William L.

    1979-01-01

    An amplifier circuit having stable performance characteristics over a wide temperature range from approximately 0.degree. C up to as high as approximately 500.degree. C, such as might be encountered in a geothermal borehole. The amplifier utilizes ceramic vacuum tubes connected in directly coupled differential amplifier pairs having a common power supply and a cathode follower output stage. In an alternate embodiment, for operation up to 500.degree. C, positive and negative power supplies are utilized to provide improved gain characteristics, and all electrical connections are made by welding. Resistor elements in this version of the invention are specially heat treated to improve their stability with temperature.

  15. Class-D audio amplifiers with negative feedback

    OpenAIRE

    Cox, Stephen M.; Candy, B. H.

    2006-01-01

    There are many different designs for audio amplifiers. Class-D, or switching, amplifiers generate their output signal in the form of a high-frequency square wave of variable duty cycle (ratio of on time to off time). The square-wave nature of the output allows a particularly efficient output stage, with minimal losses. The output is ultimately filtered to remove components of the spectrum above the audio range. Mathematical models are derived here for a variety of related class-D amplifier d...

  16. FDML swept source at 1060 nm using a tapered amplifier

    DEFF Research Database (Denmark)

    Marschall, Sebastian; Klein, Thomas; Wieser, Wolfgang;

    2010-01-01

    We present a novel frequency-swept light source working at 1060nm that utilizes a tapered amplifier as gain medium. These devices feature significantly higher saturation power than conventional semiconductor optical amplifiers and can thus improve the limited output power of swept sources...... in this wavelength range. We demonstrate that a tapered amplifier can be integrated into a fiber-based swept source and allows for high-speed FDML operation. The developed light source operates at a sweep rate of 116kHz with an effective average output power in excess of 30mW. With a total sweep range of 70 nm...

  17. Design procedure for optimizing CMOS low noise operational amplifiers

    Institute of Scientific and Technical Information of China (English)

    Li Zhiyuan; Ye Yizheng; Ma Jianguo

    2009-01-01

    This paper presents and experimentally verifies an optimized design procedure for a CMOS low noise operational amplifier.The design procedure focuses on the noise performance,which is the key requirement for low noise operational amplifiers.Based on the noise level and other specifications such as bandwidth,signal swing,slew rate,and power consumption,the device sizes and the biasing conditions are derived.In order to verify the proposed design procedure,a three-stage operational amplifier has been designed.The device parameters obtained from the proposed design procedure closely agree with the simulated results obtained by using HSPICE.

  18. MMIC DHBT Common-Base Amplifier for 172 GHz

    Science.gov (United States)

    Paidi, Vamsi; Griffith, Zack; Wei, Yun; Dahlstrom, Mttias; Urteaga, Miguel; Rodwell, Mark; Samoska, Lorene; Fung, King Man; Schlecht, Erich

    2006-01-01

    Figure 1 shows a single-stage monolithic microwave integrated circuit (MMIC) power amplifier in which the gain element is a double-heterojunction bipolar transistor (DHBT) connected in common-base configuration. This amplifier, which has been demonstrated to function well at a frequency of 172 GHz, is part of a continuing effort to develop compact, efficient amplifiers for scientific instrumentation, wide-band communication systems, and radar systems that will operate at frequencies up to and beyond 180 GHz. The transistor is fabricated from a layered structure formed by molecular beam epitaxy in the InP/InGaAs material system. A highly doped InGaAs base layer and a collector layer are fabricated from the layered structure in a triple mesa process. The transistor includes two separate emitter fingers, each having dimensions of 0.8 by 12 m. The common-base configuration was chosen for its high maximum stable gain in the frequency band of interest. The input-matching network is designed for high bandwidth. The output of the transistor is matched to a load line for maximum saturated output power under large-signal conditions, rather than being matched for maximum gain under small-signal conditions. In a test at a frequency of 172 GHz, the amplifier was found to generate an output power of 7.5 mW, with approximately 5 dB of large-signal gain (see Figure 2). Moreover, the amplifier exhibited a peak small-signal gain of 7 dB at a frequency of 176 GHz. This performance of this MMIC single-stage amplifier containing only a single transistor represents a significant advance in the state of the art, in that it rivals the 170-GHz performance of a prior MMIC three-stage, four-transistor amplifier. [The prior amplifier was reported in "MMIC HEMT Power Amplifier for 140 to 170 GHz" (NPO-30127), NASA Tech Briefs, Vol. 27, No. 11 (November 2003), page 49.] This amplifier is the first heterojunction- bipolar-transistor (HBT) amplifier built for medium power operation in this

  19. 120 nm Bandwidth Erbium-doped Fiber Amplifier

    Institute of Scientific and Technical Information of China (English)

    姜淳; 曾庆济; 肖石林

    2002-01-01

    A new dual band erbium-doped fiber amplifier configuration that provides 120 nm of optical bandwidth is simulated. This configuration employs a split-band architecture in which optical signals are splitted using a 1550/1610 nm port filter into two independent sub-bands which then pass in parallel through separate branches of the optical amplifier. Each branch may be optimized for the sub-band that traverses it. The independent sub-bands are combined and flattened before output, resulting in a 120 nm bandwidth gain-flattened optical amplifier.

  20. Influence of mode competition on beam quality of fiber amplifier

    International Nuclear Information System (INIS)

    Theoretical and experimental studies of the influence of the mode competition on the output beam quality of fiber amplifiers are presented. Rate equations and modal decomposition method are used in the theoretical model. In the experiment, the output beam-quality factor of a fiber amplifier, which is based on a Yb-doped double-clad large mode area fiber as a function of the seed beam quality and the pump power of the amplifier, is measured. The experimental results are consistent with the theoretical analysis. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

  1. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    OpenAIRE

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  2. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  3. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  4. A new class of hybrid AC/AC direct power converters

    OpenAIRE

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  5. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    OpenAIRE

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  6. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  7. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  8. Amplified spontaneous emission spectrum at the output of a diode amplifier saturated by an input monochromatic wave

    Science.gov (United States)

    Bogatov, A. P.; Drakin, A. E.; D'yachkov, N. V.; Gushchik, T. I.

    2016-08-01

    Expressions for the amplitudes of amplified spontaneous emission waves in a diode amplifier near the frequency ω0 of a 'strong' input monochromatic wave have been derived in terms of a random function of a stationary Gaussian process. We have found expressions for the spectral density of the amplitudes and shown that, on the red side of the spectrum with respect to frequency ω0, spontaneous emission waves obtain additional nonlinear gain, induced by the strong wave, whereas on the blue side of the spectrum an additional loss is induced. Such behaviour of the amplitudes of amplified waves agrees with previous results.

  9. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an...

  10. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  11. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  12. A Doherty Amplifier with Envelope Tracking Technique and DSP for High Efficiency

    Directory of Open Access Journals (Sweden)

    Ambar Saxena

    2012-01-01

    Full Text Available A Doherty amplifier employing input signal envelope tracking technique. In the amplifier, gate bias of peaking amplifier is controlled according to the magnitude of the envelope. The performance of the microwave Doherty amplifier has been compared with class AB amplifier. DSP is used to dynamically adjust the gate bias of the auxiliary (peaking amplifier at the rate of the signal envelope to obtain gain flatness. DSP is used as a digital predistortor to improve the overall linearity and efficiency.

  13. Design And Construction Of 300W Audio Power Amplifier For Classroom

    OpenAIRE

    Shune Lei Aung; Kyaw Soe Lwin and Hla Myo Tun

    2015-01-01

    Abstract This paper describes the design and construction of 300W audio power amplifier for classroom. In the construction of this amplifier microphone preamplifier tone preamplifier equalizer line amplifier output power amplifier and sound level indicator are included. The output power amplifier is designed as O.C.L system and constructed by using Class B among many types of amplifier classes. There are two types in O.C.L system quasi system and complementary system. Between them the comple...

  14. Hearing Aids and Personal Sound Amplifiers: Know the Difference

    Science.gov (United States)

    ... For Consumers Home For Consumers Consumer Updates Hearing Aids and Personal Sound Amplifiers: Know the Difference Share ... or use them as substitutes—for approved hearing aids. "Hearing aids and personal sound amplification products (PSAPS) ...

  15. 1.55 Micron High Peak Power Fiber Amplifier Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In this proposal, we propose to demonstrate and build a 1.55 micron single frequency high energy and high peak power fiber amplifier by developing an innovative...

  16. Magnetic Bearing Amplifier Output Power Filters for Flywheel Systems

    Science.gov (United States)

    Lebron-Velilla, Ramon C.; Jansen, Ralph H.; Palazzolo, Alan; Thomas, Erwin; Kascak, Peter E.; Birchenough, Arthur G.; Dever, Timothy P.

    2003-01-01

    Five power filters and two types of power amplifiers were tested for use with active magnetic bearings for flywheel applications. Filter topologies included low pass filters and low pass filters combined with trap filters at the PWM switching frequency. Two state and three state PWM amplifiers were compared. Each system was evaluated based on current magnitude at the switching frequency, voltage magnitude at 500 kHz, and power consumption. The base line system was a two state amplifier without a power filter. The recommended system is a three state power amplifier with a 50 kHz low pass filter and a 27 kHz trap filter. This system uses 5.57 W. It reduces the switching current by an order of magnitude and the 500 kHz voltage by two orders of magnitude. The relative power consumption varied depending on the test condition between 60 to 130 percent of the baseline.

  17. High current density nanofilament cathodes for microwave amplifiers

    NARCIS (Netherlands)

    Schnell, J-P.; Minoux, E.; Gangloff, L.; Vincent, P.; Legagneux, P.; Dieumegard, D.; David, J.-F.; Peauger, F.; Hudanski, L.; Teo, K.B.K.; Lacerda, R.; Chhowalla, M.; Hasko, D.G.; Ahmed, H.; Amaratunga, G.A.J.; Milne, W.I.; Vila, L.; Dauginet-De Pra, L.; Demoustier-Champagne, S.; Ferain, E.; Legras, R.; Piraux, L.; Gröening, O.; Raedt, H. De; Michielsen, K.

    2004-01-01

    We study high current density nanofilament cathodes for microwave amplifiers. Two different types of aligned nanofilament array have been studied: first, metallic nanowires grown by electrodeposition into nanoporous templates at very low temperature (T

  18. Linear and nonlinear analysis of high-power rf amplifiers

    International Nuclear Information System (INIS)

    After a survey of the state variable analysis method the final amplifier for the CBA is analyzed taking into account the real beam waveshape. An empirical method for checking the stability of a non-linear system is also considered

  19. Experimental examinations of semiconductor laser amplifiers for optical communication technology

    Science.gov (United States)

    Ludwig, Reinhold

    1993-01-01

    Properties of SLA (Semiconductor Laser Amplifier), which are particularly interesting for application to linear repeaters in coherent multichannel systems, are studied and design rules for future optimized amplifier structure are deduced. Laser diode antireflection was examined and reflection factor was measured. Low signal properties were discussed considering injection current, wavelengths, temperature and polarization. The coupling between amplifiers and glass fibers was examined. The utilization of cascade amplifiers as linear repeaters in multichannel heterodyne systems and television distribution systems was investigatied. The following results are obtained: measurement and calculation of the paradiaphony between two signals radiated in a SLA; multichannel data transfer through a SLA; polarization independent amplification with SLA configurations; measurement of the frequency dependence of four wave mixing sidelines in a SLA; measurement of the system degradation through echoes in a bidirectional SLA chain; data transmission with frequency conversion and calculation of multichannel transmission systems with cascade SLA, taking into account saturation, signal to noise ratio, bandwidth reduction and echo.

  20. Gain Variation with Raman Amplifier Parameters and Its Restoration

    Institute of Scientific and Technical Information of China (English)

    Zhaohui Li; Chao Lu; Jian Chen

    2003-01-01

    We demonstrate that gain profile of a distributed Raman amplifier is sensitive to its parameter variation, such as loss/gain coefficients change or partial pump failure. Gain flatness can be restored by adjusting power of pump lasers.

  1. Fiber amplifiers under thermal loads leading to transverse mode instability

    DEFF Research Database (Denmark)

    Johansen, Mette Marie; Hansen, Kristian Rymann; Alkeskjold, Thomas Tanggaard;

    2014-01-01

    Transverse mode instability (TMI) in rare-earth doped fiber amplifiers operating above an average power threshold is caused by intermodal stimulated thermal Rayleigh scattering due to quantum defect heating. We investigate thermally induced longitudinal waveguide perturbations causing power trans...

  2. On the unlimited gain of a nonlinear parametric amplifier

    DEFF Research Database (Denmark)

    Sorokin, Vladislav

    2014-01-01

    The present paper is concerned with analysis of the response of a nonlinear parametric amplifier in abroad range of system parameters, particularly beyond resonance. Such analysis is of particular interestfor micro- and nanosystems, since many small-scale parametric amplifiers exhibit a distinctly...... nonlinearbehavior when amplitude of their response is sufficiently large. The modified method of direct separa-tion of motions is employed to study the considered system. As the result it is obtained that steady-stateamplitude of the nonlinear parametric amplifier response can reach large values in the case...... of arbitrarilysmall amplitude of external excitation, so that the amplifier gain tends to infinity. Very large amplifiergain can be achieved in a broad range of system parameters, in particular when the amplitude of para-metric excitation is comparatively small. The obtained results clearly demonstrate that very...

  3. Compression of chirp pulses from a femtosecond fiber based amplifier

    Science.gov (United States)

    Ito, Rumi; Takiuchi, Ken-ichi; Tei, Kazuyoku; Yamaguchi, Shigeru; Enokidani, Jyun; Sumida, Shin

    2015-03-01

    We demonstrate a single mode fiber based master oscillator power amplifier (MOPA) with a single polarization and a fully monolithic design. We have built a passive mode-locked polarization maintaining Yb doped fiber as the master oscillator contains a semiconductor saturable absorber mirror and a chirped fiber Bragg grating for the dispersion management. The net intracavity dispersion was managed to be slightly anomalous. The oscillator generates the 150 fs (sech2) pulses at the center wavelength of 1065 nm, and the repetition rate of 42 MHz. The oscillator output was amplified to 1.4 W from 80 mW in the single stage fiber amplifier which results in pulse shape distortion. The pulse shaping with a band pass filter and a compressor was applied to the amplified pulses. The shaping pulses have the pulse width of 90 fs and the pulse energy of 16 nJ.

  4. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  5. Thermally induced nonlinear mode coupling in high power fiber amplifiers

    DEFF Research Database (Denmark)

    Johansen, Mette Marie; Hansen, Kristian Rymann; Alkeskjold, Thomas T.;

    2013-01-01

    Thermally induced nonlinear mode coupling leads to transverse mode instability (TMI) in high power fiber amplifiers. A numerical model including altering mode profiles from thermal effects and waveguide perturbations predicts a TMI threshold of ~200W.......Thermally induced nonlinear mode coupling leads to transverse mode instability (TMI) in high power fiber amplifiers. A numerical model including altering mode profiles from thermal effects and waveguide perturbations predicts a TMI threshold of ~200W....

  6. Calibration setup for ultralow-current transresistance amplifiers

    CERN Document Server

    Finardi, Ilaria

    2016-01-01

    We describe a calibration setup for the transresistance of low-current amplifiers, based on the capacitance-charging method. The calibration can be performed in the current range of typical interest for electron counting experiments. The setup implementation is simple and rugged, and is suitable to be embedded in larger experiments where the amplifier is employed. The calibration is traceable to units of capacitance and of time. The base relative accuracy of the implementation is in the 10^-5 range.

  7. Distributed Mode Filtering Rod Fiber Amplifier With Improved Mode Stability

    DEFF Research Database (Denmark)

    Laurila, Marko; Alkeskjold, Thomas Tanggaard; Broeng, Jes;

    2012-01-01

    We report 216W of average output power from a photonic crystal rod fiber amplifier. We demonstrate 44% power improvement before onset of the mode instability by operating the rod fiber in a leaky guiding regime.......We report 216W of average output power from a photonic crystal rod fiber amplifier. We demonstrate 44% power improvement before onset of the mode instability by operating the rod fiber in a leaky guiding regime....

  8. Ultrafast optical signal processing using semiconductor quantum dot amplifiers

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper

    2002-01-01

    The linear and nonlinear properties of quantum dot amplifiers are discussed on the basis of an extensive theoretical model. These devices show great potential for linear amplification as well as ultrafast signal processing.......The linear and nonlinear properties of quantum dot amplifiers are discussed on the basis of an extensive theoretical model. These devices show great potential for linear amplification as well as ultrafast signal processing....

  9. On the effect of time delays in negative feedback amplifiers

    OpenAIRE

    Alves, L. N.; Aguiar, R. L.

    2005-01-01

    Time delays are intrinsic to all existing devices and circuits. For the majority of applications, time delays are so small that their effects can be disregarded. However, when considering feedback amplifiers, depending on open-loop poles and loop gain, the effect of a small time delay inside the feedback path may turn to be of considerable importance. This paper analyzes the frequency response effects associated with time delays in feedback amplifiers, exploiting these effects to achieve band...

  10. On the dual symmetry between absorbing and amplifying random media

    Indian Academy of Sciences (India)

    S Anantha Ramakrishna

    2004-06-01

    We re-examine the dual symmetry between absorbing and amplifying random media. By analysing the physically allowed choice of the sign of the square root to determine the complex wave vector in a medium, we draw a broad set of conclusions that enables us to resolve the apparent paradox of the dual symmetry and also to anticipate the large local electromagnetic field enhancements in amplifying random media.

  11. DESIGN OF SEQUENTIALLY FED BALANCED AMPLIFYING ANTENNA FOR CIRCULAR POLARIZATION

    OpenAIRE

    S. K. Behera; D. R. Poddar; Mishra, R K

    2010-01-01

    This paper presents a sequentially fed balanced amplifying antenna that exhibits circularly polarized radiation. The inherent benefits of good isolation between input and output ports as well as improved matching capabilities of balanced amplifiers provide overall system gain of 8 dBi at frequency 2.36GHz. The planar arrangement of the patch antenna elements are considered to form an array. The phase of the feeding in the array increases progressively from 00 to 2700.Each element in the array...

  12. Optical parametric amplifier pumped by two mutually incoherent laser beams

    Science.gov (United States)

    Tamošauskas, G.; Dubietis, A.; Valiulis, G.; Piskarskas, A.

    2008-05-01

    We report on the experimental proof-of-principle demonstration of the ultrashort pulse single-pass beta-barium borate, BBO optical parametric amplifier pumped by two mutually incoherent laser sources. We show that the amplified signal at 1054 nm gains energy from both pump pulses with wavelengths of 680 and 527 nm, respectively, with overall energy conversion of 36%, and exhibits low wavefront distortions and improved energy stability in the gain saturation regime.

  13. Thermal Effects in High-Power Fiber Amplifiers

    DEFF Research Database (Denmark)

    Hansen, Kristian Rymann; Lægsgaard, Jesper

    2011-01-01

    The effect of temperature gradients in Yb-doped fiber amplifiers is studied numerically. We investigate the dependence of the mode area on the signal power, and compare forward and backward pumping schemes.......The effect of temperature gradients in Yb-doped fiber amplifiers is studied numerically. We investigate the dependence of the mode area on the signal power, and compare forward and backward pumping schemes....

  14. An amplifier for VUV photomultiplier operating in cryogenic environment

    Science.gov (United States)

    Arneodo, F.; Benabderrahmane, M. L.; Dahal, S.; Di Giovanni, A.; d`Inzeo, M.; Franchi, G.; Pazos Clemens, L.

    2016-07-01

    We present the characterisation of an amplifier potentially interesting for noble liquid detectors. The design has been conceived considering the requirements of low power consumption (less than 30 mW), low noise, amplification factor of 10 at 100 MHz and use of commercial components. The amplifier has been integrated onto an electronic board with a voltage divider to operate an Hamamatsu R11410 photomultiplier tube (used in XENON1T, Aprile et al. (2014) [1] dark matter experiment).

  15. Behavioral modeling and linearization of RF power amplifiers

    CERN Document Server

    Wood, John

    2014-01-01

    Wireless voice and data communications have made great improvements, with connectivity now virtually ubiquitous. Users are demanding essentially perfect transmission and reception of voice and data. The infrastructure that supports this wide connectivity and nearly error-free delivery of information is complex, costly, and continually being improved.This resource describes the mathematical methods and practical implementations of linearization techniques for RF power amplifiers for mobile communications. This includes a review of RF power amplifier design for high efficiency operation. Readers

  16. Design of low noise transimpedance amplifier for intravascular ultrasound

    KAUST Repository

    Reda, Dina

    2009-11-01

    In this paper, we study transimpedance amplifiers for capacitive sensing applications with a focus on Intravascular Ultra Sound (IVUS). We employ RF noise cancellation technique on capacitive feedback based transimpedance amplifiers. This technique eliminates the input-referred noise of TIAs completely and enhances the dynamic range of front-end electronics. Simulation results verify the proposed technique used in two different TIA topologies employing shunt-shunt feedback. ©2009 IEEE.

  17. Ferrite bead effect on Class-D amplifier audio quality

    OpenAIRE

    Haddad, Kevin El; Mrad, Roberto; Morel, Florent; Pillonnet, Gael; Vollaire, Christian; Nagari, Angelo

    2014-01-01

    International audience This paper studies the effect of ferrite beads on the audio quality of Class-D audio amplifiers. This latter is a switch-ing circuit which creates high frequency harmonics. Generally, a filter is used at the amplifier output for the sake of electro-magnetic compatibility (EMC). So often, in integrated solutions, this filter contains ferrite beads which are magnetic components and present nonlinear behavior. Time domain measurements and their equivalence in frequency ...

  18. Characterization of a multimode coplanar waveguide parametric amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Simoen, M., E-mail: simoen@chalmers.se; Krantz, P.; Bylander, Jonas; Shumeiko, V.; Delsing, P. [Department of Microtechnology and Nanoscience (MC2), Chalmers University of Technology, Göteborg SE-412 96 (Sweden); Chang, C. W. S.; Wilson, C. M. [Institute for Quantum Computing and Department of Electrical and Computer Engineering, University of Waterloo, Waterloo, Ontario N2L 3G1 (Canada); Wustmann, W. [Department of Microtechnology and Nanoscience (MC2), Chalmers University of Technology, Göteborg SE-412 96 (Sweden); Laboratory for Physical Sciences, College Park, Maryland 20740 (United States)

    2015-10-21

    We characterize a Josephson parametric amplifier based on a flux-tunable quarter-wavelength resonator. The fundamental resonance frequency is ∼1 GHz, but we use higher modes of the resonator for our measurements. An on-chip tuning line allows for magnetic flux pumping of the amplifier. We investigate and compare degenerate parametric amplification, involving a single mode, and nondegenerate parametric amplification, using a pair of modes. We show that we reach quantum-limited noise performance in both cases.

  19. Design And Construction Of 300W Audio Power Amplifier For Classroom

    Directory of Open Access Journals (Sweden)

    Shune Lei Aung

    2015-07-01

    Full Text Available Abstract This paper describes the design and construction of 300W audio power amplifier for classroom. In the construction of this amplifier microphone preamplifier tone preamplifier equalizer line amplifier output power amplifier and sound level indicator are included. The output power amplifier is designed as O.C.L system and constructed by using Class B among many types of amplifier classes. There are two types in O.C.L system quasi system and complementary system. Between them the complementary system is used in the construction of 300W audio power amplifier. The Multisim software is utilized for the construction of audio power amplifier.

  20. ANALYSIS OF INTERNALLY GENERATED NOISE OF BIOELECTRIC AMPLIFIERS

    Institute of Scientific and Technical Information of China (English)

    MashhourMustafaBaniAmer

    2003-01-01

    This papenr deals with internally generated noise of bioelectric amplifiers that are usually used for processing of bioelectric events.The main purpose of this paper is to present a procedure for analysis of the effects of internal noise generated by the active circuits and to evaluate the output noise of the author's new designed bioelectric amplifier that caused by internal effects to the amplifier circuit itself in order to compare it with the noise generated by conventional amplifiers.The obtained analysis results of internally generated noise showed that the total output noise of bioelectric active circuits does not increase when some of their resitors have a larger value.This behavior is caused by the different transfer functions for the signal and the respective noise sources associated with these resistors.Moreover,the new designed bioelectric amplifier haws an output noise less than that for conventional amplifiers.The obtained analysis results were also experimentally verified and the final conclusions were drawn.

  1. Frequency-Offset Cartesian Feedback Based on Polyphase Difference Amplifiers.

    Science.gov (United States)

    Zanchi, Marta G; Pauly, John M; Scott, Greig C

    2010-05-01

    A modified Cartesian feedback method called "frequency-offset Cartesian feedback" and based on polyphase difference amplifiers is described that significantly reduces the problems associated with quadrature errors and DC-offsets in classic Cartesian feedback power amplifier control systems.In this method, the reference input and feedback signals are down-converted and compared at a low intermediate frequency (IF) instead of at DC. The polyphase difference amplifiers create a complex control bandwidth centered at this low IF, which is typically offset from DC by 200-1500 kHz. Consequently, the loop gain peak does not overlap DC where voltage offsets, drift, and local oscillator leakage create errors. Moreover, quadrature mismatch errors are significantly attenuated in the control bandwidth. Since the polyphase amplifiers selectively amplify the complex signals characterized by a +90° phase relationship representing positive frequency signals, the control system operates somewhat like single sideband (SSB) modulation. However, the approach still allows the same modulation bandwidth control as classic Cartesian feedback.In this paper, the behavior of the polyphase difference amplifier is described through both the results of simulations, based on a theoretical analysis of their architecture, and experiments. We then describe our first printed circuit board prototype of a frequency-offset Cartesian feedback transmitter and its performance in open and closed loop configuration. This approach should be especially useful in magnetic resonance imaging transmit array systems. PMID:20814450

  2. Coherence optimization of vertical-cavity semiconductor optical amplifiers

    Science.gov (United States)

    Sanchez, Michael; Wen, Pengyue; Gross, Matthias; Kibar, Osman; Esener, Sadik C.

    2002-06-01

    Vertical cavity semiconductor optical amplifiers (VCSOAs) are attractive devices for use in coherent optical amplification, especially where 2-D amplifier arrays are required. However, the coherence preservation quality of a VCSOA depends strongly on the bias condition, resonant wavelength mismatch, and the optical input power level. We characterize the coherence degree of a VCSOA as a function of these parameters by measuring interference fringe visibility with an interferometer. The dominant factors influencing the contrast of the fringes are the ratio of coherent, stimulated emission photons to amplified spontaneous emission (ASE) photons, and the spectral distortion of the amplified signal. Mostly, the overall gain and the saturation characteristic of the amplifier determine the ratio of stimulated emission to ASE. The spectral distortion of the signal is due to the narrow gain window of the VCSOA, but the effect significantly degrades the visibility only for relatively large wavelength mismatch from the gain peak. Analytic expressions may be used to identify the optimal bias current and optical input power to maximize the amplifier gain and visibility of the interference.

  3. Improving Students' Understanding of Lock-In Amplifiers

    Science.gov (United States)

    DeVore, Seth; Gauthier, Alexandre; Levy, Jeremy; Chandralekha, Singh

    2014-03-01

    A lock-in amplifier is a versatile instrument frequently used in physics research. However, many students struggle with the basic operating principles of a lock-in amplifier which can lead to a variety of difficulties. To improve students' understanding, we have been developing and evaluating a research-based tutorial which makes use of a computer simulation of a lock-in amplifier. The tutorial is based on a field-tested approach in which students realize their difficulties after predicting the outcome of simulated experiments involving a lock-in amplifier and check their predictions using the simulated lock-in amplifier. Then, the tutorial guides and helps students develop a coherent understanding of the basics of a lock-in amplifier. The tutorial development involved interviews with physics faculty members and graduate students and iteration of many versions of the tutorial with professors and graduate students. The student difficulties and the development and assessment of the research-based tutorial are discussed. We thank National Science Foundation for award NSF-1124131.

  4. Improving Students' Understanding of Lock-in Amplifiers

    CERN Document Server

    DeVore, Seth; Levy, Jeremy; Singh, Chandralekha

    2016-01-01

    A lock-in amplifier is a versatile instrument frequently used in physics research. However, many students struggle with the basic operating principles of a lock-in amplifier which can lead to a variety of difficulties. To improve students' understanding, we have been developing and evaluating a research-based tutorial which makes use of a computer simulation of a lock-in amplifier. The tutorial is based on a field-tested approach in which students realize their difficulties after predicting the outcome of simulated experiments involving a lock-in amplifier and check their predictions using the simulated lock-in amplifier. Then, the tutorial guides and helps students develop a coherent understanding of the basics of a lock-in amplifier. The tutorial development involved interviews with physics faculty members and graduate students and iteration of many versions of the tutorial with professors and graduate students. The student difficulties and the development and assessment of the research-based tutorial are d...

  5. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  6. Entropy production in ac-calorimetry

    OpenAIRE

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  7. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  8. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  9. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  10. Optimization of the Diode-Pumped Solid State Nd:YLF Amplifier Chain for the 263 nm Drive Laser at the FAST Facility

    Science.gov (United States)

    Gillis, Julie M.; Corcovilos, Theodore A.; Edstrom, Dean R., Jr.; Ruan, Jinhao; Santucci, James K.

    The RF photoinjector of the 50 MeV superconducting electron linear accelerator at the Fermilab Accelerator Science and Technology (FAST) Facility is driven by a phase-locked laser system. The neodymium-doped yttrium-lithium fluoride (Nd:YLF) seed laser provides short (3 ps) infrared (1053 nm) pulses to an amplifier chain before conversion to ultraviolet (263 nm) through two frequency-doubling BBO crystals. The amplification section consists of seven diode-pumped solid state (DPSS) amplifiers, which increase the pulse energy of the seed laser using optically end-pumped Nd:YLF crystals. To maximize the total gain of the amplifier chain, each stage must be properly tuned with optimized optics, alignment, and laser beam characterization. In this paper we report on one of the single-pass amplifier improvements to achieve a consistent gain of 4.83 with stabilized output pulse trains for up to 1500 seed pulses. The final ultraviolet pulses imaged onto the Cs2Te photocathode of the RF electron gun have been doubled in energy to 10.2 μJ per pulse as a result of these alterations. Operated by Fermi Research Alliance, LLC under Contract No. De-AC02-07CH11359 with the United States Department of Energy.

  11. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  12. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  13. Long-term preservation of antibody-dependent cellular cytotoxicity (ADCC) of natural killer cells amplified in vitro from the peripheral blood of breast cancer patients after chemotherapy.

    Science.gov (United States)

    Clémenceau, Béatrice; Gallot, Géraldine; Vivien, Régine; Gaschet, Joëlle; Campone, Mario; Vié, Henri

    2006-01-01

    Twenty percent of breast cancer adenocarcinomas overexpress the oncogene c-erb-2 that is recognized by the humanized anti-Her2/neu monoclonal antibody Herceptin. Results from clinical studies suggest that antibody-dependent cellular cytotoxicity (ADCC) is involved in the clinical response of Herceptin-treated patients. The purpose of the current study was to evaluate the possibility of amplifying in vitro the CD3-/CD16+ natural killer (NK) cell subset that mediates ADCC from breast cancer patients after chemotherapy. Peripheral blood mononuclear cells from six breast cancer patients taken 2 months after chemotherapy completion were co-cultured with an autologous irradiated Epstein-Barr virus-transformed B-lymphoblastoid cell line (LCL) in the presence of interleukin-2 (IL-2) for 4-6 weeks. These LCL + IL2 activated cultures (ACs) were tested for ADCC potential, and their CD3/CD16 NK proportion was quantified. Among the ACs, the proportion of CD3-/CD16+ NK cells increased up to 64% over the first 2 weeks of culture and the ACs continued to expand for 1 month thereafter. Control and patient ACs displayed ADCC activity (tested in the presence of Rituximab against the autologous LCL to take into account any possible effect of inhibitory NK receptors) as well as against the MCF-7(Her2/neu) breast cancer cell line in the presence of Herceptin. This ADCC activity was maintained during the entire culture period. In conclusion, chemotherapy in breast cancer patients does not obviate the possibility of amplifying in vitro the NK cell subset that mediates ADCC. Consequently, adoptive transfer of lymphocytes mediating ADCC can be considered using this protocol to test its benefit in patients under Herceptin treatment. PMID:16365600

  14. Rare Earth Doped Fiber Amplifiers for the First Telecommunication Window

    Science.gov (United States)

    Sridhar, Balakrishnan

    A complete experimental and theoretical study of rare earth doped fiber-optic amplifiers for the first tele-communication window has been made. The thulium doped fluoride fiber amplifier is shown to provide amplification in the 800nm-820nm signal region. A complete steady state theoretical model has been presented and the model has been experimentally verified. The model predicts the gain, noise figure and the amplified spontaneous emission in the 800nm, 1470nm, 1900nm and 2300nm bands. The effect of population trapping at the ^3F_4 energy level of thulium ion is also shown with the help of the model. It has been shown that about 5 -15%o of the population is trapped at the ^3F _4 energy level. We have also shown theoretically, the expected gain and noise performance of Thulium doped fluoride fiber amplifiers pumped in the 680nm absorption band. The maximum gain at 806nm is slightly lower than with comparable 780 nm pumping. The gain bandwidth is however found to increase with 680nm pumping. The higher ASE at shorter wavelengths (flouride fiber amplifier in the 850nm signal band for the first time. The amplification is through an up-conversion process. The erbium doped flouride fiber amplifier was pumped with an estimated pump power of 35mW at 792nm. We have also considered a theoretical model for a single mode erbium doped fluoride fiber amplifier. Efficient amplification occurs because of the strong excited state absorption at the pump wavelength from the ^4I_{13/2} energy level.

  15. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  16. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled......-second average at its output, while simultaneously achieving inductive voltage boosting by shooting through either an appropriately selected inverter phase-leg or two phase-legs being commanded simultaneously. More interestingly, these performance features are achieved with no increase in the number...

  17. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    OpenAIRE

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  18. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  19. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  20. Design of A Microwave Amplifier for Wireless Application

    Directory of Open Access Journals (Sweden)

    M. H. Ullah

    2012-01-01

    Full Text Available Problem statement: Low-Noise Amplifiers (LNA are very indispensable components in the design of numerous types of communication receivers employed in microwave technology. This paper is presents the design and development of low bias(Vce = 8v, Ic =10 mA single stage low noise microwave amplifier operating in 1.5GHZ frequency range, Gain 13dB ± 0.5dB, input/output return loss Approach: The principal design target is to obtain a minimum noise figure while concomitantly achieving a maximum gain by presenting the optimum noise impedance (Zopt which is characteristically implemented by adding a matching circuit between the source and the input of the amplifier. Results: The proposed low-noise amplifier for microwave wireless application is designed, simulated and optimized using Serenade Harmonica (by Ansoft Corporation and Advance Design System (ADS software by Agilent. Conclusion: In this paper a low-noise amplifier operated at 1.5 GHz. is designed because of the significant roles played in the field of microwave communication technology, which includes the application in the output stage of a transmitter where the signals needs to be strengthen before transmission.

  1. Residual phase noise modeling of amplifiers using silicon bipolar transistors.

    Science.gov (United States)

    Theodoropoulos, Konstantinos; Everard, Jeremy

    2010-03-01

    In this paper, we describe the modeling of residual 1/f phase noise for Si bipolar amplifiers operating in the linear region. We propose that for Si bipolar amplifiers, the 1/f phase noise is largely caused by the base emitter recombination flicker noise. The up-conversion mechanism is described through linear approximation of the phase variation of the amplifier phase response by the variation of the device parameters (C(b)c, C(be), g(m), r(e)) caused by the recombination 1/f noise. The amplifier phase response describes the device over the whole frequency range of operation for which the influence of the poles and zeros is investigated. It is found that for a common emitter amplifier it is sufficient to only incorporate the effect of the device poles to describe the phase noise behavior over most of its operational frequency range. Simulations predict the measurements of others, including the flattening of the PM noise at frequencies beyond f(3dB), not predicted by previous models.

  2. Power neodymium-glass amplifier of a repetitively pulsed laser

    Energy Technology Data Exchange (ETDEWEB)

    Vinogradov, Aleksandr V; Gaganov, V E; Garanin, Sergey G; Zhidkov, N V; Krotov, V A; Martynenko, S P; Pozdnyakov, E V; Solomatin, I I [Russian Federal Nuclear Center ' All-Russian Research Institute of Experimental Physics' , Sarov, Nizhnii Novgorod region (Russian Federation)

    2011-11-30

    A neodymium-glass diode-pumped amplifier with a zigzag laser beam propagation through the active medium was elaborated; the amplifier is intended for operation in a repetitively pulsed laser. An amplifier unit with an aperture of 20 Multiplication-Sign 25 mm and a {approx}40-cm long active medium was put to a test. The energy of pump radiation amounts to 140 J at a wavelength of 806 nm for a pump duration of 550 {mu}s. The energy parameters of the amplifier were experimentally determined: the small-signal gain per pass {approx}3.2, the linear gain {approx}0.031 cm{sup -1} with a nonuniformity of its distribution over the aperture within 15%, the stored energy of 0.16 - 0.21 J cm{sup -3}. The wavefront distortions in the zigzag laser-beam propagation through the active element of the amplifier did not exceed 0.4{lambda} ({lambda} = 0.63 {mu}m is the probing radiation wavelength).

  3. Design and development of digital seismic amplifier recorder

    Energy Technology Data Exchange (ETDEWEB)

    Samsidar, Siti Alaa; Afuar, Waldy; Handayani, Gunawan, E-mail: gunawanhandayani@gmail.com [Department of Physics, ITB (Indonesia)

    2015-04-16

    A digital seismic recording is a recording technique of seismic data in digital systems. This method is more convenient because it is more accurate than other methods of seismic recorders. To improve the quality of the results of seismic measurements, the signal needs to be amplified to obtain better subsurface images. The purpose of this study is to improve the accuracy of measurement by amplifying the input signal. We use seismic sensors/geophones with a frequency of 4.5 Hz. The signal is amplified by means of 12 units of non-inverting amplifier. The non-inverting amplifier using IC 741 with the resistor values 1KΩ and 1MΩ. The amplification results were 1,000 times. The results of signal amplification converted into digital by using the Analog Digital Converter (ADC). Quantitative analysis in this study was performed using the software Lab VIEW 8.6. The Lab VIEW 8.6 program was used to control the ADC. The results of qualitative analysis showed that the seismic conditioning can produce a large output, so that the data obtained is better than conventional data. This application can be used for geophysical methods that have low input voltage such as microtremor application.

  4. Low input voltage switching amplifiers for piezoelectric actuators

    Science.gov (United States)

    Lindner, Douglas K.; Zhu, Huiyu; Song, Chunping; Huang, Weixing; Cheng, Danling

    2002-07-01

    The Inertially Stabilized Rifle is a new stabilized rifle system that can eliminate the disturbances induced by the shooter. Recurve actuator is used in this system to provide the precise movement of the rifle barrel. In such a portable device, only low voltage electrical sources are available yet the piezoelectric actuator needs high voltage to drive the actuator. The actuators consume little real power but a large amount of reactive power. Furthermore, the piezoelectric actuators are present an almost purely capacitive load. In this paper, we describe the development of a low input voltage amplifier for a high voltage piezoelectric actuator. This amplifier is based on switching technology so it efficiently handles the regenerative energy from the piezoelectric actuator. This amplifier consists of two stages. The first stage is a flyback converter which boosts the (low) input voltage to the maximum voltage required by the piezoelectric actuator. The second stage is a half-bridge amplifier which delivers the output voltage to the actuator as commanded by the reference signal. The basic structure of the amplifier is described, and its performance is characterized in terms of bandwidth, distortion, and efficiency.

  5. Spectroscopic amplifier for pin diode; Amplificador espectroscopico para diodo Pin

    Energy Technology Data Exchange (ETDEWEB)

    Alonso M, M. S.; Hernandez D, V. M.; Vega C, H. R., E-mail: bebe.luna_s@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2014-10-15

    The photodiode remains the basic choice for the photo-detection and is widely used in optical communications, medical diagnostics and field of corpuscular radiation. In detecting radiation it has been used for monitoring radon and its progeny and inexpensive spectrometric systems. The development of a spectroscopic amplifier for Pin diode is presented which has the following characteristics: canceler Pole-Zero (P/Z) with a time constant of 8 μs; constant gain of 57, suitable for the acquisition system; 4th integrator Gaussian order to waveform change of exponential input to semi-Gaussian output and finally a stage of baseline restorer which prevents Dc signal contribution to the next stage. The operational amplifier used is the TLE2074 of BiFET technology of Texas Instruments with 10 MHz bandwidth, 25 V/μs of slew rate and a noise floor of 17 nv/(Hz)1/2. The integrated circuit has 4 operational amplifiers and in is contained the total of spectroscopic amplifier that is the goal of electronic design. The results show like the exponential input signal is converted to semi-Gaussian, modifying only the amplitude according to the specifications in the design. The total system is formed by the detector, which is the Pin diode, a sensitive preamplifier to the load, the spectroscopic amplifier that is what is presented and finally a pulse height analyzer (Mca) which is where the spectrum is shown. (Author)

  6. Ways to suppress click and pop for class D amplifiers

    Science.gov (United States)

    Haishi, Wang; Bo, Zhang; Jiang, Sun

    2012-08-01

    Undesirable audio click and pop may be generated in a speaker or headphone. Compared to linear (class A/B/AB) amplifiers, class D amplifiers that comprise of an input stage and a modulation stage are more prone to producing click and pop. This article analyzes sources that generate click and pop in class D amplifiers, and corresponding ways to suppress them. For a class D amplifier with a single-ended input, click and pop is likely to be due to two factors. One is from a voltage difference (VDIF) between the voltage of an input capacitance (VCIN) and a reference voltage (VREF) of the input stage, and the other one is from the non-linear switching during the setting up of the bias and feedback voltages/currents (BFVC) of the modulation stage. In this article, a fast charging loop is introduced into the input stage to charge VCIN to roughly near VREF. Then a correction loop further charges or discharges VCIN, substantially equalizing it with VREF. Dummy switches are introduced into the modulation stage to provide switching signals for setting up BFVC, and the power switches are disabled until the BFVC are set up successfully. A two channel single-ended class D amplifier with the above features is fabricated with 0.5 μm Bi-CMOS process. Road test and fast Fourier transform analysis indicate that there is no noticeable click and pop.

  7. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  8. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  9. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  10. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  11. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  12. The abundance of nahAc genes correlates with the 14C-naphthalene mineralization potential in petroleum hydrocarbon-contaminated oxic soil layers.

    Science.gov (United States)

    Tuomi, Pirjo M; Salminen, Jani M; Jørgensen, Kirsten S

    2004-12-27

    In this study, we evaluated whether the abundance of the functional gene nahAc reflects aerobic naphthalene degradation potential in subsurface and surface samples taken from three petroleum hydrocarbon contaminated sites in southern Finland. The type of the contamination at the sites varied from lightweight diesel oil to high molecular weight residuals of crude oil. Samples were collected from both oxic and anoxic soil layers. The naphthalene dioxygenase gene nahAc was quantified using a replicate limiting dilution-polymerase chain reaction (RLD-PCR) method with a degenerate primer pair. In the non-contaminated samples nahAc genes were not detected. In the petroleum hydrocarbon-contaminated oxic soil samples nahAc gene abundance [range 3 x 10(1)-9 x 10(4) copies (g dry wt soil)(-1)] was correlated (Kendall non-parametric correlation r2=0.459, p<0.01) with the aerobic 14C-naphthalene mineralization potential (range 1 x 10(-5)-0.1 d(-1)) measured in microcosms at in situ temperatures (8 degrees C for subsurface and 20 degrees C for surface soil samples). In these samples nahAc gene abundance was also correlated with total microbial cell counts (r2=0.471, p<0.01), respiration rate (r2=0.401, p<0.01) and organic matter content (r2=0.341, p<0.05). NahAc genes were amplified from anoxic soil layers indicating that, although involved in aerobic biodegradation of naphthalene, these genes or related sequences were also present in the anoxic subsurface. In the samples taken from the anoxic layers, the aerobic 14C-naphthalene mineralization rates were not correlated with nahAc gene abundance. In conclusion, current sequence information provides the basis for a robust tool to estimate the naphthalene degradation potential at oxic zones of different petroleum hydrocarbon-contaminated sites undergoing in situ bioremediation. PMID:16329859

  13. Josephson traveling-wave parametric amplifier for superconducting qubit readout

    Science.gov (United States)

    Macklin, Chris; Slichter, D. H.; Yaakobi, O.; Friedland, L.; Bolkhovsky, V.; Braje, D. A.; Fitch, G.; Oliver, W. D.; Siddiqi, I.

    2014-03-01

    Superconducting parametric amplifiers (paramps) have successfully demonstrated near quantum limited sensitivity, enabling single-shot qubit readout, feedback, and state tracking. However, these amplifiers are commonly limited to narrow bandwidth and modest dynamic range, and most require microwave circulators to separate input and output modes. These limitations stem from the use of a resonant non-linearity to achieve mixing between a signal and pump mode. Our traveling-wave parametric amplifier (TWPA) is based on a superconducting nonlinear Josephson junction transmission line, thereby inherently sidestepping the limitations associated with a cavity structure. We present theoretical predictions and experimental results, including improved gain and noise performance. We discuss transmon qubit readout in the circuit QED architecture using a TWPA. We also comment on promising architectures for chip-level integration and multiplexing. Work supported by IARPA.

  14. Spectrally tailored supercontinuum generation from single-mode-fiber amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Hao, Qiang; Guo, Zhengru; Zhang, Qingshan [Shanghai Key Laboratory of Modern Optical System, Engineering Research Center of Optical Instrument and System (Ministry of Education), School of Optical-Electrical and Computer Engineering, University of Shanghai for Science and Technology, 516 Jungong Road, Shanghai 200093 (China); Liu, Yang; Li, Wenxue [State Key Laboratory of Precision Spectroscopy, East China Normal University, 3663 Zhongshan North Road, Shanghai 200062 (China); Zeng, Heping, E-mail: hpzeng@phy.ecnu.edu.cn [Shanghai Key Laboratory of Modern Optical System, Engineering Research Center of Optical Instrument and System (Ministry of Education), School of Optical-Electrical and Computer Engineering, University of Shanghai for Science and Technology, 516 Jungong Road, Shanghai 200093 (China); State Key Laboratory of Precision Spectroscopy, East China Normal University, 3663 Zhongshan North Road, Shanghai 200062 (China)

    2014-05-19

    Spectral filtering of an all-normal-dispersion Yb-doped fiber laser was demonstrated effective for broadband supercontinuum generation in the picosecond time region. The picosecond pump pulses were tailored in spectrum with 1 nm band-pass filter installed between two single-mode fiber amplifiers. By tuning the spectral filter around 1028 nm, four-wave mixing was initiated in a photonic crystal fiber spliced with single-mode fiber, as manifested by the simultaneous generation of Stokes wave at 1076 nm and anti-Stokes wave at 984 nm. Four-wave mixing took place in cascade with the influence of stimulated Raman scattering and eventually extended the output spectrum more than 900 nm of 10 dB bandwidth. This technique allows smooth octave supercontinuum generation by using simple single-mode fiber amplifiers rather than complicated multistage large-mode-area fiber amplifiers.

  15. Beam intensity reshaping by pump modification in a laser amplifier.

    Science.gov (United States)

    Litvin, Igor A; Collet, Oliver J P; King, Gary; Strauss, Hencharl

    2015-11-16

    We propose a new technique for laser beam shaping into a desirable beam profile by using a laser amplifier with a pump beam that has a modified intensity profile. We developed the analytical formula, which describes the transformation of the seed beam into the desired beam profile in a four level amplifiers small signal regime. We propose a numerically method to obtain the required pump intensity profile in the case where high pump power saturated the laser crystal or for three level materials. The theory was experimentally verified by one dimensionally shaping a Gaussian shaped seed into a Flat-Top beam in a Ho:YLF amplifier pumped by a Tm:YLF laser with a HG(01) intensity profile. PMID:26698497

  16. Modal instabilities in very large mode area rod fiber amplifiers

    DEFF Research Database (Denmark)

    Jørgensen, Mette Marie; Hansen, Kristian Rymann; Laurila, Marko;

    Optical fiber amplifiers have gained increased scientific and commercial interest due to high output powers with easy operation and maintenance. The main advantages of fiber amplifiers are good thermal properties, due to a large surface/volume ratio, excellent beam quality and stability [1]. Very...... large core fiber areas are highly desirable to mitigate various nonlinear processes, such as Kerr, four-wave mixing, Raman, and Brillouin effects. It is difficult to scale up the core area without going into a multi-moded regime. Microstructured fiber technology has allowed core diameters of 60...... with the finite element method to allow complex micro structured fibers to be considered. Thereby the modal instability threshold is estimated for very large mode area fiber amplifiers of various photonic crystal fiber designs. Experimentally the modal instability threshold for very large mode area fiber...

  17. Modeling Distortion Effects in Class-D Amplifier Filter Inductors

    DEFF Research Database (Denmark)

    Knott, Arnold; Stegenborg-Andersen, Tore; Thomsen, Ole Cornelius;

    2010-01-01

    Distortion is generally accepted as a quantifier to judge the quality of audio power amplifiers. In switchmode power amplifiers various mechanisms influence this performance measure. After giving an overview of those, this paper focuses on the particular effect of the nonlinearity of the output...... filter components on the audio performance. While the physical reasons for both, the capacitor and the inductor induced distortion are given, the practical in depth demonstration is done for the inductor only. This includes measuring the inductors performance, modeling through fitting and resulting...... into simulation models. The fitted models achieve distortion values between 0.03 % and 0.2 % as a basis to enable the design of a 200 W amplifier....

  18. Fiber optical parametric amplifiers in optical communication systems

    DEFF Research Database (Denmark)

    Marhic, Michel E.; Andrekson, Peter A.; Petropoulos, Periklis;

    2015-01-01

    The prospects for using fiber optical parametric amplifiers (OPAs) in optical communication systems are reviewed. Phase-insensitive amplifiers (PIAs) and phase-sensitive amplifiers (PSAs) are considered. Low-penalty amplification at/or near 1 Tb/s has been achieved, for both wavelength- and time......-division multiplexed formats. High-quality mid-span spectral inversion has been demonstrated at 0.64 Tb/s, avoiding electronic dispersion compensation. All-optical amplitude regeneration of amplitude-modulated signals has been performed, while PSAs have been used to demonstrate phase regeneration of phase...... in excess of 14,000 Tb/s x km in realistic wavelength-division multiplexed long-haul networks. Technical challenges remaining to be addressed in order for fiber OPAs to become useful for long-haul communication networks are discussed....

  19. Theoretical Analysis of Rayleigh Backscattering Noise in Fiber Raman Amplifiers

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    In this paper, a new theoretical model for Rayleigh backscattering (RB) analysis of fiber Raman amplifiers is proposed. The model includes all the interactions among the pumps, signals, and all orders of RB. The results show that the higher order RB has a negligible influence on the performance of the amplifier. The co-propagating and counterpropagating RB power of the signal grow quadratically with the net-gain of the amplifier. The signal to double Rayleigh backscattering noise ratio (OSNRDRB ) of backward-pumped FRAs is better than that of the forward-pumped ones at high net-gain level (> 13 dB), while at low net-gain level the OSNRDrb of the forward-pumped FRAs is slightly better than that of the backward-pumped ones.

  20. Using MEMS Capacitive Switches in Tunable RF Amplifiers

    Directory of Open Access Journals (Sweden)

    Danson John

    2006-01-01

    Full Text Available A MEMS capacitive switch suitable for use in tunable RF amplifiers is described. A MEMS switch is designed, fabricated, and characterized with physical and RF measurements for inclusion in simulations. Using the MEMS switch models, a dual-band low-noise amplifier (LNA operating at GHz and GHz, and a tunable power amplifier (PA at GHz are simulated in m CMOS. MEMS switches allow the LNA to operate with 11 dB of isolation between the two bands while maintaining dB of gain and sub- dB noise figure. MEMS switches are used to implement a variable matching network that allows the PA to realize up to 37% PAE improvement at low input powers.

  1. IMPATT power building blocks for 20 GHz spaceborne transmit amplifier

    Science.gov (United States)

    Asmus, J.; Cho, Y.; Degruyl, J.; Ng, E.; Giannakopoulos, A.; Okean, H. C.

    1982-01-01

    Single-stage circulator coupled IMPATT building block constituents of a 20-GHz solid state power amplifier (SSPA) currently under development for spaceborne downlink transmitter usage have been demonstrated as providing 1.5 to 2.0W RF power output at 4 to 5 dB operating gain over a 1 GHz bandwidth. Using either commercially available or recently developed in-house GaAs Schottky Read-profile IMPATT diodes, DC/RF power added efficiencies of 14 to 15% were achieved in these amplifier stages. A two stage IMPATT driver amplifier with similar RF output power capability exhibited 13 + or - 0.5 dB operating gain over a 1 GHz bandwidth.

  2. The design of a 4’th order Bandpass Butterworth filter with one operational amplifier

    DEFF Research Database (Denmark)

    Gaunholt, Hans

    2008-01-01

    band pass filter with Butterworth poles applying just one operational amplifier coupled as a unity gain amplifier. The unity gain amplifiers have the advantage of providing low power consumption, yielding a large dynamic range, sometimes simplifying the amplifier design and being usable over a larger...... frequency range than conventional constant gain amplifiers. The Schoeffler sensitivity index is used as a basis for a practical realization of the circuit....

  3. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  4. Thermal-recovery of modal instability in rod fiber amplifiers

    DEFF Research Database (Denmark)

    Jørgensen, Mette Marie; Laurila, Marko; Noordegraaf, Danny;

    2013-01-01

    We investigate the temporal dynamics of Modal instabilities (MI) in ROD fiber amplifiers using a 100 μm core rod fiber in a single-pass amplifier configuration, and we achieve ~200W of extracted output power before the onset of MI. Above the MI threshold, we investigate the temporal dynamics of b...... and thermally annealed between each test series. We find that the MI threshold degrades as it is reached multiple times, but is recovered by thermal annealing. We also find that the test history of the rods affects the temporal dynamics....

  5. Design of Low Noise Microwave Amplifiers Using Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Sadık Ulker

    2012-08-01

    Full Text Available This short paper presents a work on the design of low noise microwave amplifiers using particle swarmoptimization (PSO technique. Particle Swarm Optimization is used as a method that is applied to a singlestage amplifier circuit to meet two criteria: desired gain and desired low noise. The aim is to get the bestoptimized design using the predefined constraints for gain and low noise values. The code is written toapply the algorithm to meet the desired goals and the obtained results are verified using differentsimulators. The results obtained show that PSO can be applied very efficiently for this kind of designproblems with multiple constraints.

  6. Design of Low Noise Microwave Amplifiers Using Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Sadık Ülker

    2012-07-01

    Full Text Available This short paper presents a work on the design of low noise microwave amplifiers using particle swarm optimization (PSO technique. Particle Swarm Optimization is used as a method that is applied to a single stage amplifier circuit to meet two criteria: desired gain and desired low noise. The aim is to get the best optimized design using the predefined constraints for gain and low noise values. The code is written to apply the algorithm to meet the desired goals and the obtained results are verified using different simulators. The results obtained show that PSO can be applied very efficiently for this kind of design problems with multiple constraints.

  7. Dispersion-Engineered Traveling Wave Kinetic Inductance Parametric Amplifier

    Science.gov (United States)

    Zmuidzinas, Jonas (Inventor); Day, Peter K. (Inventor)

    2014-01-01

    A traveling wave kinetic inductance parametric amplifier comprises a superconducting transmission line and a dispersion control element. The transmission line can include periodic variations of its dimension along its length. The superconducting material can include a high normal state resistivity material. In some instances the high normal state resistivity material includes nitrogen and a metal selected from the group consisting of titanium, niobium and vanadium. The traveling wave kinetic inductance parametric amplifier is expected to exhibit a noise temperature below 100 mK/GHz.

  8. Investigation of accelerator's characteristics used for an energy amplifier

    International Nuclear Information System (INIS)

    The sub-critical reactor of the energy amplifier is a kind of swimming pool reactors, operates by fast neutron and uses ThO2 + 0.1U233 as fuel. The long cylindrical fuel bars are arranged in constant steps according to a hexagonal configuration. The two fuel assemblies are with the 12.43 mm and 11.38 mm fuel bar steps. The cell group parameters and effective neutron multiplication coefficient of the energy amplifier including two neutron energy groups are defined by the WIMS-D homogenization code. Their calculating results are presented. (NHA)

  9. High efficiency coherent beam combining of semiconductor optical amplifiers.

    Science.gov (United States)

    Creedon, Kevin J; Redmond, Shawn M; Smith, Gary M; Missaggia, Leo J; Connors, Michael K; Kansky, Jan E; Fan, Tso Yee; Turner, George W; Sanchez-Rubio, Antonio

    2012-12-01

    We demonstrate 40 W coherently combined output power in a single diffraction-limited beam from a one-dimensional 47-element array of angled-facet slab-coupled optical waveguide amplifiers at 1064 nm. The output from each emitter was collimated and overlapped onto a diffractive optical element combiner using a common transform lens. Phase locking was achieved via active feedback on each amplifier's drive current to maximize the power in the combined beam. The combining efficiency at all current levels was nearly constant at 87%.

  10. Resonant Phase Matching of Josephson Junction Traveling Wave Parametric Amplifiers

    Science.gov (United States)

    O'Brien, Kevin; Macklin, Chris; Siddiqi, Irfan; Zhang, Xiang

    2014-10-01

    We propose a technique to overcome phase mismatch in Josephson-junction traveling wave parametric amplifiers in order to achieve high gain over a broad bandwidth. Using "resonant phase matching," we design a compact superconducting device consisting of a transmission line with subwavelength resonant inclusions that simultaneously achieves a gain of 20 dB, an instantaneous bandwidth of 3 GHz, and a saturation power of -98 dBm. Such an amplifier is well suited to cryogenic broadband microwave measurements such as the multiplexed readout of quantum coherent circuits based on superconducting, semiconducting, or nanomechanical elements, as well as traditional astronomical detectors.

  11. In-amplifier mid-infrared supercontinuum generation.

    Science.gov (United States)

    Gauthier, Jean-Christophe; Fortin, Vincent; Duval, Simon; Vallée, Réal; Bernier, Martin

    2015-11-15

    Mid-infrared supercontinuum (SC) generation from 2.6 to 4.1 μm is demonstrated in a single-mode erbium-doped fluoride glass fiber amplifier pumped at 976 nm and seeded by an optical parametric generation (OPG) source emitting 400 ps pulses at 2.75 μm. Up to 82% of the SC power is generated beyond 3 μm. This novel and simple in-amplifier SC generation approach is promising for the development of compact and efficient sources operating in the mid-infrared, especially in the 3-5 μm band. PMID:26565846

  12. Solid-state microwave high-power amplifiers

    CERN Document Server

    Sechi, Franco

    2009-01-01

    This practical resource offers expert guidance on the most critical aspects of microwave power amplifier design. This comprehensive book provides descriptions of all the major active devices, discusses large signal characterization, explains all the key circuit design procedures. Moreover you gain keen insight on the link between design parameters and technological implementation, helping you achieve optimal solutions with the most efficient utilization of available technologies. The book covers a broad range of essential topics, from requirements for high-power amplifiers, device models, phas

  13. Accurate simulation of Raman amplified lightwave synthesized frequency sweeper

    DEFF Research Database (Denmark)

    Pedersen, Anders Tegtmeier; Olesen, Anders Sig; Rottwitt, Karsten

    2011-01-01

    A lightwave synthesized frequency sweeper using a Raman amplifier for loss compensation is presented together with a numerical model capable of predicting the shape of individual pulses as well as the overall envelope of more than 100 pulses. The generated pulse envelope consists of 116 pulses...... with constant peak power and no significant growth of noise. The numerical simulation is based on careful measurements of the physical properties of the individual components and a well established Raman amplifier model. Very good agreement between the measured and the simulated data is found. (C) 2011 Optical...

  14. Multislice behavioral modeling based on envelope domain for power amplifiers

    Institute of Scientific and Technical Information of China (English)

    Wang Huadong; Bao Jingfu; Wu Zhengde

    2009-01-01

    An envelope domain multislice behavioral modeling is introduced. The tradition AM-AM and AM-PM characteristics of power amplifiers are extended to envelope domain and base-band filter is applied to distortion complex envelope signal for description of the envelope memory effect. Using traditional one and two-tone tests, the coefficients of nonlinear model and the FIR filter can be extracted. At last the model has been applied to a 10 W WCDMA power amplifier to predict its output signal. And simulation results show that the model output conforms very well to the traditional transistor level simulation results.

  15. Four-wave mixing in nanosecond pulsed fiber amplifiers.

    Science.gov (United States)

    Fève, Jean-Philippe; Schrader, Paul E; Farrow, Roger L; Kliner, Dahv A V

    2007-04-16

    We present an experimental and theoretical analysis of four-wave mixing in nanosecond pulsed amplifiers based on double-clad ytterbium-doped fibers. This process leads to saturation of the amplified pulse energy at 1064 nm and to distortion of the spectral and temporal profiles. These behaviours are well described by a simple model considering both Raman and four-wave-mixing contributions. The role of seed laser polarization in birefringent fibers is also presented. These results point out the critical parameters and possible tradeoffs for optimization. PMID:19532710

  16. Tapered amplifier laser with frequency-shifted feedback

    CERN Document Server

    Bayerle, A; Vlaar, P; Pasquiou, B; Schreck, F

    2016-01-01

    We present a frequency-shifted feedback (FSF) laser based on a tapered amplifier. The laser operates as a coherent broadband source with up to 370GHz spectral width and 2.3us coherence time. If the FSF laser is seeded by a continuous-wave laser a frequency comb spanning the output spectrum appears in addition to the broadband emission. The laser has an output power of 280mW and a center wavelength of 780nm. The ease and flexibility of use of tapered amplifiers makes our FSF laser attractive for a wide range of applications, especially in metrology.

  17. DC SQUID amplifier for NMR experiments on small samples

    International Nuclear Information System (INIS)

    Low noise preamplifiers are required for the detection of the magnetic resonance of small size samples or at low magnetic fields. According to calculations based on the en, in model. SQUID based amplifiers are more suitable to NMR experiments on small samples than semiconductor amplifiers. We propose an amplification method by frequency transposition using a DC SQUID. Such a system can be run over a broad range of frequency as the noise impedance of the stages subsequent to the SQUID is continually optimised. The measurements are in good agreement with our theoretical model, based on a simplified voltage to flux SQUID characteristic. (orig.)

  18. Adaptation of a Digitally Predistorted RF Amplifier Using Selective Sampling

    Institute of Scientific and Technical Information of China (English)

    R. Neil Braithwaite

    2011-01-01

    In this paper, a reduced-cost method of measuring residual nonlinearities in an adaptive digitally predistorted amplifier is proposed. Measurements obtained by selective sampling of the amplifier output are integrated over the input envelope range to adapt a fourth-order polynomial predistorter with memory correction. Results for a WCDMA input with a 101 carrier configuration show that a transmitter using the proposed method can meet the adjacent channel leakage ratio (ACLR) specification. Inverse modeling of the nonlinearity is proposed as a future extension that will reduce the cost of the system further.

  19. High-power phase locking of a fiber amplifier array

    Science.gov (United States)

    Shay, T. M.; Baker, J. T.; Sanchez, A. D.; Robin, C. A.; Vergien, C. L.; Zeringue, C.; Gallant, D.; Lu, Chunte A.; Pulford, Benjamin; Bronder, T. J.; Lucero, Arthur

    2009-02-01

    We report high power phase locked fiber amplifier array using the Self-Synchronous Locking of Optical Coherence by Single-detector Electronic-frequency Tagging technique. We report the first experimental results for a five element amplifier array with a total locked power of more than 725-W. We will report on experimental measurements of the phase fluctuations versus time when the control loop is closed. The rms phase error was measured to be λ/60. Recent results will be reported. To the best of the authors' knowledge this is the highest fiber laser power to be coherently combined.

  20. Low-noise FET amplifier for dc SQUID

    International Nuclear Information System (INIS)

    We report on the design, characterization, and operation of a low-noise FET-input differential amplifier, which is used as second stage for a dc SQUID in the electronic instrumentation of the gravitational wave detector of the Rome group at CERN. The 3-dB bandwidth of the amplifier is from 10 kHz to 1.5 MHz. At the SQUID modulation frequency of 70 kHz the voltage noise is 0.5 nV/(Hz)1/2, the current noise is 35 fA/(Hz)1/2

  1. Gain dynamics and saturation in semiconductor quantum dot amplifiers

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper; Hvam, Jørn Märcher

    2004-01-01

    Quantum dot (QD)-based semiconductor optical amplifiers offer unique properties compared with conventional devices based on bulk or quantum well material. Due to the bandfilling properties of QDs and the existence of a nearby reservoir of carriers in the form of a wetting layer, QD semiconductor...... carrier populations in terms of a simple rate equation model. Based on the steady-state and small-signal properties of the model, we analyse and discuss the optical modulation response and the four-wave mixing properties of QD semiconductor optical amplifiers, in particular emphasizing the role...

  2. Spatial and spectral imaging of LMA photonic crystal fiber amplifiers

    DEFF Research Database (Denmark)

    Laurila, Marko; Lægsgaard, Jesper; Alkeskjold, Thomas Tanggaard;

    2011-01-01

    We demonstrate modal characterization using spatial and spectral resolved (S2) imaging, on an Ytterbium-doped large-mode-area photonic crystal fiber (PCF) amplifier and compare results with conventional cut-off methods. We apply numerical simulations and step-index fiber experiments to calibrate...... our mathematical and experimental routines of our S2 imaging system. We systematically analyze higher order mode (HOM) content of a polarizing 40μm core double-clad PCF amplifier with various launching and coiling configurations. We demonstrate a HOM suppression of more than -24dB with variance of 2...

  3. Genome profiling of ERBB2-amplified breast cancers

    International Nuclear Information System (INIS)

    Around 20% of breast cancers (BC) show ERBB2 gene amplification and overexpression of the ERBB2 tyrosine kinase receptor. They are associated with a poor prognosis but can benefit from targeted therapy. A better knowledge of these BCs, genomically and biologically heterogeneous, may help understand their behavior and design new therapeutic strategies. We defined the high resolution genome and gene expression profiles of 54 ERBB2-amplified BCs using 244K oligonucleotide array-comparative genomic hybridization and whole-genome DNA microarrays. Expression of ERBB2, phosphorylated ERBB2, EGFR, IGF1R and FOXA1 proteins was assessed by immunohistochemistry to evaluate the functional ERBB2 status and identify co-expressions. First, we identified the ERBB2-C17orf37-GRB7 genomic segment as the minimal common 17q12-q21 amplicon, and CRKRS and IKZF3 as the most frequent centromeric and telomeric amplicon borders, respectively. Second, GISTIC analysis identified 17 other genome regions affected by copy number aberration (CNA) (amplifications, gains, losses). The expression of 37 genes of these regions was deregulated. Third, two types of heterogeneity were observed in ERBB2-amplified BCs. The genomic profiles of estrogen receptor-postive (ER+) and negative (ER-) ERBB2-amplified BCs were different. The WNT/β-catenin signaling pathway was involved in ER- ERBB2-amplified BCs, and PVT1 and TRPS1 were candidate oncogenes associated with ER+ ERBB2-amplified BCs. The size of the ERBB2 amplicon was different in inflammatory (IBC) and non-inflammatory BCs. ERBB2-amplified IBCs were characterized by the downregulated and upregulated mRNA expression of ten and two genes in proportion to CNA, respectively. IHC results showed (i) a linear relationship between ERBB2 gene amplification and its gene and protein expressions with a good correlation between ERBB2 expression and phosphorylation status; (ii) a potential signaling cross-talk between EGFR or IGF1R and ERBB2, which could influence

  4. On Instantaneous Power Dissipation in Class B Amplifier

    Directory of Open Access Journals (Sweden)

    Hristo Zhivomirov

    2014-08-01

    Full Text Available The present paper describes the analysis of the instantaneous power dissipation by the two active components in a class B power amplifier. Attention is paid to restrictions of the instantaneous power dissipation relations in reference literature, and the consequences of their misuse. A new generalized equation that takes into account the power dissipated by the two active devices is proposed. The theoretical statement is substantiated by Matlab® numeric computation and visualization, Cadence OrCAD® simulations and measurements of a real-world audio power amplifier performed by NI USB-6211 measurement complex.

  5. Amplifier input impedance in dry electrode ECG recording.

    Science.gov (United States)

    Assambo, Cedric; Burke, Martin J

    2009-01-01

    This paper presents a novel approach for designing the front-end of instrumentation amplifiers for use in dry electrode recording of the human electrocardiogram (ECG). The method relies on information provided by the characterization of the skin-electrode interface and the analysis of low frequency ECG criteria defined by international standards. Marginal measurements of capacitive elements of the skin-electrode interface as small as 0.01 microF, suggest values of input impedance in the order of 1.3 GOmega. However, results in 99% of the data analyzed indicate that a recording amplifier providing an input impedance of 500 MOmega should ensure clear signal sensing without distortion.

  6. A Method To ModifyCorrect The Performance Of Amplifiers

    Directory of Open Access Journals (Sweden)

    Rohith Krishnan R

    2015-01-01

    Full Text Available Abstract The actual response of the amplifier may vary with the replacement of some aged or damaged components and this method is to compensate that problem. Here we use op-amp Fixator as the design tool. The tool helps us to isolate the selected circuit component from rest of the circuit adjust its operating point to correct the performance deviations and to modify the circuit without changing other parts of the circuit. A method to modifycorrect the performance of amplifiers by properly redesign the circuit is presented in this paper.

  7. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  8. A Tool and Methodology for AC-Stability Analysis of Continuous-Time Closed-Loop Systems

    CERN Document Server

    Milev, Momchil

    2011-01-01

    Presented are a methodology and a DFII-based tool for AC-stability analysis of a wide variety of closed-loop continuous-time (operational amplifiers and other linear circuits). The methodology used allows for easy identification and diagnostics of ac-stability problems including not only main-loop effects but also local-instability loops in current mirrors, bias circuits and emitter or source followers without breaking the loop. The results of the analysis are easy to interpret. Estimated phase margin is readily available. Instability nodes and loops along with their respective oscillation frequencies are immediately identified and mapped to the existing circuit nodes thus offering significant advantages compared to traditional "black-box" methods of stability analysis (Transient Overshoot, Bode and Phase margin plots etc.). The tool for AC-Stability analysis is written in SKILL? and is fully integrated in DFII? environment. Its "push-button" graphical user interface (GUI) is easy to use and understand. The t...

  9. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  10. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  11. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  12. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...

  13. Estudio acústico del Conservatorio de Piles

    OpenAIRE

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  14. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V.

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  15. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  16. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  17. Spectral hole-burning and carrier-heating dynamics in quantum-dot amplifiers: Comparison with bulk amplifiers

    DEFF Research Database (Denmark)

    Borri, P.; Langbein, W.; Hvam, Jørn Märcher;

    2001-01-01

    The ultrafast gain dynamics in an electrically pumped InAs/InGaAs/GaAs quantum-dot amplifier are measured at room temperature with femtosecond resolution, and compared with results on an InGaAsP bulk amplifier. The role of spectral hole burning and carrier heating in the recovery of the gain...... compression is investigated. Reduced carrier heating for both gain and refractive index dynamics of the quantum-dot device is found, which is a promising prerequisite for high-speed applications....

  18. Characteristics of GaAs complementary heterojunction FETs (C-HFETs) and C-HFET based amplifiers exposed to high neutron fluences

    International Nuclear Information System (INIS)

    This paper discusses the electrical properties of complementary GaAs heterojunction FETs and of amplifiers based on these devices before and after irradiation with neutrons for a total fluence of 1.1x1015 n/cm2. Measurements were made on the threshold voltage, the transconductance, the saturation drain current and the gate leakage current of the discrete transistors. For the preamplifiers, DC and AC characteristics as well as their input referred noise were measured. All devices remained fully functional after irradiation, with no anomalous behaviour. The overall change in transistor parameters after irradiation was typically 10%. The DC and AC characteristics of the amplifiers were found to remain stable after neutron irradiation. There is a slight increase in 1/f noise: For a total input capacitance of 1 pF and a shaping time of 50 ns an increase in the total ENC from 150 electrons before to 180 electrons after irradiation was measured for a preamplifier with 330 μm input FET. (orig.)

  19. The spectacular human nose: an amplifier of individual quality?

    Directory of Open Access Journals (Sweden)

    Åse Kristine Rognmo Mikalsen

    2014-04-01

    Full Text Available Amplifiers are signals that improve the perception of underlying differences in quality. They are cost free and advantageous to high quality individuals, but disadvantageous to low quality individuals, as poor quality is easier perceived because of the amplifier. For an amplifier to evolve, the average fitness benefit to the high quality individuals should be higher than the average cost for the low quality individuals. The human nose is, compared to the nose of most other primates, extraordinary large, fragile and easily broken—especially in male–male interactions. May it have evolved as an amplifier among high quality individuals, allowing easy assessment of individual quality and influencing the perception of attractiveness? We tested the latter by manipulating the position of the nose tip or, as a control, the mouth in facial pictures and had the pictures rated for attractiveness. Our results show that facial attractiveness failed to be influenced by mouth manipulations. Yet, facial attractiveness increased when the nose tip was artificially centered according to other facial features. Conversely, attractiveness decreased when the nose tip was displaced away from its central position. Our results suggest that our evaluation of attractiveness is clearly sensitive to the centering of the nose tip, possibly because it affects our perception of the face’s symmetry and/or averageness. However, whether such centering is related to individual quality remains unclear.

  20. Temporal and transverse coherence of self-amplified spontaneous emission

    Energy Technology Data Exchange (ETDEWEB)

    Kim, K.J.

    1997-06-01

    The authors review the coherence properties of the self-amplified spontaneous emission (SASE). Temporally, SASE is similar to the spontaneous undulator radiation except that the spectral bandwidth is about ten times narrower compared with typical undulator radiation. The situation is quite different in the transverse dimension, where SASE is fully coherent.

  1. Temporal and transverse coherence of self-amplified spontaneous emission

    Energy Technology Data Exchange (ETDEWEB)

    Kim, K. [Lawrence Berkeley National Laboratory, University of California, Berkeley, California94720 (United States)

    1997-06-01

    We review the coherence properties of the self-amplified spontaneous emission (SASE). Temporally, SASE is similar to the spontaneous undulator radiation except that the spectral bandwidth is about ten times narrower compared with typical undulator radiation. The situation is quite different in the transverse dimension, where SASE is fully coherent. {copyright} {ital 1997 American Institute of Physics.}

  2. Semiconductor quantum dot amplifiers for optical signal processing

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Uskov, A. V.; Bischoff, Svend;

    2001-01-01

    The dynamics of quantum dot semiconductor amplifiers are investigated theoretically with respect to the potential for ultrafast signal processing. The high-speed signal processing capacity of these devices is found to be limited by the wetting layer dynamics in case of electrical pumping, while...... optical pumping partly removes this limitation. Also, the possibility of using spectral hole burning for signal processing is discussed....

  3. Giant Geometrically Amplified Piezoresistance in Metal-Semiconductor Hybrid Resistors

    DEFF Research Database (Denmark)

    Hansen, Ole; Reck, Kasper; Thomsen, Erik Vilain

    2008-01-01

    We show that very high geometrically amplified piezoresistance can indeed be obtained in microstructured metal-semiconductor hybrid devices, even significantly higher amplification factors than the factor of approximately 8 demonstrated recently by Rowe and co-workers may be achieved. However, we...

  4. The Pathological and Physiological Roles of IL-6 Amplifier Activation

    Directory of Open Access Journals (Sweden)

    Masaaki Murakami, Toshio Hirano

    2012-01-01

    Full Text Available The NFκB-triggered positive feedback loop for IL-6 signaling in type 1 collagen+ non-immune cells (IL-6 amplifier was first discovered to be a synergistic signal that is activated following IL-17A and IL-6 stimulation in type 1 collagen+ non-immune cells. Subsequent disease models have shown that it can also be stimulated by the simultaneous activation of NFκB and STAT3, functions as a local chemokine inducer, and acts as a mechanism for local inflammation, particularly chronic ones like rheumatoid arthritis and a multiple sclerosis. Moreover, we have recently shown that hyper activation of the IL-6 amplifier via regional neural activation establishes a gateway for immune cells including autoreactive T cells to pass the blood-brain barrier at dorsal vessels in 5th lumbar cord. Here we review how the IL-6 amplifier is activated by neural activation and the physiological relevance of the gateway to the central nervous system. Accumulating evidences continues to suggest that the IL-6 amplifier offers a potential molecular mechanism for the relationship between neural activation and the development of inflammatory diseases, which could establish a new interdisciplinary field that fuses neurology and immunology.

  5. A European Project on Vacuum Tube Amplifiers for THz Amplification

    DEFF Research Database (Denmark)

    Paoloni, Claudio; Di Carlo, Aldo; Brunetti, Francesca;

    2012-01-01

    The OPTHER (Optically Driven THz amplifier) project supported by the European Commission within the Seventh Framework Program (FP7) represents the first joint European attempt to realize vacuum electron devices in THz range. The target of the project was to design and realize the first 1 THz vacuum...

  6. Transistor biased amplifier minimizes diode discriminator threshold attenuation

    Science.gov (United States)

    Larsen, R. N.

    1967-01-01

    Transistor biased amplifier has a biased diode discriminator driven by a high impedance /several megohms/ current source, rather than a voltage source with several hundred ohms output impedance. This high impedance input arrangement makes the incremental impedance of the threshold diode negligible relative to the input impedance.

  7. The Gain Dependence of the Power Transient in Raman Amplifier

    Institute of Scientific and Technical Information of China (English)

    Zheng Lei; Zhang Jiahong; Chen Zhangyuan; Wu Deming; Xu Anshi

    2003-01-01

    It is observed that the amplitude of the power transient overshoot depends on the gain of the amplifier when the input signal powers are the same. The other system parameters, such as the input pump power and fiber length, have no effects on it.

  8. Optimizing bandwidth and dynamic range of lumped Josephson parametric amplifiers

    Science.gov (United States)

    Eddins, A.; Vijay, R.; Macklin, C.; Minev, Z.; Siddiqi, I.

    2013-03-01

    Superconducting parametric amplifiers have revolutionized the field of quantum measurement by providing high gain, ultra-low noise amplification. They have been used successfully for high-fidelity qubit state measurements, probing nano-mechanical resonators, quantum feedback, and for microwave quantum optics experiments. Though several designs exist, a simple and robust architecture is the Lumped Josephson Parametric Amplifier (LJPA). This device consists of a capacitively shunted SQUID directly coupled to a transmission line to form a low quality factor (Q) nonlinear resonator. We discuss amplifiers which can be tuned over the full 4-8 GHz band with 20-25 dB of gain and 10 - 50 MHz of signal bandwidth. However, similar to other parametric amplifiers employing a resonant circuit, the LJPA suffers from low dynamic range and has a -1 dB gain compression point of order -130 dBm. We explore new designs comprised of an array of SQUIDs to improve the dynamic range. We will present the results of numerical simulations and preliminary experiments. We will also briefly discuss improvements obtained from different biasing methods and packaging. This research was supported by the Army Research Office under a QCT grant.

  9. Amplified spontaneous emission pulses for high-power supercontinuum generation

    Directory of Open Access Journals (Sweden)

    Huan Huan Liu

    2016-03-01

    Full Text Available The authors demonstrate an incoherent light source based on a reflective semiconductor optical amplifier as pump for high-power supercontinuum generation for the first time. The obtained power level is about 160 mW and 20 dB spectral bandwidth is around 170 nm.

  10. Theory of the singly quasidegenerate Josephson junction parametric amplifier

    DEFF Research Database (Denmark)

    Sørensen, O.H.; Dueholm, B.; Mygind, Jesper;

    1980-01-01

    A comprehensive account of the theory of the singly quasidegenerate Josephson junction parametric amplifier is given. In this mode the signal and idler frequencies are both approximately equal to half the pump frequency, and hence the signal and idler channels have a common termination. It is shown...

  11. Sexing birds using random amplified polymorphic DNA (RAPD) markers

    NARCIS (Netherlands)

    Lessells, C.M.; Mateman, A.C.

    1998-01-01

    We used random amplified polymorphic DNA (RAPD) markers to sex birds from small tissue (usually blood) samples. Arbitrarily chosen 10-mer PCR primers were screened with DNA from known-sex individuals for the production of a bright female-specific band. Suitable primers were found for seven bird spec

  12. Field Effect Transistor /FET/ circuit for variable gin amplifiers

    Science.gov (United States)

    Spaid, G. H.

    1969-01-01

    Amplifier circuit using two FETs combines improved input and output impedances with relatively large signal handling capability and an immunity from adverse effects of automatic gain control. Circuit has sources and drains in parallel plus a resistive divider for signal and bias to either of the gate terminals.

  13. Multi Carrier Modulator for Switch-Mode Audio Power Amplifiers

    DEFF Research Database (Denmark)

    Knott, Arnold; Pfaffinger, Gerhard; Andersen, Michael Andreas E.

    2008-01-01

    -mode audio power amplifiers while keeping the performance measures to excellent levels is therefore of high general interest. A modulator utilizing multiple carrier signals to generate a two level pulse train will be shown in this paper. The performance of the modulator will be compared in simulation...

  14. Population structure of Salmonella investigated by amplified fragment length polymorphism

    DEFF Research Database (Denmark)

    Torpdahl, M.; Ahrens, Peter

    2004-01-01

    Aims: This study was undertaken to investigate the usefulness of amplified fragment length polymorphism (AFLP) in determining the population structure of Salmonella. Methods and Results: A total of 89 strains were subjected to AFLP analysis using the enzymes BglII and BspDI, a combination...

  15. 2R Regeneration in Concatenated Semiconductor Optical Amplifiers and Electroabsorbers

    DEFF Research Database (Denmark)

    Christiansen, Lotte Jin; Xu, Lin; Yvind, Kresten;

    2004-01-01

    We present a novel 2R regenerator with a large level separation and steep step a sharp, adjustable threshold based on concatenated semiconductor optical amplifiers and electroabsorbers. We demonstrate demonstrate improvements in both extinction-ratio and BER sensitivity atfor a 10 Gb/s NRZ signal....

  16. Current-Driven Switch-Mode Audio Power Amplifiers

    DEFF Research Database (Denmark)

    Knott, Arnold; Buhl, Niels Christian; Andersen, Michael A. E.

    2012-01-01

    The conversion of electrical energy into sound waves by electromechanical transducers is proportional to the current through the coil of the transducer. However virtually all audio power amplifiers provide a controlled voltage through the interface to the transducer. This paper is presenting a sw...

  17. A fully integrated 16 channel digitally trimmed pulse shaping amplifier

    International Nuclear Information System (INIS)

    A fully integrated CMOS pulse shaping amplifier has been developed at LBL. All frequency dependent networks are included on the chip. Provision is made for tuning to compensate for process variations. The overall architecture and details of the circuitry are discussed. Test results are presented

  18. K-Band Traveling-Wave Tube Amplifier

    Science.gov (United States)

    Force, Dale A.; Simons, Rainee N.; Peterson, Todd T.; Spitsen, Paul C.

    2010-01-01

    A new space-qualified, high-power, high-efficiency, K-band traveling-wave tube amplifier (TWTA) will provide high-rate, high-capacity, direct-to-Earth communications for science data and video gathered by the Lunar Reconnaissance Orbiter (LRO) during its mission. Several technological advances were responsible for the successful demonstration of the K-band TWTA.

  19. Noise Shaping Filter Compensating PWM Distortion for Fully Digital Amplifier

    Science.gov (United States)

    Yoneya, Akihiko

    The full-digital audio amplifiers have several merits such as a high power enabling a small size of the amplifier and digital implementation of the signal processing which allows desired precision of the processing except for the final stage switching amplifiers. Unfortunately, the pulse width modulation (PWM) causes signal distortions because of the non-linearity of the modulation from the viewpoint of the transient response. This paper proposes a compensation method of the PWM distortion with feedback approach. In the noise-shaping filter of the delta-sigma modulator to calculate the pulse codes for the PWM, the distortion caused by the PWM is evaluated and fed it back to compensate the distortion. Eventually the filter is implemented as a state-variable filter with non-linear feedback from the quantizer. The calculation of the filter elements is also described. By using proposed filters, PWM signals with small distortions and small floor noise can be obtained to realize high-fidelity audio amplifiers.

  20. Quantum dot amplifiers with high output power and low noise

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper

    2003-01-01

    Quantum dot semiconductor optical amplifiers have been theoretically investigated and are predicted to achieve high saturated output power, large gain, and low noise figure. We discuss the device dynamics and, in particular, show that the presence of highly inverted barrier states does not limit...

  1. Can El Nino Amplify the Solar Forcing of Climate?

    Science.gov (United States)

    Ruzmaikin, A.

    1999-01-01

    ENSO (El Nino and the Southern Oscillation) is considered as a stochastic driver that excites the atmospheric anomaly states, such as Pacific North American pattern. This can make the 11 year solar activity forcing feasible to climate through stochastic resonance -- a phenomenon that amplifies a weak input to a nonlinear bistable system by the assistance of noise.

  2. Development and energization of IOT based RF amplifier

    International Nuclear Information System (INIS)

    A 704 MHz IOT based CW RF amplifier has been developed in VECC. It can also be used with proper tuning to power cavity modules operating at 650 MHz in high energy high intensity proton linear accelerator proposed to be built for ADSS/SNS programme in India and Project-X at Fermilab, USA. This IOT based amplifier provides up to 60 kW continuous wave RF power at 700 MHz. It required various power supplies, LCW cooling and forced air cooling for its operation. The auxiliary power supplies like Grid, Filament and Ion-pump, are floated and mounted on an isolated frame, i.e., HV deck. The mains inputs are electrically isolated by means of isolation transformer. Also, a Programmable Logic Controller (PLC) based interlocks along with high voltage collector power supply has been designed and developed for the safe operation of the RF amplifier. This paper discusses about various developments and energization of the IOT based RF amplifier with high power dummy load. (author)

  3. Characterization of a high-power tapered semiconductor amplifier system

    CERN Document Server

    Voigt, D; Spreeuw, R J C; Van Linden van den Heuvell, H B

    2001-01-01

    We have characterized a semiconductor amplifier laser system which provides up to 200mW output after a single-mode optical fiber at 780nm wavelength. The system is based on a tapered semiconductor gain element, which amplifies the output of a narrow-linewidth diode laser. Gain and saturation are discussed as a function of operating temperature and injection current. The spectral properties of the amplifier are investigated with a grating spectrometer. Amplified spontaneous emission (ASE) causes a spectral background with a width of 4nm FWHM. The ASE background was suppressed to below our detection limit by a proper choice of operating current and temperature, and by sending the light through a single-mode optical fiber. The final ASE spectral density was less than 0.1nW/MHz, i.e. less than 0.2 % of the optical power. Related to an optical transition linewidth of $\\Gamma/2\\pi=6$ MHz for rubidium, this gives a background suppression of better than -82dB. An indication of the beam quality is provided by the fibe...

  4. Single-mode operation of a coiled multimode fiber amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Jeffrey P. Koplow; Dahv A. V. Kliner; Lew Goldberg

    2000-01-19

    The authors report a new approach to obtain single-transverse-mode operation of a multimode fiber amplifier, in which the gain fiber is coiled to induce significant bend loss for all but the lowest-order mode. They have demonstrated this method by constructing a coiled amplifier using Yb-doped, double-clad fiber with a core diameter of 25 {micro}m and NA of {minus}0.1 (V {approx} 7.4). When operated as an ASE source, the output beam had an M{sup 2} value of 1.09 {+-} 0.09; when seeded at 1,064 nm, the slope efficiency was similar to that of an uncoiled amplifier. This technique does not require exotic fiber designs or increase system complexity and is inexpensive to implement. It will allow scaling of pulsed fiber lasers and amplifiers to significantly higher pulse energies and peak powers and cw fiber sources to higher average powers while maintaining excellent beam quality.

  5. Electron motion in an elliptically polarized free electron laser amplifier

    International Nuclear Information System (INIS)

    The equation of motion for an electron in a free electron laser amplifier are written in hamiltonian form, and exactly solved for the circular polarized case. Successively, an approximate solution for a general polarization (elliptical or linear) and weak laser field is obtained by a relativistic generalization of the two timing technique. Finally, the theoretical perturbative results are confirmed by comparison with numerical solutions

  6. Minimizing Crosstalk in Self Oscillating Switch Mode Audio Power Amplifiers

    DEFF Research Database (Denmark)

    Knott, Arnold; Ploug, Rasmus Overgaard

    2012-01-01

    The varying switching frequencies of self oscillating switch mode audio amplifiers have been known to cause interchannel intermodulation disturbances in multi channel configurations. This crosstalk phenomenon has a negative impact on the audio performance. The goal of this paper is to present...... by the implementation presented. Future work could include further refinement of the implementation of the concepts, electromagnetic interference investigations or PCB design....

  7. Nonlinear carrier dynamics in a quantum dash optical amplifier

    DEFF Research Database (Denmark)

    Hansen, Per Lunnemann; Ek, Sara; Yvind, Kresten;

    2012-01-01

    Results of experimental pump-probe spectroscopy of a quantum dash optical amplifier biased at transparency are presented. Using strong pump pulses we observe a competition between free carrier absorption and two-photon induced stimulated emission that can have drastic effects on the transmission...

  8. Amplifiers Module Prototype for the Johnson Noise Thermometry System

    Energy Technology Data Exchange (ETDEWEB)

    Britton Jr, Charles L [ORNL; Bull, Nora D [ORNL; Roberts, Michael [ORNL

    2013-06-01

    This document is intended to summarize the development and testing of the amplifier module portion of the Johnson Noise Thermometry (JNT) system developed at ORNL. The proposed system has been presented in an earlier report [1]. A more extensive project background including the project rationale is available in the initial project report [2].

  9. Ultrafast gain and index dynamics in quantum dot amplifiers

    DEFF Research Database (Denmark)

    Borri, Paola; Langbein, Wolfgang; Mørk, Jesper;

    1999-01-01

    The ultrafast dynamics of gain and refractive index in an InAs/GaAs quantum dot amplifier are investigated at room temperature. The gain is observed to recover with a 90 fs time constant, ruling out problems of slow carrier capture into the dots, and making this component promising for high...

  10. Semiconductor optical amplifier length effects on gain dynamics

    International Nuclear Information System (INIS)

    We study theoretically semiconductor optical amplifier (SOA) length effects on gain dynamics when a short saturating pulse (pump) is either co- or counter-propagative with the probe. More specifically, we focus our attention on SOA recovery dynamics and gain overshoot. Analysis is also given when the input probe power and input pump energy are increased for different SOA lengths

  11. Asymmetric gain-saturated spectrum in fiber optical parametric amplifiers

    DEFF Research Database (Denmark)

    Lali-Dastjerdi, Zohreh; Rottwitt, Karsten; Galili, Michael;

    2012-01-01

    We demonstrate experimentally and numerically an unexpected spectral asymmetry in the saturated-gain spectrum of single-pump fiber optical parametric amplifiers. The interaction between higher-order four-wave mixing products and dispersive waves radiated as an effect of third-order dispersion...

  12. Optimum design of Nd-doped fiber optical amplifiers

    DEFF Research Database (Denmark)

    Rasmussen, Thomas; Bjarklev, Anders Overgaard; Lumholt, Ole;

    1992-01-01

    The waveguide parameters for a Nd-doped fluoride (Nd:ZBLANP) fiber amplifier have been optimized for small-signal and booster operation using an accurate numerical model. The optimum cutoff wavelength is shown to be 800 nm and the numerical aperture should be made as large as possible. Around 80...

  13. Monolithic integrated circuit charge amplifier and comparator for MAMA readout

    Science.gov (United States)

    Cole, Edward H.; Smeins, Larry G.

    1991-01-01

    Prototype ICs for the Solar Heliospheric Observatory's Multi-Anode Microchannel Array (MAMA) have been developed; these ICs' charge-amplifier and comparator components were then tested with a view to pulse response and noise performance. All model performance predictions have been exceeded. Electrostatic discharge protection has been included on all IC connections; device operation over temperature has been consistent with model predictions.

  14. Prototype Small Footprint Amplifier for Piezoelectric Deformable Mirrors

    Science.gov (United States)

    Caputa, Kris; Herriot, Glen; Niebergal, Joel; Zielinski, Adam

    2011-09-01

    AO subsystems of the ELT observatories will incorporate deformable mirrors with an order of magnitude larger number of piezoelectric actuators than the AO systems currently deployed. Simply scaling up the drive electronics that are presently available commercially would substantially drive up the AO cost, pose unacceptably high demands for the supply power and heat dissipation, and occupy large physical volume. We have set out to prototype a high voltage amplifier that is compact enough to allow packaging 100 amplifier channels on a single 6U Eurocard with the goal to have a DM drive channel density of 1200 per 6U VME crate. Individual amplifier circuits should be driven by a multichannel A/D converter, consume no more than 0.5W from the +/-400V power supply, be slew rate limited in hardware, and be short-circuit protected. The component cost should be an order of magnitude less than the integrated circuit high voltage amplifiers currently on the market. We started out with modeling candidate circuits in SPICE, then built physical prototypes using inexpensive off the shelf components. In this paper we present experimental results of exposing several prototype circuits to both normal operating conditions and foreseeable fault conditions. The performance is evaluated against the AO requirements for the output range and bandwidth and the DM actuator safety requirements.

  15. Effects of gamma radiation on commercial operational amplifiers

    International Nuclear Information System (INIS)

    The operational amplifiers are widely used in nuclear instrumentation. Their applications span the signal conditioning circuits, analog instrumentation, amplifiers, converters, oscillators and others. If an operational amplifier is used to work in a radiation environment, the device suffers degradation in its performance leading to the bad work in the systems. Some of these devices are designed as rad-hard components and therefore the effects of radiation damage are minimized, however its main disadvantage is the high cost and difficult to find in the market. As an alternative one can use the conventional electronic components available in the market and named COTS (Commercially Available Off-The-Shelf) but they must be tested under a radiation environment. In this work the effect of the radiation damage is studied in two typical operational amplifiers. Some electric parameters of these devices were measured for different gamma radiation doses and they were working at different input signal frequencies. A 60Co isotopic radiation source was used and the results show that there is a certain degradation of the device depending on the radiation absorbed dose. (author)

  16. Electrical versus optical pumping of quantum dot amplifiers

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Bischoff, Svend; Mørk, Jesper

    2001-01-01

    The influence of the pumping mechanism for the dynamical properties of quantum dot amplifiers is investigated for 10, 40 and 160 GHz signals. A fast response is predicted in the case of optical pumping in the wetting layer (WL). The combination of fast relaxation and capture times and the presence...

  17. HTS dc SQUID based rf amplifier: development concept

    DEFF Research Database (Denmark)

    Prokopenko, G.V.; Shitov, S.V.; Borisenko, I.V.;

    2002-01-01

    We present a concept of a rf amplifier based on a directly coupled dc SQUID with bicrystal junctions, which have high saturation power and can be used with SIS mixers or possibly for satellite and cellular phone communications. A novel input resonant circuit is proposed using single layer of HTS...

  18. Temporal and transverse coherence of self-amplified spontaneous emission

    International Nuclear Information System (INIS)

    The authors review the coherence properties of the self-amplified spontaneous emission (SASE). Temporally, SASE is similar to the spontaneous undulator radiation except that the spectral bandwidth is about ten times narrower compared with typical undulator radiation. The situation is quite different in the transverse dimension, where SASE is fully coherent

  19. Systematic Design of EMI-Resilient Negative-Feedback Amplifiers

    NARCIS (Netherlands)

    Van der Horst, M.J.

    2012-01-01

    The information transfer capacity of negative-feedback amplifiers, and electronic circuits in general, is limited by three fundamental limitations being noise, bandwidth, and signal power. Electromagnetic Interference (EMI) is not a fundamental limitation, but it also hampers the information transf

  20. Recent advances in semiconductor optical amplifiers and their applications

    DEFF Research Database (Denmark)

    Stubkjær, Kristian; Mikkelsen, Benny; Djurhuus, Torsten;

    1992-01-01

    The authors review recent advances in SOAs (semiconductor optical amplifiers) and some of their applications. SOAs are under rapid development to achieve polarization independent gain, low facet reflectivities, good coupling to optical fibers, and high saturation power. The package SOA can be made...

  1. Multilevel inverter based class D audio amplifier for capacitive transducers

    DEFF Research Database (Denmark)

    Nielsen, Dennis; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    The reduced semiconductor voltage stress makes the multilevel inverters especially interesting, when driving capacitive transducers for audio applications. A ± 300 V flying capacitor class D audio amplifier driving a 100 nF load in the midrange region of 0.1-3.5 kHz with Total Harmonic Distortion...

  2. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  3. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  4. Nuclear magnetic resonance experiments with dc SQUID amplifiers

    International Nuclear Information System (INIS)

    The development and fabrication of dc SQUIDs (Superconducting QUantum Interference Devices) with Nb/Al2O3/Nb Josephson junctions is described. A theory of the dc SQUID as a radio-frequency amplifier is presented, with an optimization strategy that accounts for the loading and noise contributions of the postamplifier and maximizes the signal-to-noise ratio of the total system. The high sensitivity of the dc SQUID is extended to high field NMR. A dc SQUID is used as a tuned radio-frequency amplifier to detect pulsed nuclear magnetic resonance at 32 MHz from a metal film in a 3.5 Tesla static field. A total system noise temperature of 11 K has been achieved, at a bath temperature of 4.2 K. The minimum number of nuclear Bohr magnetons observable from a free precession signal after a single pulse is about 2 x 1017 in a bandwidth of 25 kHz. In a separate experiment, a dc SQUID is used as a rf amplifier in a NQR experiment to observe a new resonance response mechanism. The net electric polarization of a NaClO3 crystal due to the precessing electric quadrupole moments of the Cl nuclei is detected at 30 MHz. The sensitivity of NMR and NQR spectrometers using dc SQUID amplifiers is compared to the sensitivity of spectrometers using conventional rf amplifiers. A SQUID-based spectrometer has a voltage sensitivity which is comparable to the best achieved by a FET-based spectrometer, at these temperatures and operating frequencies

  5. Ways to suppress click and pop for class D amplifiers

    Institute of Scientific and Technical Information of China (English)

    Wang Haishi; Zhang Bo; Sun Jiang

    2012-01-01

    Undesirable audio click and pop may be generated in a speaker or headphone.Compared to linear (class A/B/AB) amplifiers,class D amplifiers that comprise of an input stage and a modulation stage are more prone to producing click and pop.This article analyzes sources that generate click and pop in class D amplifiers,and corresponding ways to suppress them.For a class D amplifier with a single-ended input,click and pop is likely to be due to two factors.One is from a voltage difference (VDIF) between the voltage of an input capacitance (VCIN)and a reference voltage (VREF) of the input stage,and the other one is from the non-linear switching during the setting up of the bias and feedback voltages/currents (BFVC) of the modulation stage.In this article,a fast charging loop is introduced into the input stage to charge VCIN to roughly near VREF.Then a correction loop further charges or discharges VCIN,substantially equalizing it with VREF.Dummy switches are introduced into the modulation stage to provide switching signals for setting up BFVC,and the power switches are disabled until the BFVC are set up successfully.A two channel single-ended class D amplifier with the above features is fabricated with 0.5 μm Bi-CMOS process.Road test and fast Fourier transform analysis indicate that there is no noticeable click and pop.

  6. An ac bridge readout for bolometric detectors

    Science.gov (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  7. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  8. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  9. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  10. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  11. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  12. Criterion of transverse coherence of self-amplified spontaneous emission in high gain free electron laser amplifiers

    International Nuclear Information System (INIS)

    In a high gain free electron laser amplifier based on Self-Amplified Spontaneous Emission (SASE) the spontaneous radiation generated by an electron beam near the undulator entrance is amplified many orders of magnitude along the undulator. The transverse coherence properties of the amplified radiation depends on both the amplification process and the coherence of the seed radiation (the undulator radiation generated in the first gain length or so). The evolution of the transverse coherence in the amplification process is studied based on the solution of the coupled Maxwell-Vlasov equations including higher order transverse modes. The coherence of the seed radiation is determined by the number of coherent modes in the phase space area of the undulator radiation. We discuss the criterion of transverse coherence and identify governing parameters over a broad range of parameters. In particular we re-examine the well known emittance criterion for the undulator radiation, which states that full transverse coherence is guaranteed if the rms emittance is smaller than the wavelength divided by 4π. It is found that this criterion is modified for SASE because of the different optimization conditions required for the electron beam. Our analysis is a generalization of the previous study by Yu and Krinsky for the case of vanishing emittance with parallel electron beam. Understanding the transverse coherence of SASE is important for the X-ray free electron laser projects now under consideration at SLAC and DESY

  13. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  14. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . With the proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion system...

  15. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  16. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  17. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  18. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  19. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%), for kidneys 20 ± 1% (19...

  20. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.