WorldWideScience

Sample records for ac amplifiers

  1. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  2. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Science.gov (United States)

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  3. Operational amplifiers

    CERN Document Server

    Dostal, Jiri

    1993-01-01

    This book provides the reader with the practical knowledge necessary to select and use operational amplifier devices. It presents an extensive treatment of applications and a practically oriented, unified theory of operational circuits.Provides the reader with practical knowledge necessary to select and use operational amplifier devices. Presents an extensive treatment of applications and a practically oriented, unified theory of operational circuits

  4. Switching-mode Audio Power Amplifiers with Direct Energy Conversion

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2005-01-01

    This paper presents a new class of switching-mode audio power amplifiers, which are capable of direct energy conversion from the AC mains to the audio output. They represent an ultimate integration of a switching-mode power supply and a Class D audio power amplifier, where the intermediate DC bus...

  5. Cross-differential amplifier

    Science.gov (United States)

    Hajimiri, Seyed-Ali (Inventor); Kee, Scott D. (Inventor); Aoki, Ichiro (Inventor)

    2013-01-01

    A cross-differential amplifier is provided. The cross-differential amplifier includes an inductor connected to a direct current power source at a first terminal. A first and second switch, such as transistors, are connected to the inductor at a second terminal. A first and second amplifier are connected at their supply terminals to the first and second switch. The first and second switches are operated to commutate the inductor between the amplifiers so as to provide an amplified signal while limiting the ripple voltage on the inductor and thus limiting the maximum voltage imposed across the amplifiers and switches.

  6. Portable musical instrument amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Christian, David E. (Danbury, CT)

    1990-07-24

    The present invention relates to a musical instrument amplifier which is particularly useful for electric guitars. The amplifier has a rigid body for housing both the electronic system for amplifying and processing signals from the guitar and the system's power supply. An input plug connected to and projecting from the body is electrically coupled to the signal amplifying and processing system. When the plug is inserted into an output jack for an electric guitar, the body is rigidly carried by the guitar, and the guitar is operatively connected to the electrical amplifying and signal processing system without use of a loose interconnection cable. The amplifier is provided with an output jack, into which headphones are plugged to receive amplified signals from the guitar. By eliminating the conventional interconnection cable, the amplifier of the present invention can be used by musicians with increased flexibility and greater freedom of movement.

  7. Wireless Josephson amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Narla, A.; Sliwa, K. M.; Hatridge, M.; Shankar, S.; Frunzio, L.; Schoelkopf, R. J.; Devoret, M. H. [Department of Applied Physics, Yale University, New Haven, Connecticut 06511 (United States)

    2014-06-09

    Josephson junction parametric amplifiers are playing a crucial role in the readout chain in superconducting quantum information experiments. However, their integration with current 3D cavity implementations poses the problem of transitioning between waveguide, coax cables, and planar circuits. Moreover, Josephson amplifiers require auxiliary microwave components, like directional couplers and/or hybrids, that are sources of spurious losses and impedance mismatches that limit measurement efficiency and amplifier tunability. We have developed a wireless architecture for these parametric amplifiers that eliminates superfluous microwave components and interconnects. This greatly simplifies their assembly and integration into experiments. We present an experimental realization of such a device operating in the 9–11 GHz band with about 100 MHz of amplitude gain-bandwidth product, on par with devices mounted in conventional sample holders. The simpler impedance environment presented to the amplifier also results in increased amplifier tunability.

  8. Oscillators and operational amplifiers

    DEFF Research Database (Denmark)

    Lindberg, Erik

    2005-01-01

    A generalized approach to the design of oscillators using operational amplifiers as active elements is presented. A piecewise-linear model of the amplifier is used so that it make sense to investigate the eigenvalues of the Jacobian of the differential equations. The characteristic equation...... of the general circuit is derived. The dynamic nonlinear transfer characteristic of the amplifier is investigated. Examples of negative resistance oscillators are discussed....

  9. Single conversion stage amplifier - SICAM

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.

    2005-12-15

    This Ph.D. thesis presents a thorough analysis of the so called SICAM - SIngle Converter stage AMplifier approach to building direct energy conversion audio power amplifiers. The mainstream approach for building isolated audio power amplifiers today consists of isolated DC power supply and Class D amplifier, which essentially represents a two stage solution, where each of the components can be viewed as separate and independent part. The proposed SICAM solution strives for direct energy conversion from the mains to the audio output, by dedicating the operation of the components one to another and integrating their functions, so that the final audio power amplifier represents a single-stage topology with higher efficiency, lower volume, less board space, lower component count and subsequently lower cost. The SICAM approach is both applicable to non-isolated and isolated audio power amplifiers, but the problems encountered in these two cases are different. Non-isolated SICAM solutions are intended for both AC mains-connected and battery-powered devices. In non-isolated mains-connected SICAMs the main idea is to simplify the power supply or even provide integrated power factor correction (PFC) functions, while still maintaining low component stress and good audio performance by generally decreasing the input voltage level to the Class D audio power amplifier. On the other hand, non-isolated battery-powered SICAMs have to cope with the ever changing battery voltage and provide output voltage levels which are both lower and higher than the battery voltage, while still being simple and single-stage energy conversion solutions. In isolated SICAMs the isolation transformer adjusts the voltage level on the secondary side to the desired level, so the main challenges here are decreasing the size of the magnetic core and reducing the number and size of bulky reactive components as much as possible. The main focus of this thesis is directed towards the isolated SICAMs and

  10. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  11. Optoisolators simplify amplifier design

    Science.gov (United States)

    Ting, Joseph Wee

    2007-09-01

    Simplicity and low parts count are key virtues to this high voltage amplifier. Optoisolators replace complex high voltage transistor biasing schemes. This amplifier employs only 2 optoisolators, 16 high voltage mosfets transistors, 2 low voltage ones, 6 linear IC's and a score of passive components. Yet it can amplify opamp signals to 5 kV peak-to-peak from DC to sine waves up to 20 kHz. Resistor feedback guarantees the fidelity of the signal. It can source and sink 10 mA of output current. This amplifier was conceived to power ion traps for biological whole cell mass measurements. It is a versatile tool for a variety of applications.

  12. RF Power Amplifier Analysis

    Directory of Open Access Journals (Sweden)

    M. Lokay

    1993-04-01

    Full Text Available The special program is presented for the demonstration of RF power transistor amplifiers for the purposes of the high-school education in courses of radio transmitters. The program is written in Turbo Pascal 6. 0 and enables to study the waveforms in selected points of the amplifier and to draw the trajectories of the working point in a plot of output transistor characteristics.

  13. Charge-sensitive amplifier

    Directory of Open Access Journals (Sweden)

    Startsev V. I.

    2008-02-01

    Full Text Available The authors consider design and circuit design techniques of reduction of the influence of the pyroelectric effect on operation of the charge sensitive amplifiers. The presented experimental results confirm the validity of the measures taken to reduce the impact of pyroelectric currents. Pyroelectric currents are caused by the influence of the temperature gradient on the piezoelectric sensor and on the output voltage of charge sensitive amplifiers.

  14. Electrospun amplified fiber optics.

    Science.gov (United States)

    Morello, Giovanni; Camposeo, Andrea; Moffa, Maria; Pisignano, Dario

    2015-03-11

    All-optical signal processing is the focus of much research aiming to obtain effective alternatives to existing data transmission platforms. Amplification of light in fiber optics, such as in Erbium-doped fiber amplifiers, is especially important for efficient signal transmission. However, the complex fabrication methods involving high-temperature processes performed in a highly pure environment slow the fabrication process and make amplified components expensive with respect to an ideal, high-throughput, room temperature production. Here, we report on near-infrared polymer fiber amplifiers working over a band of ∼20 nm. The fibers are cheap, spun with a process entirely carried out at room temperature, and shown to have amplified spontaneous emission with good gain coefficients and low levels of optical losses (a few cm(-1)). The amplification process is favored by high fiber quality and low self-absorption. The found performance metrics appear to be suitable for short-distance operations, and the large variety of commercially available doping dyes might allow for effective multiwavelength operations by electrospun amplified fiber optics.

  15. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  16. Fourier plane image amplifier

    Science.gov (United States)

    Hackel, L.A.; Hermann, M.R.; Dane, C.B.; Tiszauer, D.H.

    1995-12-12

    A solid state laser is frequency tripled to 0.3 {micro}m. A small portion of the laser is split off and generates a Stokes seed in a low power oscillator. The low power output passes through a mask with the appropriate hole pattern. Meanwhile, the bulk of the laser output is focused into a larger stimulated Brillouin scattering (SBS) amplifier. The low power beam is directed through the same cell in the opposite direction. The majority of the amplification takes place at the focus which is the fourier transform plane of the mask image. The small holes occupy large area at the focus and thus are preferentially amplified. The amplified output is now imaged onto the multichip module where the holes are drilled. Because of the fourier plane amplifier, only about 1/10th the power of a competitive system is needed. This concept allows less expensive masks to be used in the process and requires much less laser power. 1 fig.

  17. Fourier plane image amplifier

    Science.gov (United States)

    Hackel, Lloyd A.; Hermann, Mark R.; Dane, C. Brent; Tiszauer, Detlev H.

    1995-01-01

    A solid state laser is frequency tripled to 0.3 .mu.m. A small portion of the laser is split off and generates a Stokes seed in a low power oscillator. The low power output passes through a mask with the appropriate hole pattern. Meanwhile, the bulk of the laser output is focused into a larger stimulated Brillouin scattering (SBS) amplifier. The low power beam is directed through the same cell in the opposite direction. The majority of the amplification takes place at the focus which is the fourier transform plane of the mask image. The small holes occupy large area at the focus and thus are preferentially amplified. The amplified output is now imaged onto the multichip module where the holes are drilled. Because of the fourier plane amplifier, only .about.1/10th the power of a competitive system is needed. This concept allows less expensive masks to be used in the process and requires much less laser power.

  18. STABILIZED TRANSISTOR AMPLIFIER

    Science.gov (United States)

    Noe, J.B.

    1963-05-01

    A temperature stabilized transistor amplifier having a pair of transistors coupled in cascade relation that are capable of providing amplification through a temperature range of - 100 un. Concent 85% F to 400 un. Concent 85% F described. The stabilization of the amplifier is attained by coupling a feedback signal taken from the emitter of second transistor at a junction between two serially arranged biasing resistances in the circuit of the emitter of the second transistor to the base of the first transistor. Thus, a change in the emitter current of the second transistor is automatically corrected by the feedback adjustment of the base-emitter potential of the first transistor and by a corresponding change in the base-emitter potential of the second transistor. (AEC)

  19. Polarization effect in parametric amplifier

    Institute of Scientific and Technical Information of China (English)

    Junhe Zhou; Jianping Chen; Xinwan Li; Guiling Wu; Yiping Wang

    2005-01-01

    @@ Polarization effect in parametric amplifiers is studied. Coupled equations are derived from the basic propagation equations and numerical solutions are given for both one-wavelength-pump and two-wavelengthpump systems. Several parametric amplifiers driven by pumps at one wavelength and two wavelengths are analyzed and the polarization independent parametric amplifier is proposed.

  20. Radio Frequency Solid State Amplifiers

    CERN Document Server

    Jacob, J

    2015-01-01

    Solid state amplifiers are being increasingly used instead of electronic vacuum tubes to feed accelerating cavities with radio frequency power in the 100 kW range. Power is obtained from the combination of hundreds of transistor amplifier modules. This paper summarizes a one hour lecture on solid state amplifiers for accelerator applications.

  1. Multiple pass laser amplifier system

    Science.gov (United States)

    Brueckner, Keith A.; Jorna, Siebe; Moncur, N. Kent

    1977-01-01

    A laser amplification method for increasing the energy extraction efficiency from laser amplifiers while reducing the energy flux that passes through a flux limited system which includes apparatus for decomposing a linearly polarized light beam into multiple components, passing the components through an amplifier in delayed time sequence and recombining the amplified components into an in phase linearly polarized beam.

  2. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  3. Simplified design of IC amplifiers

    CERN Document Server

    Lenk, John

    1996-01-01

    Simplified Design of IC Amplifiers has something for everyone involved in electronics. No matter what skill level, this book shows how to design and experiment with IC amplifiers. For experimenters, students, and serious hobbyists, this book provides sufficient information to design and build IC amplifier circuits from 'scratch'. For working engineers who design amplifier circuits or select IC amplifiers, the book provides a variety of circuit configurations to make designing easier.Provides basics for all phases of practical design.Covers the most popular forms for amplif

  4. Electronic amplifiers for automatic compensators

    CERN Document Server

    Polonnikov, D Ye

    1965-01-01

    Electronic Amplifiers for Automatic Compensators presents the design and operation of electronic amplifiers for use in automatic control and measuring systems. This book is composed of eight chapters that consider the problems of constructing input and output circuits of amplifiers, suppression of interference and ensuring high sensitivity.This work begins with a survey of the operating principles of electronic amplifiers in automatic compensator systems. The succeeding chapters deal with circuit selection and the calculation and determination of the principal characteristics of amplifiers, as

  5. Building valve amplifiers

    CERN Document Server

    Jones, Morgan

    2013-01-01

    Building Valve Amplifiers is a unique hands-on guide for anyone working with tube audio equipment--as an electronics hobbyist, audiophile or audio engineer. This 2nd Edition builds on the success of the first with technology and technique revisions throughout and, significantly, a major new self-build project, worked through step-by-step, which puts into practice the principles and techniques introduced throughout the book. Particular attention has been paid to answering questions commonly asked by newcomers to the world of the valve, whether audio enthusiasts tackling their first build or

  6. REGENERATIVE TRANSISTOR AMPLIFIER

    Science.gov (United States)

    Kabell, L.J.

    1958-11-25

    Electrical circults for use in computers and the like are described. particularly a regenerative bistable transistor amplifler which is iurned on by a clock signal when an information signal permits and is turned off by the clock signal. The amplifier porforms the above function with reduced power requirements for the clock signal and circuit operation. The power requirements are reduced in one way by employing transformer coupling which increases the collector circuit efficiency by eliminating the loss of power in the collector load resistor.

  7. Wideband amplifier design

    CERN Document Server

    Hollister, Allen L

    2007-01-01

    In this book, the theory needed to understand wideband amplifier design using the simplest models possible will be developed. This theory will be used to develop algebraic equations that describe particular circuits used in high frequency design so that the reader develops a ""gut level"" understanding of the process and circuit. SPICE and Genesys simulations will be performed to show the accuracy of the algebraic models. By looking at differences between the algebraic equations and the simulations, new algebraic models will be developed that include parameters originally left out of the model

  8. A Correction Formula for the ST Segment Measurements for the AC-coupled Electrocardiograms

    DEFF Research Database (Denmark)

    Schmid, Ramun; Isaksen, Jonas; Leber, Remo;

    2016-01-01

    The ST segment of an electrocardiogram (ECG) is very important for the correct diagnosis of an acute myocardial infarction. Most clinical ECGs are recorded using an AC-coupled ECG amplifier. It is well known, that first-order high-pass filters used for the AC coupling can affect the ST segment...

  9. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  10. Nanoscale electromechanical parametric amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Aleman, Benjamin Jose; Zettl, Alexander

    2016-09-20

    This disclosure provides systems, methods, and apparatus related to a parametric amplifier. In one aspect, a device includes an electron source electrode, a counter electrode, and a pumping electrode. The electron source electrode may include a conductive base and a flexible conductor. The flexible conductor may have a first end and a second end, with the second end of the flexible conductor being coupled to the conductive base. A cross-sectional dimension of the flexible conductor may be less than about 100 nanometers. The counter electrode may be disposed proximate the first end of the flexible conductor and spaced a first distance from the first end of the flexible conductor. The pumping electrode may be disposed proximate a length of the flexible conductor and spaced a second distance from the flexible conductor.

  11. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  12. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    Energy Technology Data Exchange (ETDEWEB)

    Guerra, A.S.; Laitano, R.F.; Petrocchi, A. [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

    1997-09-01

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  13. Modeling of semiconductor optical amplifiers

    DEFF Research Database (Denmark)

    Mørk, Jesper; Bischoff, Svend; Berg, Tommy Winther

    We discuss the modelling of semiconductor optical amplifiers with emphasis on their high-speed properties. Applications in linear amplification as well as ultrafast optical signal processing are reviewed. Finally, the possible role of quantum-dot based optical amplifiers is discussed.......We discuss the modelling of semiconductor optical amplifiers with emphasis on their high-speed properties. Applications in linear amplification as well as ultrafast optical signal processing are reviewed. Finally, the possible role of quantum-dot based optical amplifiers is discussed....

  14. Capacities of quantum amplifier channels

    Science.gov (United States)

    Qi, Haoyu; Wilde, Mark M.

    2017-01-01

    Quantum amplifier channels are at the core of several physical processes. Not only do they model the optical process of spontaneous parametric down-conversion, but the transformation corresponding to an amplifier channel also describes the physics of the dynamical Casimir effect in superconducting circuits, the Unruh effect, and Hawking radiation. Here we study the communication capabilities of quantum amplifier channels. Invoking a recently established minimum output-entropy theorem for single-mode phase-insensitive Gaussian channels, we determine capacities of quantum-limited amplifier channels in three different scenarios. First, we establish the capacities of quantum-limited amplifier channels for one of the most general communication tasks, characterized by the trade-off between classical communication, quantum communication, and entanglement generation or consumption. Second, we establish capacities of quantum-limited amplifier channels for the trade-off between public classical communication, private classical communication, and secret key generation. Third, we determine the capacity region for a broadcast channel induced by the quantum-limited amplifier channel, and we also show that a fully quantum strategy outperforms those achieved by classical coherent-detection strategies. In all three scenarios, we find that the capacities significantly outperform communication rates achieved with a naive time-sharing strategy.

  15. Small signal microwave amplifier design

    CERN Document Server

    Grosch, Theodore

    2000-01-01

    This book explains techniques and examples for designing stable amplifiers for high-frequency applications in which the signal is small and the amplifier circuit is linear. An in-depth discussion of linear network theory provides the foundation needed to develop actual designs. Examples throughout the book will show you how to apply the knowledge gained in each chapter leading to the complex design of low noise amplifiers. Many exercises at the end of each chapter will help students to practice their skills. The solutions to these design problems are available in an accompanying solutions book

  16. International Standardization Activities for Optical Amplifiers

    Institute of Scientific and Technical Information of China (English)

    Haruo Okamura

    2003-01-01

    International standardization activities for Optical Amplifiers at IECTC86 and ITU-T SG15 are reviewed. Current discussions include Optical Amplifier safety guideline, Reliability standard, Rest methods of Noise and PMD, Definitions of Raman amplifier parameters and OA classification.

  17. Characterization of SLUG microwave amplifiers

    Science.gov (United States)

    Hoi, I.-C.; Zhu, S.; Thorbeck, T.; McDermott, R.; Mutus, J.; Jeffrey, E.; Barends, R.; Chen, Y.; Roushan, P.; Fowler, A.; Sank, D.; White, T.; Campbell, B.; Chen, Z.; Chiaro, B.; Dunsworth, A.; Kelly, J.; Megrant, A.; Neill, C.; O'Malley, P. J. J.; Quintana, C.; Vainsencher, A.; Wenner, J.; Martinis, J. M.

    2015-03-01

    With the rapid growth of superconducting circuits quantum technology, a near quantum-limited amplifier at GHz frequency is needed to enable high fidelity measurements. We describe such an amplifier, the SQUID based, superconducting low inductance undulatory galvanometer (SLUG) amplifier. We measure the full scattering matrix of the SLUG. In particular, we measure both forward and reverse gain, as well as reflection. We see 15dB forward gain with added noise from one quanta to several quanta. The -1 dB compression point is around -95 dBm, about two orders of magnitude higher than that of typical Josephson parametric amplifiers. With these properties, SLUG is well suited for the high fidelity, simultaneous multiplexed readout of superconducting qubits.

  18. PID Controller with Operational Amplifier

    Directory of Open Access Journals (Sweden)

    Cristian Paul Chioncel

    2009-01-01

    Full Text Available The paper presents a PID controller made with LM741 operational amplifier that implement the PID controllers laws and allow for a widerange of applications of in the field of automatic control of technicalprocesses and systems.

  19. New Packaging for Amplifier Slabs

    Energy Technology Data Exchange (ETDEWEB)

    Riley, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thorsness, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Suratwala, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Steele, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rogowski, G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-03-18

    The following memo provides a discussion and detailed procedure for a new finished amplifier slab shipping and storage container. The new package is designed to maintain an environment of <5% RH to minimize weathering.

  20. TARC: Carlo Rubbia's Energy Amplifier

    CERN Multimedia

    Laurent Guiraud

    1997-01-01

    Transmutation by Adiabatic Resonance Crossing (TARC) is Carlo Rubbia's energy amplifier. This CERN experiment demonstrated that long-lived fission fragments, such as 99-TC, can be efficiently destroyed.

  1. Operational amplifiers theory and design

    CERN Document Server

    Huijsing, Johan

    2017-01-01

    This proven textbook guides readers to a thorough understanding of the theory and design of operational amplifiers (OpAmps). The core of the book presents systematically the design of operational amplifiers, classifying them into a periodic system of nine main overall configurations, ranging from one gain stage up to four or more stages. This division enables circuit designers to recognize quickly, understand, and choose optimal configurations. Characterization of operational amplifiers is given by macro models and error matrices, together with measurement techniques for their parameters. Definitions are given for four types of operational amplifiers depending on the grounding of their input and output ports. Many famous designs are evaluated in depth, using a carefully structured approach enhanced by numerous figures. In order to reinforce the concepts introduced and facilitate self-evaluation of design skills, the author includes problems with detailed solutions, as well as simulation exercises. Provides te...

  2. A KIND OF NEW AMPLIFIER

    Institute of Scientific and Technical Information of China (English)

    YIN XUN-HE; FENG RU-PENG; REN YONG

    2000-01-01

    Chaotic characteristics in the iteration of logistic map (one-dimensional discrete dynamic system) are simulatedand analyzed. The circuit implementation of a kind of chaotic amplifier model is based on the chaotic characteristicsthat chaos is sensitively dependent on its initial conditions, and the circuit simulation result is given using simulationprogram with integrated circuit emphasis for personal computer (PSPICE), and is compared with linear amplifier.Advantages and disadvantages of such a model are indicated.

  3. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  4. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  5. Bio-potential amplifier for potential gradient measurements

    Energy Technology Data Exchange (ETDEWEB)

    Bermudez, Andrea N; Spinelli, Enrique M; Muravchik, Carlos H [LEICI, Departamento de Electrotecnia, Universidad Nacional de La Plata, CC 91 (1900) La Plata (Argentina)

    2007-11-15

    This work proposes a bio-potential amplifier suitable for measurements from an electric potential gradient sensor, in electro-encephalography (EEG). The sensor is an array made by three electrodes placed on the vertices of an equilateral triangle of reduced size. Measuring the gradient requires small separation between electrodes hence, very low amplitude signals, of a few {mu}V, are obtained. Therefore, it is important to minimize amplifier noise and electromagnetic interference effects. In the proposed scheme, the first stage is a passive and balanced ac-coupling network adapted to the gradient configuration and the second stage is an 80 dB gain amplifier. The implementation requires a reduced number of components. Therefore, the circuit can be mounted just above the electrodes (active electrodes). The proposed amplifier was built and tested. It achieves a CMRR of 125dB at 50 Hz and an equivalent input noise voltage of 0,3{mu}V RMS in the band 0.5 - 500 Hz. Finally, some preliminary results in the detection of occipital alpha rhythm are presented.

  6. EMI-resilient amplifier circuits

    CERN Document Server

    van der Horst, Marcel J; Linnenbank, André C

    2014-01-01

    This book enables circuit designers to reduce the errors introduced by the fundamental limitations and electromagnetic interference (EMI) in negative-feedback amplifiers.  The authors describe a systematic design approach for application specific negative-feedback amplifiers, with specified signal-to-error ratio (SER).  This approach enables designers to calculate noise, bandwidth, EMI, and the required bias parameters of the transistors used in  application specific amplifiers in order to meet the SER requirements.   ·         Describes design methods that incorporate electromagnetic interference (EMI) in the design of application specific negative-feedback amplifiers; ·         Provides designers with a structured methodology to avoid the use of trial and error in meeting signal-to-error ratio (SER) requirements; ·         Equips designers to increase EMI immunity of the amplifier itself, thus avoiding filtering at the input, reducing the number of components and avoiding detr...

  7. Computer Aided Design and Analysis of a 2-4 GHz Broadband Balanced Microstrip Amplifier

    Directory of Open Access Journals (Sweden)

    S. H. Ibrahim

    2012-07-01

    Full Text Available In this paper, a computer-aided design and analysis of a 2-4 GHz broadband balanced microstrip amplifier using a full computer simulation program developed by the author and others is presented. A short and efficient CAD procedure for broadband amplifier design is introduced. The first step is to design an initial narrow-band high gain microstrip amplifier at 3-GHz central frequency. The second step is to optimize the initial lengths and widths of the input and output microstrip-matching circuits to get the broadband amplifier over the range 2-4 GHz. The analysis of both narrow and broadband amplifiers is investigated. In addition, with the design and analysis of a low-pass microstrip filter, the paper introduces the design and analysis of a Lange coupler. The final AC schematic diagram of the designed amplifier with the lengths and widths of microstrip lines is presented.Key Words: Computer-Aided Design and Analysis, Microstrip Amplifier, Microwave Amplifier.

  8. A CMOS current-mode operational amplifier

    DEFF Research Database (Denmark)

    Kaulberg, Thomas

    1993-01-01

    current-mode feedback amplifier or a constant bandwidth in a transimpedance feedback amplifier. The amplifier is found to have a gain-bandwidth product of 3 MHz, an offset current of 0.8 μA (signal range ±700 μA), and a (theoretically) unlimited slew rate. The amplifier is realized in a standard CMOS 2...

  9. Capacitively-coupled chopper amplifiers

    CERN Document Server

    Fan, Qinwen; Huijsing, Johan H

    2017-01-01

    This book describes the concept and design of the capacitively-coupled chopper technique, which can be used in precision analog amplifiers. Readers will learn to design power-efficient amplifiers employing this technique, which can be powered by regular low supply voltage such as 2V and possibly having a +\\-100V input common-mode voltage input. The authors provide both basic design concepts and detailed design examples, which cover the area of both operational and instrumentation amplifiers for multiple applications, particularly in power management and biomedical circuit designs. Discusses basic working principles and details of implementation for proven designs; Includes a diverse set of applications, along with measurement results to demonstrate the effectiveness of the technique; Explains advantages and drawbacks of the technique, given particular circumstances.

  10. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  11. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  12. Thermal recovery of NIF amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Sutton, S.; Marshall, C.; Petty, C.; Smith, L.; van Wonterghem, B.; Mills, S.

    1997-02-01

    The issue of thermal recovery of the NIF amplifiers has taken on increased emphasis as program goals move toward increasing the shot rate to once every four hours. This paper addresses the technical issues associated with achieving thermal recovery in the NIF amplifiers. We identify two temperature related thermal recovery quantities: (1) the difference between the average slab temperature and the temperature of other surfaces in the amplifier cavity, and (2) the temperature difference in the slab over the aperture. The first quantity relates to optical disturbances in the gas column in the system, while the second quantity is associated with optical aberrations in the laser media itself. Calculations and experiments are used to quantify recovery criteria, and develop cooling approaches. The cooling approaches discussed are (1) active cooling of the flashlamps with ambient gas and chilled gas, and (2) active cooling of the slab edge cladding. Calculations indicate that the NIF baseline cooling approach of 20 cfm per lamp ambient temperature gas flow in both the central and side flashlamp cassettes is capable of meeting thermal recovery requirements for an 8 hour shot period, while to achieve a 4 hour shot period requires use of chilled gas and edge cladding cooling. In addition, the effect of changing the amplifier cavity and beamtube fill gas from nitrogen to helium is addressed, showing that a factor of 8 reduction in the sensitivity to thermal disturbances is possible. 6 refs., 9 figs., 1 tab.

  13. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  14. CMOS Current-mode Operational Amplifier

    DEFF Research Database (Denmark)

    Kaulberg, Thomas

    1992-01-01

    current-mode feedback amplifier or a constant bandwidth in a transimpedance feedback amplifier. The amplifier is found to have a gain bandwidth product of 8 MHz, an offset current of 0.8 ¿A (signal-range ±700¿A) and a (theoretically) unlimited slew-rate. The amplifier is realized in a standard CMOS 2......A fully differential-input differential-output current-mode operational amplifier (COA) is described. The amplifier utilizes three second generation current-conveyors (CCII) as the basic building blocks. It can be configured to provide either a constant gain-bandwidth product in a fully balanced...

  15. Linearisation of RF Power Amplifiers

    DEFF Research Database (Denmark)

    Nielsen, Per Asbeck

    2001-01-01

    This thesis deals with linearisation techniques of RF power amplifiers (PA), PA design techniques and integration of the necessary building blocks in a CMOS technology. The opening chapters introduces the theory of transmitter architectures, RF-signal representation and the principles of digital...... modulation. Furthermore different types of power amplifiers, models and measures of non-linearities are presented. A chapter is also devoted to different types of linearisation systems. The work carried out and described in this thesis can be divided into a more theoretical and system oriented treatment...... the polar loop architecture and it’s suitability to modern digital transmitters is discussed. A proposal of an architecture that is suitable for digital transmitters, which means that it has an interface to the digital back-end, defined by low-pass signals in polar form, is presented. Simulation guidelines...

  16. 338-GHz Semiconductor Amplifier Module

    Science.gov (United States)

    Samoska, Lorene A.; Gaier, Todd C.; Soria, Mary M.; Fung, King Man; Rasisic, Vesna; Deal, William; Leong, Kevin; Mei, Xiao Bing; Yoshida, Wayne; Liu, Po-Hsin; Uyeda, Jansen; Lai, Richard

    2010-01-01

    Research findings were reported from an investigation of new gallium nitride (GaN) monolithic millimeter-wave integrated circuit (MMIC) power amplifiers (PAs) targeting the highest output power and the highest efficiency for class-A operation in W-band (75-110 GHz). W-band PAs are a major component of many frequency multiplied submillimeter-wave LO signal sources. For spectrometer arrays, substantial W-band power is required due to the passive lossy frequency multipliers.

  17. Small and lightweight power amplifiers

    Science.gov (United States)

    Shams, Qamar A.; Barnes, Kevin N.; Fox, Robert L.; Moses, Robert W.; Bryant, Robert G.; Robinson, Paul C.; Shirvani, Mir

    2002-07-01

    The control of u wanted structural vibration is implicit in most of NASA's programs. Currently several approaches to control vibrations in large, lightweight, deployable structures and twin tail aircraft at high angles of attack are being evaluated. The Air Force has been examining a vertical tail buffet load alleviation system that can be integrated onboard an F/A-18 and flown. Previous wind tunnel and full-scale ground tests using distributed actuators have shown that the concept works; however, there is insufficient rom available onboard an F/A-18 to store current state-of- the-art system components such as amplifiers, DC-to-DC converter and a computer for performing vibration suppression. Sensor processing, power electronics, DC-to-DC converters, and control electronics that may be collocated with distributed actuators, are particularly desirable. Such electronic system would obviate the need for complex, centralized, control processing and power distribution components that will eliminate the weight associated with lengthy wiring and cabling networks. Several small and lightweight power amplifiers ranging from 300V pp to 650V pp have been designed using off the shelf components for different applications. In this paper, the design and testing of these amplifiers will be presented under various electrical loads.

  18. SPS RF System Amplifier plant

    CERN Multimedia

    1977-01-01

    The picture shows a 2 MW, 200 MHz amplifier plant with feeder lines. The main RF-system of the SPS comprises four cavities: two of 20 m length and two of 16.5 m length. They are all installed in one long straight section (LSS 3). These cavities are of the travelling-wave type operating at a centre frequency of 200.2 MHz. They are wideband, filling time about 700 ns and untuned. The power amplifiers, using tetrodes are installed in a surface building 200 m from the cavities. Initially only two cavities were installed, a third cavity was installed in 1978 and a forth one in 1979. The number of power amplifiers was also increased: to the first 2 MW plant a second 2 MW plant was added and by end 1979 there were 8 500 kW units combined in pairs to feed each of the 4 cavities with up to about 1 MW RF power, resulting in a total accelerating voltage of about 8 MV. See also 7412016X, 7412017X, 7411048X.

  19. High power regenerative laser amplifier

    Science.gov (United States)

    Miller, J.L.; Hackel, L.A.; Dane, C.B.; Zapata, L.E.

    1994-02-08

    A regenerative amplifier design capable of operating at high energy per pulse, for instance, from 20-100 Joules, at moderate repetition rates, for instance from 5-20 Hertz is provided. The laser amplifier comprises a gain medium and source of pump energy coupled with the gain medium; a Pockels cell, which rotates an incident beam in response to application of a control signal; an optical relay system defining a first relay plane near the gain medium and a second relay plane near the rotator; and a plurality of reflectors configured to define an optical path through the gain medium, optical relay and Pockels cell, such that each transit of the optical path includes at least one pass through the gain medium and only one pass through the Pockels cell. An input coupler, and an output coupler are provided, implemented by a single polarizer. A control circuit coupled to the Pockels cell generates the control signal in timed relationship with the input pulse so that the input pulse is captured by the input coupler and proceeds through at least one transit of the optical path, and then the control signal is applied to cause rotation of the pulse to a polarization reflected by the polarizer, after which the captured pulse passes through the gain medium at least once more and is reflected out of the optical path by the polarizer before passing through the rotator again to provide an amplified pulse. 7 figures.

  20. Analog circuit design designing high performance amplifiers

    CERN Document Server

    Feucht, Dennis

    2010-01-01

    The third volume Designing High Performance Amplifiers applies the concepts from the first two volumes. It is an advanced treatment of amplifier design/analysis emphasizing both wideband and precision amplification.

  1. Higher order mode optical fiber Raman amplifiers

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Friis, Søren Michael Mørk; Usuga Castaneda, Mario A.;

    2016-01-01

    We review higher order mode Raman amplifiers and discuss recent theoretical as well as experimental results including system demonstrations.......We review higher order mode Raman amplifiers and discuss recent theoretical as well as experimental results including system demonstrations....

  2. Design and implementation of a wireless (Bluetooth) four channel bio-instrumentation amplifier and digital data acquisition device with user-selectable gain, frequency, and driven reference.

    Science.gov (United States)

    Cosmanescu, Alin; Miller, Benjamin; Magno, Terence; Ahmed, Assad; Kremenic, Ian

    2006-01-01

    A portable, multi-purpose Bio-instrumentation Amplifier and Data AcQuisition device (BADAQ) capable of measuring and transmitting EMG and EKG signals wirelessly via Bluetooth is designed and implemented. Common topologies for instrumentation amplifiers and filters are used and realized with commercially available, low-voltage, high precision operational amplifiers. An 8-bit PIC microcontroller performs 10-bit analog-to-digital conversion of the amplified and filtered signals and controls a Bluetooth transceiver capable of wirelessly transmitting the data to any Bluetooth enabled device. Electrical isolation between patient/subject, circuitry, and ancillary equipment is achieved by optocoupling components. The design focuses on simplicity, portability, and affordability.

  3. Challenges in higher order mode Raman amplifiers

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Nielsen, Kristian; Friis, Søren Michael Mørk;

    2015-01-01

    A higher order Raman amplifier model that take random mode coupling into account ispresented. Mode dependent gain and signal power fluctuations at the output of the higher order modeRaman amplifier are discussed......A higher order Raman amplifier model that take random mode coupling into account ispresented. Mode dependent gain and signal power fluctuations at the output of the higher order modeRaman amplifier are discussed...

  4. Improved charge amplifier using hybrid hysteresis compensation

    Science.gov (United States)

    Amin-Shahidi, Darya; Trumper, David L.

    2013-08-01

    We present a novel charge amplifier, with a robust feedback circuit and a method for compensating piezoelectric actuator's hysteresis at low frequencies. The amplifier uses a modified feedback circuit which improves robustness to the addition of series load impedance such as in cabling. We also describe a hybrid hysteresis compensation method for enabling the charge amplifier to reduce hysteresis at low frequencies. Experimental results demonstrate the utility of the new amplifier design.

  5. European Research on THz Vacuum Amplifiers

    DEFF Research Database (Denmark)

    Brunetti, F.; Cojocarua, C.-S.; de Rossi, A.

    2010-01-01

    The OPTHER (OPtically Driven TeraHertz AmplifiERs) project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within this project is a consolidation of efforts at the international level from the main players of the Eu...... of the European research, academy and industry in vacuum electronics. This paper describes the status of the project and progress towards the THz amplifier realization....

  6. low pump power photonic crystal fibre amplifiers

    DEFF Research Database (Denmark)

    Hougaard, Kristian G.; Broeng, Jes; Bjarklev, Anders Overgaard

    2003-01-01

    Designs of low pump power optical amplifiers, based on photonic crystal fibres are presented. The potential of these fibre amplifiers is investigated, and it is demonstrated that such amplifiers may deliver gains of more than 15 dB at 1550 nm with less than 1 mW of optical pump power....

  7. A High-performance Small Signal Amplifier

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    According to questions in the design of high quality small signal amplifier, this paper gave a new-type high performance small signal amplifier. The paper selected the operational amplifier of ICL Company and designed a new-type circuit with simple, low cost and excellent performance.

  8. Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

    Directory of Open Access Journals (Sweden)

    Pijar Riza Anugerah

    2015-10-01

    Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A(NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

  9. DOUBLE-BOOST DC-AC CONVERTER WITH SLIDING-MODE CONTROL FOR PORTABLE AUDIO

    DEFF Research Database (Denmark)

    Bolten Maizonave, Gert; Andersen, Michael Andreas E.; Kjærgaard, Claus;

    2009-01-01

    The double-boost topology is studied for operation as a dc-ac converter and single stage audio amplifier. A sliding-mode controller is designed in order to achieve fast enough response for the whole audio frequency range. Symmetric, asymmetric and interleaved operation modes are analyzed....

  10. Log amplifier with pole-zero compensation

    Science.gov (United States)

    Brookshier, William

    1987-01-01

    A logarithmic amplifier circuit provides pole-zero compensation for improved stability and response time over 6-8 decades of input signal frequency. The amplifier circuit includes a first operational amplifier with a first feedback loop which includes a second, inverting operational amplifier in a second feedback loop. The compensated output signal is provided by the second operational amplifier with the log elements, i.e., resistors, and the compensating capacitors in each of the feedback loops having equal values so that each break point or pole is offset by a compensating break point or zero.

  11. Semiconductor quantum-dot lasers and amplifiers

    DEFF Research Database (Denmark)

    Hvam, Jørn Märcher; Borri, Paola; Ledentsov, N. N.

    2002-01-01

    -power surface emitting VCSELs. We investigated the ultrafast dynamics of quantum-dot semiconductor optical amplifiers. The dephasing time at room temperature of the ground-state transition in semiconductor quantum dots is around 250 fs in an unbiased amplifier, decreasing to below 50 fs when the amplifier...... is biased to positive net gain. We have further measured gain recovery times in quantum dot amplifiers that are significantly lower than in bulk and quantum-well semiconductor optical amplifiers. This is promising for future demonstration of quantum dot devices with high modulation bandwidth...

  12. An Implantable CMOS Amplifier for Nerve Signals

    DEFF Research Database (Denmark)

    Nielsen, Jannik Hammel; Lehmann, Torsten

    2003-01-01

    In this paper, a low noise high gain CMOS amplifier for minute nerve signals is presented. The amplifier is constructed in a fully differential topology to maximize noise rejection. By using a mixture of weak- and strong inversion transistors, optimal noise suppression in the amplifier is achieved....... A continuous-time current-steering offset-compensation technique is utilized in order to minimize the noise contribution and to minimize dynamic impact on the amplifier input nodes. The method for signal recovery from noisy nerve signals is presented. A prototype amplifier is realized in a standard digital 0...

  13. A low cost amplifier and acquisition system for cortical-electroncephalography in non-human applications.

    Science.gov (United States)

    Viggiano, A; Coppola, G

    2014-04-01

    A simple circuit is described to make an AC-amplifier and an analog-to-digital converter in a single, compact solution, for use in basic research, but not on humans. The circuit sends data to and is powered from a common USB port of modern computers; using proper firmware and driver the communication with the device is an emulated RS232 serial port.

  14. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  15. High temperature charge amplifier for geothermal applications

    Science.gov (United States)

    Lindblom, Scott C.; Maldonado, Frank J.; Henfling, Joseph A.

    2015-12-08

    An amplifier circuit in a multi-chip module includes a charge to voltage converter circuit, a voltage amplifier a low pass filter and a voltage to current converter. The charge to voltage converter receives a signal representing an electrical charge and generates a voltage signal proportional to the input signal. The voltage amplifier receives the voltage signal from the charge to voltage converter, then amplifies the voltage signal by the gain factor to output an amplified voltage signal. The lowpass filter passes low frequency components of the amplified voltage signal and attenuates frequency components greater than a cutoff frequency. The voltage to current converter receives the output signal of the lowpass filter and converts the output signal to a current output signal; wherein an amplifier circuit output is selectable between the output signal of the lowpass filter and the current output signal.

  16. Audio power amplifier design handbook

    CERN Document Server

    Self, Douglas

    2013-01-01

    This book is essential for audio power amplifier designers and engineers for one simple reason...it enables you as a professional to develop reliable, high-performance circuits. The Author Douglas Self covers the major issues of distortion and linearity, power supplies, overload, DC-protection and reactive loading. He also tackles unusual forms of compensation and distortion produced by capacitors and fuses. This completely updated fifth edition includes four NEW chapters including one on The XD Principle, invented by the author, and used by Cambridge Audio. Cro

  17. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  18. High power RF solid state power amplifier system

    Science.gov (United States)

    Sims, III, William Herbert (Inventor); Chavers, Donald Gregory (Inventor); Richeson, James J. (Inventor)

    2011-01-01

    A high power, high frequency, solid state power amplifier system includes a plurality of input multiple port splitters for receiving a high-frequency input and for dividing the input into a plurality of outputs and a plurality of solid state amplifier units. Each amplifier unit includes a plurality of amplifiers, and each amplifier is individually connected to one of the outputs of multiport splitters and produces a corresponding amplified output. A plurality of multiport combiners combine the amplified outputs of the amplifiers of each of the amplifier units to a combined output. Automatic level control protection circuitry protects the amplifiers and maintains a substantial constant amplifier power output.

  19. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  20. Quantum Noise in Amplifiers and Hawking/Dumb-Hole Radiation as Amplifier Noise

    CERN Document Server

    Unruh, W G

    2011-01-01

    The quantum noise in a linear amplifier is shown to be thermal noise. The theory of linear amplifiers is applied first to the simplest, single or double oscillator model of an amplifier, and then to linear model of an amplifier with continuous fields and input and outputs. Finally it is shown that the thermal noise emitted by black holes first demonstrated by Hawking, and of dumb holes (sonic and other analogs to black holes), arises from the same analysis as for linear amplifiers. The amplifier noise of black holes acting as amplifiers on the quantum fields living in the spacetime surrounding the black hole is the radiation discovered by Hawking. For any amplifier, that quantum noise is completely characterized by the attributes of the system regarded as a classical amplifier, and arises out of those classical amplification factors and the commutation relations of quantum mechanics.

  1. YANG-MILLS FIELD AMPLIFIER

    Directory of Open Access Journals (Sweden)

    Trunev A. P.

    2015-09-01

    Full Text Available The article presents a project of the Yang-Mills amplifier. Amplifier model is a multilayer spherical shell with increasing density towards the center. In the center of the amplifier is the core of high-density material. It is shown that in such a system, the amplitude of the Yang-Mills waves rises from the periphery to the center of several orders of magnitude. The role of the Yang-Mills field in the processes occurring in the nuclei of galaxies, stars and planets is discussed. The data modeling to strengthen the Yang-Mills field in the bowels of the planet, with an atomic explosion, and in some special devices such as the voltaic pile. To describe the mechanism of amplification chromodynamics field used as accurate results in Yang-Mills theory and numerical models developed based on an average and the exact equations as well. Among the exact solutions of the special role played by the centralsymmetric metric describing the contribution of the Yang-Mills field in the speed of recession of galaxies. Among the approximate numerical models can be noted the eight-scalar model we have developed for the simulation of non-linear color oscillations and chaos in the Yang-Mills theory. Earlier models were investigated spatio-temporal oscillations of the YangMills theory in the case of three and eight colors. The results of numerical simulation show that the nonlinear interaction does not lead to a spatial mixing of colors as it might be in the case of turbulent diffusion. Depending on the system parameters there is a suppression of the amplitude of the oscillations the first three by five colors or vice versa. The kinetic energy fluctuations or shared equally between the color components, or dominated by the kinetic energy of repressed groups of colors. In the present study, we found that amplification chromodynamic field leads to a sharp increase in the amplitude of the suppressed color, which can lead to an increase in entropy, excitation of nuclear

  2. Locoregional MYCN-amplified neuroblastoma.

    Science.gov (United States)

    Morales La Madrid, Andres; Volchenboum, Samuel; Gastier-Foster, Julie M; Pyatt, Robert; Liu, Don; Pytel, Peter; Lavarino, Cinzia; Rodriguez, Eva; Cohn, Susan L

    2012-10-01

    MYCN-amplification is strongly associated with other high-risk prognostic factors and poor outcome in neuroblastoma. Infrequently, amplification of MYCN has been identified in localized tumors with favorable biologic features. Outcome for these children is difficult to predict and optimal treatment strategies remain unclear. We report a 5-month-old who presented with an MYCN-amplified INSS stage 3, pelvic neuroblastoma. The tumor had favorable histology, hyperdiploidy, and lacked 1p36 and 11q23 aberrations. Although the patient met the criteria for high-risk neuroblastoma, because of the discordant prognostic markers we elected to treat her according to an intermediate-risk protocol. She remains event-free more than 18 months.

  3. Transverse pumped laser amplifier architecture

    Science.gov (United States)

    Bayramian, Andrew James; Manes, Kenneth; Deri, Robert; Erlandson, Al; Caird, John; Spaeth, Mary

    2013-07-09

    An optical gain architecture includes a pump source and a pump aperture. The architecture also includes a gain region including a gain element operable to amplify light at a laser wavelength. The gain region is characterized by a first side intersecting an optical path, a second side opposing the first side, a third side adjacent the first and second sides, and a fourth side opposing the third side. The architecture further includes a dichroic section disposed between the pump aperture and the first side of the gain region. The dichroic section is characterized by low reflectance at a pump wavelength and high reflectance at the laser wavelength. The architecture additionally includes a first cladding section proximate to the third side of the gain region and a second cladding section proximate to the fourth side of the gain region.

  4. Reflection amplifiers in self-regulated learning

    NARCIS (Netherlands)

    Verpoorten, Dominique

    2012-01-01

    Verpoorten, D. (2012). Reflection amplifiers in self-regulated learning. Doctoral thesis. November, 9, 2012, Heerlen, The Netherlands: Open Universiteit (CELSTEC). Datawyse / Universitaire Pers Maastricht.

  5. Enhanced Gain in Photonic Crystal Amplifiers

    DEFF Research Database (Denmark)

    Ek, Sara; Semenova, Elizaveta; Hansen, Per Lunnemann;

    2012-01-01

    study of a 1 QW photonic crystal amplifier. Net gain is achieved which enables laser oscillation in photonic crystal micro cavities. The ability to freely tailor the dispersion in a semiconductor optical amplifier makes it possible to raise the optical gain considerably over a certain bandwidth......We experimentally demonstrate enhanced gain in the slow-light regime of quantum well photonic crystal amplifiers. A strong gain enhancement is observed with the increase of the group refractive index, due to light slow-down. The slow light enhancement is shown in a amplified spontaneous emission...

  6. Design of an 1800nm Raman amplifier

    DEFF Research Database (Denmark)

    Svane, Ask Sebastian; Rottwitt, Karsten

    2013-01-01

    We present the experimental results for a Raman amplifier that operates at 1810 nm and is pumped by a Raman fiber laser at 1680 nm. Both the pump laser and the Raman amplifier is polarization maintaining. A challenge when scaling Raman amplifiers to longer wavelengths is the increase...... performance of the amplifier is also investigated for both configurations. Our results show an on/off gain exceeding 20 dB at 1810 nm for which the obtained effective noise figure is below 3 dB....

  7. Dynamics of Soliton Cascades in Fiber Amplifiers

    CERN Document Server

    Arteaga-Sierra, F R; Agrawal, Govind P

    2016-01-01

    We study numerically the formation of cascading solitons when femtosecond optical pulses are launched into a fiber amplifier with less energy than required to form a soliton of equal duration. As the pulse is amplified, cascaded fundamental solitons are created at different distances, without soliton fission, as each fundamental soliton moves outside the gain bandwidth through the Raman-induced spectral shifts. As a result, each input pulse creates multiple, temporally separated, ultrashort pulses of different wavelengths at the amplifier output. The number of pulses depends not only on the total gain of the amplifier but also on the width of input pulses.

  8. A low-noise transimpedance amplifier for the detection of "Violin-Mode" resonances in advanced Laser Interferometer Gravitational wave Observatory suspensions

    Science.gov (United States)

    Lockerbie, N. A.; Tokmakov, K. V.

    2014-11-01

    This paper describes the design and performance of an extremely low-noise differential transimpedance amplifier, which takes its two inputs from separate photodiodes. The amplifier was planned to serve as the front-end electronics for a highly sensitive shadow-displacement sensing system, aimed at detecting very low-level "Violin-Mode" (VM) oscillations in 0.4 mm diameter by 600 mm long fused-silica suspension fibres. Four such highly tensioned fibres support the 40 kg test-masses/mirrors of the Advanced Laser Interferometer Gravitational wave Observatory interferometers. This novel design of amplifier incorporates features which prevent "noise-gain peaking" arising from large area photodiode (and cable) capacitances, and which also usefully separate the DC and AC photocurrents coming from the photodiodes. In consequence, the differential amplifier was able to generate straightforwardly two DC outputs, one per photodiode, as well as a single high-gain output for monitoring the VM oscillations—this output being derived from the difference of the photodiodes' two, naturally anti-phase, AC photocurrents. Following a displacement calibration, the amplifier's final VM signal output was found to have an AC displacement responsivity at 500 Hz of (9.43 ± 1.20) MV(rms) m-1(rms), and, therefore, a shot-noise limited sensitivity to such AC shadow- (i.e., fibre-) displacements of (69 ± 13) picometres/√Hz at this frequency, over a measuring span of ±0.1 mm.

  9. A low-noise transimpedance amplifier for the detection of "Violin-Mode" resonances in Advanced Laser Interferometer Gravitational wave Observatory suspensions.

    Science.gov (United States)

    Lockerbie, N A; Tokmakov, K V

    2014-11-01

    This paper describes the design and performance of an extremely low-noise differential transimpedance amplifier, which takes its two inputs from separate photodiodes. The amplifier was planned to serve as the front-end electronics for a highly sensitive shadow-displacement sensing system, aimed at detecting very low-level "Violin-Mode" (VM) oscillations in 0.4 mm diameter by 600 mm long fused-silica suspension fibres. Four such highly tensioned fibres support the 40 kg test-masses/mirrors of the Advanced Laser Interferometer Gravitational wave Observatory interferometers. This novel design of amplifier incorporates features which prevent "noise-gain peaking" arising from large area photodiode (and cable) capacitances, and which also usefully separate the DC and AC photocurrents coming from the photodiodes. In consequence, the differential amplifier was able to generate straightforwardly two DC outputs, one per photodiode, as well as a single high-gain output for monitoring the VM oscillations-this output being derived from the difference of the photodiodes' two, naturally anti-phase, AC photocurrents. Following a displacement calibration, the amplifier's final VM signal output was found to have an AC displacement responsivity at 500 Hz of (9.43 ± 1.20) MV(rms) m(-1)(rms), and, therefore, a shot-noise limited sensitivity to such AC shadow- (i.e., fibre-) displacements of (69 ± 13) picometres/√Hz at this frequency, over a measuring span of ±0.1 mm.

  10. Distributed feedback laser amplifiers combining the functions of amplifiers and channel filters

    DEFF Research Database (Denmark)

    Wang, Z.; Durhuus, T.; Mikkelsen, Benny;

    1994-01-01

    A dynamic model for distributed feedback amplifiers, including the mode coupled equations and the carrier rate equation, is established. The presented mode coupled equations have taken into account the interaction between fast changing optical signal and the waveguide with corrugations. By showin...... the possibility of amplifying 100 ps pulses without pulse broadening, we anticipate that a distributed feedback amplifier can be used as a combined amplifier and channel filter in high bit rate transmission systems....

  11. Amplified spontaneous emission and its restraint in a terawatt Ti:sapphire amplifier

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Amplified spontaneous emission (ASE) and its restraint in a femtosecond Ti: sapphire chirped_pulse amplifier were investigated. The noises arising from ASE were effectively filtered out in the spatial, temporal and spectral domain. Pulses as short as 38 fs were amplified to peak power of 1.4 TW. The power ratio between the amplified femtosecond pulse and the ASE was higher than 106:1.

  12. Self-pulsation in Raman fiber amplifiers

    DEFF Research Database (Denmark)

    Pedersen, Martin Erland Vestergaard; Ott, Johan Raunkjær; Rottwitt, Karsten

    2009-01-01

    Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated.......Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated....

  13. BROADBAND TRAVELLING WAVE SEMICONDUCTOR OPTICAL AMPLIFIER

    DEFF Research Database (Denmark)

    2010-01-01

    Broadband travelling wave semiconductor optical amplifier (100, 200, 300, 400, 800) for amplification of light, wherein the amplifier (100, 200, 300, 400, 800) comprises a waveguide region (101, 201, 301, 401, 801) for providing confinement of the light in transverse directions and adapted...

  14. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  15. Ultrafast disk lasers and amplifiers

    Science.gov (United States)

    Sutter, Dirk H.; Kleinbauer, Jochen; Bauer, Dominik; Wolf, Martin; Tan, Chuong; Gebs, Raphael; Budnicki, Aleksander; Wagenblast, Philipp; Weiler, Sascha

    2012-03-01

    Disk lasers with multi-kW continuous wave (CW) output power are widely used in manufacturing, primarily for cutting and welding applications, notably in the automotive industry. The ytterbium disk technology combines high power (average and/or peak power), excellent beam quality, high efficiency, and high reliability with low investment and operating costs. Fundamental mode picosecond disk lasers are well established in micro machining at high throughput and perfect precision. Following the world's first market introduction of industrial grade 50 W picosecond lasers (TruMicro 5050) at the Photonics West 2008, the second generation of the TruMicro series 5000 now provides twice the average power (100 W at 1030 nm, or 60 W frequency doubled, green output) at a significantly reduced footprint. Mode-locked disk oscillators achieve by far the highest average power of any unamplified lasers, significantly exceeding the 100 W level in laboratory set-ups. With robust long resonators their multi-microjoule pulse energies begin to compete with typical ultrafast amplifiers. In addition, significant interest in disk technology has recently come from the extreme light laser community, aiming for ultra-high peak powers of petawatts and beyond.

  16. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  17. Design and performance of the beamlet amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Erlandson, A.C.; Rotter, M.D.; Frank, M.D.; McCracken, R.W.

    1996-06-01

    In future laser systems, such as the National Ignition Facility (NIF), multi-segment amplifiers (MSAs) will be used to amplify the laser beam to the required levels. As a prototype of such a laser architecture, the authors have designed, built, and tested flash-lamp-pumped, Nd:Glass, Brewster-angle slab MSAs for the Beamlet project. In this article, they review the fundamentals of Nd:Glass amplifiers, describe the MSA geometry, discuss parameters that are important in amplifier design, and present our results on the characterization of the Beamlet MSAs. In particular, gain and beam steering measurements show that the Beamlet amplifiers meet all optical performance specifications and perform close to model predictions.

  18. Amplified OTDR systems for multipoint corrosion monitoring.

    Science.gov (United States)

    Nascimento, Jehan F; Silva, Marcionilo J; Coêlho, Isnaldo J S; Cipriano, Eliel; Martins-Filho, Joaquim F

    2012-01-01

    We present two configurations of an amplified fiber-optic-based corrosion sensor using the optical time domain reflectometry (OTDR) technique as the interrogation method. The sensor system is multipoint, self-referenced, has no moving parts and can measure the corrosion rate several kilometers away from the OTDR equipment. The first OTDR monitoring system employs a remotely pumped in-line EDFA and it is used to evaluate the increase in system reach compared to a non-amplified configuration. The other amplified monitoring system uses an EDFA in booster configuration and we perform corrosion measurements and evaluations of system sensitivity to amplifier gain variations. Our experimental results obtained under controlled laboratory conditions show the advantages of the amplified system in terms of longer system reach with better spatial resolution, and also that the corrosion measurements obtained from our system are not sensitive to 3 dB gain variations.

  19. Amplified OTDR Systems for Multipoint Corrosion Monitoring

    Directory of Open Access Journals (Sweden)

    Joaquim F. Martins-Filho

    2012-03-01

    Full Text Available We present two configurations of an amplified fiber-optic-based corrosion sensor using the optical time domain reflectometry (OTDR technique as the interrogation method. The sensor system is multipoint, self-referenced, has no moving parts and can measure the corrosion rate several kilometers away from the OTDR equipment. The first OTDR monitoring system employs a remotely pumped in-line EDFA and it is used to evaluate the increase in system reach compared to a non-amplified configuration. The other amplified monitoring system uses an EDFA in booster configuration and we perform corrosion measurements and evaluations of system sensitivity to amplifier gain variations. Our experimental results obtained under controlled laboratory conditions show the advantages of the amplified system in terms of longer system reach with better spatial resolution, and also that the corrosion measurements obtained from our system are not sensitive to 3 dB gain variations.

  20. Detection of Non-Amplified Genomic DNA

    CERN Document Server

    Corradini, Roberto

    2012-01-01

    This book offers a state-of-the-art overview on non amplified DNA detection methods and provides chemists, biochemists, biotechnologists and material scientists with an introduction to these methods. In fact all these fields have dedicated resources to the problem of nucleic acid detection, each contributing with their own specific methods and concepts. This book will explain the basic principles of the different non amplified DNA detection methods available, highlighting their respective advantages and limitations. The importance of non-amplified DNA sequencing technologies will be also discussed. Non-amplified DNA detection can be achieved by adopting different techniques. Such techniques have allowed the commercialization of innovative platforms for DNA detection that are expected to break into the DNA diagnostics market. The enhanced sensitivity required for the detection of non amplified genomic DNA has prompted new strategies that can achieve ultrasensitivity by combining specific materials with specifi...

  1. An Implantable CMOS Amplifier for Nerve Signals

    DEFF Research Database (Denmark)

    Nielsen, Jannik Hammel; Lehmann, Torsten

    2001-01-01

    In this paper, a low noise high gain CMOS amplifier for minute nerve signals is presented. By using a mixture of weak- and strong inversion transistors, optimal noise suppression in the amplifier is achieved. A continuous-time offset-compensation technique is utilized in order to minimize impact...... on the amplifier input nodes. The method for signal recovery from noisy nerve signals is presented. A prototype amplifier is realized in a standard digital 0.5 μm CMOS single poly, n-well process. The prototype amplifier features a gain of 80 dB over a 3.6 kHz bandwidth, a CMRR of more than 87 dB and a PSRR...

  2. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  3. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  4. Measuring Optimal Length of the Amplifying Fiber in Different Working Conditions of the Amplifier

    Directory of Open Access Journals (Sweden)

    Radek Poboril

    2014-01-01

    Full Text Available The aim of this article is to highlight possible unwanted behaviour of an EDFA optical amplifier during temperature changes. After a brief introduction dealing with amplifiers and doped fibers in general we focus on the assembly of our own EDFA amplifier with standard construction and the IsoGain I-6 amplifying fiber, and on the parameters of its individual components. Since an erbium doped fiber has usually no direct thermal stabilization, temperature changes can affect performance of the entire amplifier. The next part of the article therefore describes the impacts of such changes on behaviour of our amplifier. At the very end we performed a measurement of the amplifier deployed in the actual WDM-PON the description of which can be found in the last chapter.

  5. Theoretical analysis and an improvement method of the bias effect on the linearity of RF linear power amplifiers

    Institute of Scientific and Technical Information of China (English)

    Wu Tuo; Chen Hongyi; Qian Dahong

    2009-01-01

    Based on the Gummel-Poon model of BJT, the change of the DC bias as a function of the AC input signal in RF linear power amplifiers is theoretically derived, so that the linearity of different DC bias circuits can be interpreted and compared. According to the analysis results, a quantitative adaptive DC bias circuit is proposed,which can improve the linearity and efficiency. From the simulation and test results, we draw conclusions on how to improve the design of linear power amplifier.

  6. High power Ka band TWT amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Golkowski, C.; Ivers, J.D.; Nation, J.A.; Wang, P.; Schachter, L.

    1999-07-01

    Two high power 35 GHz TWT amplifiers driven by a relativistic pencil, 850 kV, 200A electron beam have been assembled and tested. The first had a dielectric slow wave structure and was primarily used to develop diagnostics, and to gain experience in working with high power systems in Ka band. The source of the input power for the amplifier was a magnetron producing a 30 kW, 200ns long pulse of which 10 kW as delivered to the experiment. The 30 cm long dielectric (Teflon) amplifier produced output power levels of about 1 MW with a gain of about 23 dB. These results are consistent with expectations from PIC code simulations for this arrangement. The second amplifier, which is a single stage disk loaded slow wave structure, has been designed. It consists of one hundred uniform cells with two sets of ten tapered calls at the ends to lower the reflection coefficient. The phase advance per cell is {pi}/2. The amplifier passband extends from 28 to 40 GHz. It is designed to increase the output power to about 20 MW. The amplifier is in construction and will be tested in the near future. Details of the design of both systems will be provided and initial results from the new amplifier presented.

  7. An Envelope Hammerstein Model for Power Amplifiers

    Institute of Scientific and Technical Information of China (English)

    Hua-Dong Wang; Song-Bai He; Jing-Fu Bao; Zheng-De Wu

    2007-01-01

    In this paper, an envelope Hammerstein(EH) model is introduced to describe dynamic inputoutput characteristics of RF power amplifiers. In the modeling approach, we use a new truncation method and an established nonlinear time series method to determine model structure. Then, we discuss the process of model parameter extraction in detailed. Finally, a 2 W WCDMA power amplifier is measured to verify the performance of EH model, and good agreement between model output and measurement result shows our model can accurately predict output characteristic of the power amplifier.

  8. Quantum electronics maser amplifiers and oscillators

    CERN Document Server

    Fain, V M; Sanders, J H

    2013-01-01

    Quantum Electronics, Volume 2: Maser Amplifiers and Oscillators deals with the experimental and theoretical aspects of maser amplifiers and oscillators which are based on the principles of quantum electronics. It shows how the concepts and equations used in quantum electronics follow from the basic principles of theoretical physics.Comprised of three chapters, this volume begins with a discussion on the elements of the theory of quantum oscillators and amplifiers working in the microwave region, along with the practical achievements in this field. Attention is paid to two-level paramagnetic ma

  9. Effect of Soliton Propagation in Fiber Amplifiers

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The propagation of optical solitons in fiber amplifiers is discussed by considering a model that includes linear high order dispersion, two-photon absorption, nonlinear high-order dispersion, self-induced Ramam and five-order nonlinear effects. Based on travelling wave method, the solutions of the nonlinear Schrdinger equations, and the influence on soliton propagation as well as high-order effect in the fiber amplifier are discussed in detail. It is found that because of existing five-order nonlinear effect, the solution is not of secant hyperbola type, but shows high gain state of the fiber amplifier which is very favourable to the propagation of solitons.

  10. High Efficiency Microwave Power Amplifier (HEMPA) Design

    Science.gov (United States)

    Sims, W. Herbert

    2004-01-01

    This paper will focus on developing an exotic switching technique that enhances the DC-to-RF conversion efficiency of microwave power amplifiers. For years, switching techniques implemented in the 10 kHz to 30 MHz region have resulted in DC-to-RF conversion efficiencies of 90-95-percent. Currently amplifier conversion efficiency, in the 2-3 GHz region approaches, 10-20-percent. Using a combination of analytical modeling and hardware testing, a High Efficiency Microwave Power Amplifier was built that demonstrated conversion efficiencies four to five times higher than current state of the art.

  11. Fundamentals of RF and microwave transistor amplifiers

    CERN Document Server

    Bahl, Inder J

    2009-01-01

    A Comprehensive and Up-to-Date Treatment of RF and Microwave Transistor Amplifiers This book provides state-of-the-art coverage of RF and microwave transistor amplifiers, including low-noise, narrowband, broadband, linear, high-power, high-efficiency, and high-voltage. Topics covered include modeling, analysis, design, packaging, and thermal and fabrication considerations. Through a unique integration of theory and practice, readers will learn to solve amplifier-related design problems ranging from matching networks to biasing and stability. More than 240 problems are included to help read

  12. Experimental design of laminar proportional amplifiers

    Science.gov (United States)

    Hellbaum, R. F.

    1976-01-01

    An experimental program was initiated at Langley Research Center to study the effects of various parameters on the design of laminar proportional beam deflection amplifiers. Matching and staging of amplifiers to obtain high-pressure gain was also studied. Variable parameters were aspect ratio, setback, control length, receiver distance, receiver width, width of center vent, and bias pressure levels. Usable pressure gains from 4 to 19 per stage can now be achieved, and five amplifiers were staged together to yield pressure gains up to 2,000,000.

  13. Phase noise in RF and microwave amplifiers.

    Science.gov (United States)

    Boudot, Rodolphe; Rubiola, Enrico

    2012-12-01

    Understanding amplifier phase noise is a critical issue in many fields of engineering and physics, such as oscillators, frequency synthesis, telecommunication, radar, and spectroscopy; in the emerging domain of microwave photonics; and in exotic fields, such as radio astronomy, particle accelerators, etc. Focusing on the two main types of base noise in amplifiers, white and flicker, the power spectral density of the random phase φ(t) is Sφ(f) = b(0) + b(-1)/f. White phase noise results from adding white noise to the RF spectrum in the carrier region. For a given RF noise level, b(0) is proportional to the reciprocal of the carrier power P(0). By contrast, flicker results from a near-dc 1/f noise-present in all electronic devices-which modulates the carrier through some parametric effect in the semiconductor. Thus, b(-1) is a parameter of the amplifier, constant in a wide range of P(0). The consequences are the following: Connecting m equal amplifiers in parallel, b(-1) is 1/m times that of one device. Cascading m equal amplifiers, b(-1) is m times that of one amplifier. Recirculating the signal in an amplifier so that the gain increases by a power of m (a factor of m in decibels) as a result of positive feedback (regeneration), we find that b(-1) is m(2) times that of the amplifier alone. The feedforward amplifier exhibits extremely low b(-1) because the carrier is ideally nulled at the input of its internal error amplifier. Starting with an extensive review of the literature, this article introduces a system-oriented model which describes the phase flickering. Several amplifier architectures (cascaded, parallel, etc.) are analyzed systematically, deriving the phase noise from the general model. There follow numerous measurements of amplifiers using different technologies, including some old samples, and in a wide frequency range (HF to microwaves), which validate the theory. In turn, theory and results provide design guidelines and give suggestions for CAD and

  14. Achieving and maintaining cleanliness in NIF amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Burnham, A. K.; Horvath, J. A.; Letts, S. A.; Menapace, J. A.; Stowers, I. F.

    1998-07-28

    Cleanliness measurements made on AMPLAB prototype National Ignition Facility (NIF) laser amplifiers during assembly, cassette transfer, and amplifier operation are summarized. These measurements include particle counts from surface cleanliness assessments using filter swipe techniques and from airborne particle monitoring. Results are compared with similar measurements made on the Beamlet and Nova lasers and in flashlamp test fixtures. Observations of Class 100,000 aerosols after flashlamp firings are discussed. Comparisons are made between typical damage densities on laser amplifier optics from Novette, NOVA, Beamlet, and AMPLAB.

  15. Class D audio amplifier with 4th order output filter and self-oscillating full-state hysteresis based feedback driving capacitive transducers

    DEFF Research Database (Denmark)

    Nielsen, Dennis; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    A practical solution is presented for the design of a non-isolated high voltage DC/AC power converter. The converter is intended to be used as a class D audio amplifier for a Dielectric Electro Active Polymer (DEAP) transducer. A simple and effective hysteretic control scheme for the converter (b...

  16. Self-pulsation in Raman fiber amplifiers

    OpenAIRE

    Pedersen, Martin Erland Vestergaard; Ott, Johan Raunkjær; Rottwitt, Karsten

    2009-01-01

    Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated.

  17. Laser Cooled High-Power Fiber Amplifier

    CERN Document Server

    Nemova, Galina

    2009-01-01

    A theoretical model for laser cooled continuous-wave fiber amplifier is presented. The amplification process takes place in the Tm3+-doped core of the fluoride ZBLAN (ZrF4-BaF2-LaF3-AlF3-NaF) glass fiber. The cooling process takes place in the Yb3+:ZBLAN fiber cladding. It is shown that for each value of the pump power and the amplified signal there is a distribution of the concentration of the Tm3+ along the length of the fiber amplifier, which provides its athermal operation. The influence of a small deviation in the value of the amplified signal on the temperature of the fiber with the fixed distribution of the Tm3+ions in the fiber cladding is investigated.

  18. High Energy Single Frequency Resonant Amplifier Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR phase I project proposes a single frequency high energy resonant amplifier for remote sensing. Current state-of-art technologies can not provide all...

  19. Efficient Power Amplifier for Motor Control

    Science.gov (United States)

    Brown, R. J.

    1986-01-01

    Pulse-width-modulated amplifier supplies high current as efficiently as low current needed for starting and running motor. Key to efficiency of motor-control amplifier is V-channel metal-oxide/semiconductor transistor Q1. Device has low saturation resistance. However, has large gate input capacitance and small margin between its turn-on voltage and maximum allowable gate-to-source voltage. Circuits for output stages overcome limitations of VMOS device.

  20. Quantum cloning with an optical fiber amplifier

    CERN Document Server

    Fasel, S; Ribordy, G; Scarani, V; Zbinden, H; Fasel, Sylvain; Gisin, Nicolas; Ribordy, Gregoire; Scarani, Valerio; Zbinden, Hugo

    2002-01-01

    It has been shown theoretically that a light amplifier working on the physical principle of stimulated emission should achieve optimal quantum cloning of the polarization state of light. We demonstrate close-to-optimal universal quantum cloning of polarization in a standard fiber amplifier for telecom wavelengths. For cloning $1\\to 2$ we find a fidelity of 0.82, the optimal value being ${5/6}=0.83$.

  1. CMOS current amplifiers : speed versus nonlinearity

    OpenAIRE

    2000-01-01

    This work deals with analogue integrated circuit design using various types of current-mode amplifiers. These circuits are analysed and realised using modern CMOS integration technologies. The dynamic nonlinearities of these circuits are discussed in detail as in the literature only linear nonidealities and static nonlinearities are conventionally considered. For the most important open-loop current-mode amplifier, the second-generation current-conveyor (CCII), a macromodel is derived tha...

  2. MMIC Amplifiers for 90 to 130 GHz

    Science.gov (United States)

    Samoska, Lorene; Pukala, David; Peralta, Alejandro; Bryerton, Eric; Morgan, Matt; Boyd, T.; Hu, Ming; Schmitz, Adele

    2007-01-01

    This brief describes two monolithic microwave integrated-circuit (MMIC) amplifier chips optimized to function in the frequency range of 90 to 130 GHz, covering nearly all of F-band (90 - 140 GHz). These amplifiers were designed specifically for local-oscillator units in astronomical radio telescopes such as the Atacama Large Millimeter Array (ALMA). They could also be readily adapted for use in electronic test equipment, automotive radar systems, and communications systems that operate between 90 and 130 GHz.

  3. Some Notes on Wideband Feedback Amplifiers

    Science.gov (United States)

    Fitch, V.

    1949-03-16

    The extension of the passband of wideband amplifiers is a highly important problem to the designer of electronic circuits. Throughout the electronics industry and in many research programs in physics and allied fields where extensive use is made of video amplifiers, the foremost requirement is a passband of maximum width. This is necessary if it is desired to achieve a more faithful reproduction of transient wave forms, a better time resolution in physical measurements, or perhaps just a wider band gain-frequency response to sine wave signals. The art of electronics is continually faced with this omnipresent amplifier problem. In particular, the instrumentation techniques of nuclear physics require amplifiers with short rise times, a high degree of gain stability, and a linear response to high signal levels. While the distributed amplifier may solve the problems of those seeking only a wide passband, the requirements of stability and linearity necessitate using feedback circuits. This paper considers feedback amplifiers from the standpoint of high-frequency performance. The circuit conditions for optimum steady-state (sinusoidal) and transient response are derived and practical circuits (both interstage and output) are presented which fulfill these conditions. In general, the results obtained may be applied to the low-frequency end.

  4. Low Noise Optically Pre-amplified Lightwave Receivers and Other Applications of Fiber Optic Parametric Amplifiers

    Science.gov (United States)

    2010-07-27

    noise performance, optical gain bandwidth, and power efficiency. An interesting alternative to the mature Erbium-doped fiber amplifier ( EDFA ) is the...fibers (HNLF) and high power booster EDFAs . The FOPA can provide a very wide gain bandwidth [2], very high gain (70 dB was demonstrated in [3]), and...amplified spontaneous emission (ASE) noise in EDFAs is also generated. It is sometimes referred to as amplified quantum noise. Maximum gain (at the gain

  5. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  6. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  7. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  8. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  9. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  10. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  11. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  12. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  13. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  14. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  15. AC losses in monofilamentary MgB{sub 2} round wire carrying alternating transport currents

    Energy Technology Data Exchange (ETDEWEB)

    Kajikawa, K [Research Institute of Superconductor Science and Systems, Kyushu University, Fukuoka 819-0395 (Japan); Kawano, T [Department of Electrical and Electronic Systems Engineering, Kyushu University, Fukuoka 819-0395 (Japan); Osaka, R [Department of Electrical Engineering, Kyushu University, Fukuoka 819-0395 (Japan); Nakamura, T [Department of Electrical Engineering, Kyoto University, Kyoto 615-8510 (Japan); Sugano, M [Department of Electronic Science and Engineering, Kyoto University, Kyoto 615-8510 (Japan); Takahashi, M; Wakuda, T, E-mail: kajikawa@sc.kyushu-u.ac.j [Hitachi Research Laboratory, Hitachi, Ltd, Hitachi 319-1292 (Japan)

    2010-04-15

    AC losses in a monofilamentary MgB{sub 2} round wire with niobium and copper metal sheaths and carrying alternating transport currents are evaluated at several temperatures and frequencies. First, the transport current losses are observed electrically using a lock-in amplifier. Experimental results show that the AC losses decrease with an increase in the temperature if the amplitude of the transport current normalized by the corresponding critical current is maintained constant. On the other hand, the AC losses increase slightly with the frequency. Next, the AC losses are calculated numerically by a finite difference method. The numerical results for the superconductor filament show a good agreement with the results of the conventional theoretical expression formulated using the Bean model over a wide range of current amplitudes. It is also found that the AC losses in the niobium sheath are negligible whereas those in the copper sheath are comparable with those in the superconductor. On the basis of the numerical calculations, an expression is analytically derived for estimating the eddy current loss occurring in a metal sheath. The derived expression well reproduces the AC loss properties of both the copper and niobium sheaths.

  16. AC losses in monofilamentary MgB2 round wire carrying alternating transport currents

    Science.gov (United States)

    Kajikawa, K.; Kawano, T.; Osaka, R.; Nakamura, T.; Sugano, M.; Takahashi, M.; Wakuda, T.

    2010-04-01

    AC losses in a monofilamentary MgB2 round wire with niobium and copper metal sheaths and carrying alternating transport currents are evaluated at several temperatures and frequencies. First, the transport current losses are observed electrically using a lock-in amplifier. Experimental results show that the AC losses decrease with an increase in the temperature if the amplitude of the transport current normalized by the corresponding critical current is maintained constant. On the other hand, the AC losses increase slightly with the frequency. Next, the AC losses are calculated numerically by a finite difference method. The numerical results for the superconductor filament show a good agreement with the results of the conventional theoretical expression formulated using the Bean model over a wide range of current amplitudes. It is also found that the AC losses in the niobium sheath are negligible whereas those in the copper sheath are comparable with those in the superconductor. On the basis of the numerical calculations, an expression is analytically derived for estimating the eddy current loss occurring in a metal sheath. The derived expression well reproduces the AC loss properties of both the copper and niobium sheaths.

  17. Fully digital controlled A.C. servo engraving machine based on DEC4DA

    Science.gov (United States)

    Shu, Zhibing; Chen, Xianfeng; Zhang, Hairong; Huang, Yiqun; Yan, Caizhong

    2005-12-01

    A novel engraving machine (NUT-1A) is presented, in which fully digital controlled AC system based on DEC4DA was used to improve the machining precision and sensitivity. This engraving machine was constructed around AC servo motor with encoder, controlled by a servo motor control card - DEC4DA. As the upper unit of AC servo motor, DEC4DA was a numerical control generator, which received pulses form CPU by ISA bus, and these pulses were amplified and converted to drive AC servo actuator. This novel engraving machine can achieve a higher positioning accuracy of +/-0.01mm and positioning repetition of +/-0.005mm, and its resolution is 0.001mm/0.0001mm. Moreover, because of multi-closed loops were used in the system, the steady and transient performances are more excellent. This system ensures a much quicker current regulation in closed-loop operation, of acceleration and braking in both directions, as well as stable speed characteristics. Amplifier boards are protected against excessive current, excessive temperature and short circuiting of the motor supply cables.

  18. Transpermeance Amplifier Applied to Magnetic Bearings

    Directory of Open Access Journals (Sweden)

    Jossana Ferreira

    2017-02-01

    Full Text Available The most conventional approach of controlling magnetic forces in active magnetic bearings (AMBs is through current feedback amplifiers: transconductance. This enables the operation of the AMB to be understood in terms of a relatively simple current-based model as has been widely reported on in the literature. The alternative notion of using transpermeance amplifiers, which approximate the feedback of gap flux rather than current, has been in commercial use in some form for at least thirty years, however is only recently seeing more widespread acceptance as a commercial standard. This study explores how such alternative amplifiers should be modeled and then examines the differences in behavior between AMBs equipped with transconductance and transpermeance amplifiers. The focus of this study is on two aspects. The first is the influence of rotor displacement on AMB force, commonly modeled as a constant negative equivalent mechanical stiffness, and it is shown that either scheme actually leads to a finite bandwidth effect, but that this bandwidth is much lower when transpermeance is employed. The second aspect is the influence of eddy currents. Using a very simple model of eddy currents (a secondary short-circuited coil, it is demonstrated that transpermeance amplifiers can recover significant actuator bandwidth compared with transconductance, but at the cost of needing increased peak current headroom.

  19. High power, high beam quality regenerative amplifier

    Science.gov (United States)

    Hackel, L.A.; Dane, C.B.

    1993-08-24

    A regenerative laser amplifier system generates high peak power and high energy per pulse output beams enabling generation of X-rays used in X-ray lithography for manufacturing integrated circuits. The laser amplifier includes a ring shaped optical path with a limited number of components including a polarizer, a passive 90 degree phase rotator, a plurality of mirrors, a relay telescope, and a gain medium, the components being placed close to the image plane of the relay telescope to reduce diffraction or phase perturbations in order to limit high peak intensity spiking. In the ring, the beam makes two passes through the gain medium for each transit of the optical path to increase the amplifier gain to loss ratio. A beam input into the ring makes two passes around the ring, is diverted into an SBS phase conjugator and proceeds out of the SBS phase conjugator back through the ring in an equal but opposite direction for two passes, further reducing phase perturbations. A master oscillator inputs the beam through an isolation cell (Faraday or Pockels) which transmits the beam into the ring without polarization rotation. The isolation cell rotates polarization only in beams proceeding out of the ring to direct the beams out of the amplifier. The diffraction limited quality of the input beam is preserved in the amplifier so that a high power output beam having nearly the same diffraction limited quality is produced.

  20. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  1. The OPTHER Project: Progress toward the THz Amplifier

    DEFF Research Database (Denmark)

    Paoloni, C; Brunetti, F; Di Carlo, A

    2011-01-01

    This paper describes the status of the OPTHER (OPtically driven TeraHertz AmplifiERs) project and progress toward the THz amplifier realization. This project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within th...

  2. Wideband pulse amplifiers for the NECTAr chip

    Science.gov (United States)

    Sanuy, A.; Delagnes, E.; Gascon, D.; Sieiro, X.; Bolmont, J.; Corona, P.; Feinstein, F.; Glicenstein, J.-F.; Naumann, C. L.; Nayman, P.; Ribó, M.; Tavernet, J.-P.; Toussenel, F.; Vincent, P.; Vorobiov, S.

    2012-12-01

    The NECTAr collaboration's FE option for the camera of the CTA is a 16 bits and 1-3 GS/s sampling chip based on analog memories including most of the readout functions. This works describes the input amplifiers of the NECTAr ASIC. A fully differential wideband amplifier, with voltage gain up to 20 V/V and a BW of 400 MHz. As it is impossible to design a fully differential OpAmp with an 8 GHz GBW product in a 0.35 CMOS technology, an alternative implementation based on HF linearized transconductors is explored. The output buffer is a class AB miller operational amplifier, with special non-linear current boost.

  3. Wideband pulse amplifiers for the NECTAr chip

    Energy Technology Data Exchange (ETDEWEB)

    Sanuy, A., E-mail: asanuy@ecm.ub.es [Dept. AM i Dept. ECM, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona. Marti i Franques 1, E08028, Barcelona (Spain); Delagnes, E. [IRFU/DSM/CEA, CE-Saclay, Bat. 141 SEN Saclay, F-91191, Gif-sur-Yvette (France); Gascon, D. [Dept. AM i Dept. ECM, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona. Marti i Franques 1, E08028, Barcelona (Spain); Sieiro, X. [Departament d' Electronica, Universitat de Barcelona. Marti i Franques 1, E08028, Barcelona (Spain); Bolmont, J.; Corona, P. [LPNHE, Universite Paris VI and Universite Paris VII and IN2P3/CNRS, Barre 12-22, 1er etage, 4 place Jussieu, 75252 Paris (France); Feinstein, F. [LUPM, Universite Montpellier II and IN2P3/CNRS, CC072, bat. 13, place Eugene Bataillon, 34095 Montpellier (France); Glicenstein, J-F. [IRFU/DSM/CEA, CE-Saclay, Bat. 141 SEN Saclay, F-91191, Gif-sur-Yvette (France); Naumann, C.L.; Nayman, P. [LPNHE, Universite Paris VI and Universite Paris VII and IN2P3/CNRS, Barre 12-22, 1er etage, 4 place Jussieu, 75252 Paris (France); Ribo, M. [Dept. AM i Dept. ECM, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona. Marti i Franques 1, E08028, Barcelona (Spain); and others

    2012-12-11

    The NECTAr collaboration's FE option for the camera of the CTA is a 16 bits and 1-3 GS/s sampling chip based on analog memories including most of the readout functions. This works describes the input amplifiers of the NECTAr ASIC. A fully differential wideband amplifier, with voltage gain up to 20 V/V and a BW of 400 MHz. As it is impossible to design a fully differential OpAmp with an 8 GHz GBW product in a 0.35 CMOS technology, an alternative implementation based on HF linearized transconductors is explored. The output buffer is a class AB miller operational amplifier, with special non-linear current boost.

  4. The Electron Beam Semiconductor (EBS) amplifier

    Science.gov (United States)

    True, R. M.; Baxendale, J. F.

    1980-07-01

    The Electron Beam Semiconductor (EBS) concept has existed for three decades; but only within the last decade has an active, well-defined program been underway to develop devices that can operate as high-power radio frequency(RF) amplifiers, fast risetime switches, and current and voltage pulse amplifiers. This report discusses the test procedures, data and results of reliability testing of RF and video pulse EBS amplifiers at Electronics Research and Development Command (ERADCOM), Fort Monmouth, New Jersey. Also, the experimental analysis of the series connected diode EBS device is described in detail. Finally, the report concludes with a discussion of the state-of-the-art of EBS and future trends of the technology.

  5. Design Of A Doherty Power Amplifier For GSM Systems

    Directory of Open Access Journals (Sweden)

    Saad Wasmi Osman

    2013-04-01

    Full Text Available This paper presents the design and analysis of Doherty power amplifier. The Doherty amplifier is used in  a base station for mobile system because of its high efficiency. The class AB power amplifier used in the configuration of the main and auxiliary amplifier. The result obtained shows that the Doherty power amplifier can be used on a wide band spectrum, the amplifier works at 900MHz and has very good power added efficiency (PAE and gain. The amplifier can also work at 1800MHz at input power greater than 20dBm. 

  6. Implementation of Digital Lock-in Amplifier

    Science.gov (United States)

    Bhattacharyya, Sabyasachi; Nasir Ahmed, Ragib; Bijoy Purkayastha, Basab; Bhattacharyya, Kaustubh

    2016-10-01

    The recovery of signal under the presence of noise is utmost essential for proper communication. The signals corrupted due to noise can be recovered using various techniques. However the weak signals are more prone to noise and hence they can be easily degraded due to noise. In such cases, a digital lock-in amplifier becomes an essential device for recovery of such weak signals. Keeping the cost, speed and other considerations, we will present the implementation of digital lock-in amplifier and how it recovers the weak signal under extreme noisy conditions.

  7. Double Clad Er-doped Fiber Amplifier

    Institute of Scientific and Technical Information of China (English)

    FU Yong-jun; MAO Xiang-qiao; WEI Huai; LI jian

    2007-01-01

    Presented is a theoretical study of double-clad Er-doped fiber power amplifier(EDFA). Two kinds of double clad fibers(DCF) with rectangular and "flower" inner clad shapes are studied, and these fibers have different coupling constants and propagation losses. We calculate the effective pump power absorption ratio along the fiber with different coupling constants from the first cladding to the doped core and with different propagation losses for the power in the inner cladding. Then the gains of the double clad Er-doped fiber amplifiers versus fiber lengths are calculated using the EDFA model based on propagation and rate equations of a homogeneous, two-level medium.

  8. Optimization of Pr3+:ZBLAN fiber amplifiers

    OpenAIRE

    Pedersen, B.; Miniscalco, J. W.; Quimby, R. S.

    1992-01-01

    Experimental parameters have been measured and used in a quantitative model of Pr3+-doped fluorozirconate fiber amplifiers. The optimum cutoff wavelength was determined to be 800 nm and the gain for 400 mW of pump was found to increase from 12 to 34 dB if the NA was increased from 0.15 to 0.25. Lengthening the metastable state lifetime from 110 to 300 μs would significantly improve amplifier performance while concentration quenching can appreciably degrade it

  9. Dynamic range meter for radiofrequency amplifiers

    Directory of Open Access Journals (Sweden)

    Drozd S. S.

    2009-04-01

    Full Text Available The new measurement setup having increased on 20…30 dB the own dynamic range in comparison with the standard circuit of the dynamic range meter is offered and the rated value of an error bringing by setup in the worst case does not exceed ± 2,8 dB. The measurement setup can be applied also to determinate levels of intermodulation components average power amplifiers and powerful amplifiers of a low-frequency at replacement of the quartz filter on meeting low-frequency the LC-filter and the spectrum analyzer.

  10. Analysis of bipolar and CMOS amplifiers

    CERN Document Server

    Sodagar, Amir M

    2007-01-01

    The classical approach to analog circuit analysis is a daunting prospect to many students, requiring tedious enumeration of contributing factors and lengthy calculations. Most textbooks apply this cumbersome approach to small-signal amplifiers, which becomes even more difficult as the number of components increases. Analysis of Bipolar and CMOS Amplifiers offers students an alternative that enables quick and intuitive analysis and design: the analysis-by-inspection method.This practical and student-friendly text demonstrates how to achieve approximate results that fall within an acceptable ran

  11. Linear Amplifier Model for Optomechanical Systems

    CERN Document Server

    Botter, Thierry; Brahms, Nathan; Schreppler, Sydney; Stamper-Kurn, Dan M

    2011-01-01

    We model optomechanical systems as linear optical amplifiers. This provides a unified treatment of diverse optomechanical phenomena. We emphasize, in particular, the relationship between ponderomotive squeezing and optomechanically induced transparency, two foci of current research. We characterize the amplifier response to quantum and deliberately applied fluctuations, both optical and mechanical. Further, we apply these results to establish quantum limits on external force sensing both on and off cavity resonance. We find that the maximum sensitivity attained on resonance constitutes an absolute upper limit, not surpassed when detuning off cavity resonance. The theory can be extended to a two-sided cavity with losses and limited detection efficiency.

  12. Operational amplifier circuits analysis and design

    CERN Document Server

    Nelson, J C C

    1995-01-01

    This book, a revised and updated version of the author's Basic Operational Amplifiers (Butterworths 1986), enables the non-specialist to make effective use of readily available integrated circuit operational amplifiers for a range of applications, including instrumentation, signal generation and processing.It is assumed the reader has a background in the basic techniques of circuit analysis, particularly the use of j notation for reactive circuits, with a corresponding level of mathematical ability. The underlying theory is explained with sufficient but not excessive, detail. A range of compu

  13. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nin T, cardiac muscle OS=Homo sapiens... 35 0.27 sp|P98193|DMP1_RAT Dentin matrix...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac...EEDAEAEAETEETRAEEDEEEEEAKEAEDG 68 Query: 329 PADQETP 349 P ++ P Sbjct: 69 PMEESKP 75 >sp|P98193|DMP1_RAT Dentin

  14. AcEST: DK956827 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n, cytoplasmic 1 OS=Salmo salar GN=AC... 389 e-107 tr|B3TH90|B3TH90_POERE Beta-actin OS=Poecilia reticulata ...PE=2 SV=1 389 e-107 tr|B3TH89|B3TH89_POERE Beta-actin OS=Poecilia reticulata PE=4 SV=1 389 e-107 tr|B3GLI4|B

  15. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  16. Feedback analysis of transimpedance operational amplifier circuits

    DEFF Research Database (Denmark)

    Bruun, Erik

    1993-01-01

    The transimpedance or current feedback operational amplifier (CFB op-amp) is reviewed and compared to a conventional voltage mode op-amp using an analysis emphasizing the basic feedback characteristics of the circuit. With this approach the paradox of the constant bandwidth obtained from CFB op...

  17. High-Performance Operational and Instrumentation Amplifiers

    NARCIS (Netherlands)

    Shahi, B.

    2015-01-01

    This thesis describes techniques to reduce the offset error in precision instrumentation and operational amplifiers. The offset error which is considered a major error source associated with gain blocks, together with other errors are reviewed. Conventional and newer approaches to remove offset and

  18. Holographic preamplifier for a quantum amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Zemskov, K.I.; Kazarian, M.A.; Orlova, N.G.; Liuksiutov, S.F.; Odulov, S.G.

    1988-08-01

    Successive amplification of a weak optical signal was realized experimentally in holographic and quantum amplifiers. The signal was a coherent one with an intensity less than the actual noise of the copper-vapor active medium; the technique involved the use of a coherent holographic preamplifier based on a lithium niobate/sodium photorefractive crystal. 8 references.

  19. Optimization of Pr3+:ZBLAN fiber amplifiers

    DEFF Research Database (Denmark)

    Pedersen, B.; Miniscalco, J. W.; Quimby, R. S.

    1992-01-01

    Experimental parameters have been measured and used in a quantitative model of Pr3+-doped fluorozirconate fiber amplifiers. The optimum cutoff wavelength was determined to be 800 nm and the gain for 400 mW of pump was found to increase from 12 to 34 dB if the NA was increased from 0.15 to 0...

  20. Predistortion of a Bidirectional Cuk Audio Amplifier

    DEFF Research Database (Denmark)

    Birch, Thomas Hagen; Nielsen, Dennis; Knott, Arnold;

    2014-01-01

    Some non-linear amplifier topologies are capable of providing a larger voltage gain than one from a DC source, which could make them suitable for various applications. However, the non-linearities introduce a significant amount of harmonic distortion (THD). Some of this distortion could be reduce...

  1. A THEORY FOR BROADBAND VARACTOR PARAMETRIC AMPLIFIERS

    Science.gov (United States)

    design and synthesis of broadband varactor parametric amplifiers. The circuit considered in this thesis is that of linear variable capacitors embedded...second and more important inherent property is that, due to the frequency-coupling action of the variable capacitor , the scattering coefficient at the

  2. Offset Correction Techniques for Voltage Sense Amplifiers

    NARCIS (Netherlands)

    Groeneveld, S.

    2006-01-01

    This report deals with offset correction techniques for voltage sense amplifiers and is divided into two different parts: 1) mismatch and 2) offset correction techniques. First a literature study is done on the subject mismatch with specially focus on the future. Mismatch of a transistor is determin

  3. Ultra-low Voltage CMOS Cascode Amplifier

    DEFF Research Database (Denmark)

    Lehmann, Torsten; Cassia, Marco

    2000-01-01

    In this paper, we design a folded cascode operational transconductance amplifier in a standard CMOS process, which has a measured 69 dB DC gain, a 2 MHz bandwidth and compatible input- and output voltage levels at a 1 V power supply. This is done by a novel Current Driven Bulk (CDB) technique...

  4. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  5. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  6. A balanced wide-band amplifier for microwave applications

    Science.gov (United States)

    Panzariu, Mircea; Lupescu, Horia; Dumitrascu, Ana; Tamas, Razvan D.

    2015-02-01

    Due to its better performance, high fiability and large power capability, balanced amplifier is one of the most popular designs used in narrow band applications. However, with a balanced amplifier in class A operation, the band-pass is still narrow with classical coupler [1]. In this paper, we propose a new method for widen the band-pass and linearity of the amplifier, by using two Lange couplers and by adding two drivers, so that small signal could be amplified [2], [3], [4], [5]. The proposed amplifier works in the 0.9 - 2.4 GHz band, with good performances. We also propose an A class X-band amplifier, with Wilkinson power divider used as a combiner and divider. The amplifier will operate at 9,5 GHz with Continuous Wave (C.W). The two methods were validated by simulating the balanced amplifier with Lange coupler and the balanced amplifier with Wilkinson power divider, in class A operation.

  7. Multi-pass amplifier architecture for high power laser systems

    Science.gov (United States)

    Manes, Kenneth R; Spaeth, Mary L; Erlandson, Alvin C

    2014-04-01

    A main amplifier system includes a first reflector operable to receive input light through a first aperture and direct the input light along an optical path. The input light is characterized by a first polarization. The main amplifier system also includes a first polarizer operable to reflect light characterized by the first polarization state. The main amplifier system further includes a first and second set of amplifier modules. Each of the first and second set of amplifier modules includes an entrance window, a quarter wave plate, a plurality of amplifier slablets arrayed substantially parallel to each other, and an exit window. The main amplifier system additionally includes a set of mirrors operable to reflect light exiting the first set of amplifier modules to enter the second set of amplifier modules and a second polarizer operable to reflect light characterized by a second polarization state.

  8. Stimulus presentation at specific neuronal oscillatory phases experimentally controlled with tACS: implementation and applications

    Directory of Open Access Journals (Sweden)

    Sanne Ten Oever

    2016-10-01

    Full Text Available In recent years it has become increasingly clear that both the power and phase of oscillatory brain activity can influence the processing and perception of sensory stimuli. Transcranial alternating current stimulation (tACS can phase-align and amplify endogenous brain oscillations and has often been used to control and thereby study oscillatory power. Causal investigation of oscillatory phase is more difficult, as it requires precise real-time temporal control over both oscillatory phase and sensory stimulation. Here, we present hardware and software solutions allowing temporally precise presentation of sensory stimuli during tACS at desired tACS phases, enabling causal investigations of oscillatory phase. We developed freely available and easy to use software, which can be coupled with standard commercially available hardware to allow flexible and multi-modal stimulus presentation (visual, auditory, magnetic stimuli, etc. at pre-determined tACS-phases, opening up a range of new research opportunities. We validate that stimulus presentation at tACS phase in our setup is accurate to the sub-millisecond level with high inter-trial consistency. Conventional methods investigating the role of oscillatory phase such as magneto-/electroencephalography can only provide correlational evidence. Using brain stimulation with the described methodology enables investigations of the causal role of oscillatory phase. This setup turns oscillatory phase into an independent variable, allowing innovative and systematic studies of its functional impact on perception and cognition.

  9. The warm, rich sound of valve guitar amplifiers

    Science.gov (United States)

    Keeports, David

    2017-03-01

    Practical solid state diodes and transistors have made glass valve technology nearly obsolete. Nevertheless, valves survive largely because electric guitar players much prefer the sound of valve amplifiers to the sound of transistor amplifiers. This paper discusses the introductory-level physics behind that preference. Overdriving an amplifier adds harmonics to an input sound. While a moderately overdriven valve amplifier produces strong even harmonics that enhance a sound, an overdriven transistor amplifier creates strong odd harmonics that can cause dissonance. The functioning of a triode valve explains its creation of even and odd harmonics. Music production software enables the examination of both the wave shape and the harmonic content of amplified sounds.

  10. Low phase noise oscillator using two parallel connected amplifiers

    Science.gov (United States)

    Kleinberg, Leonard L.

    1987-01-01

    A high frequency oscillator is provided by connecting two amplifier circuits in parallel where each amplifier circuit provides the other amplifier circuit with the conditions necessary for oscillation. The inherent noise present in both amplifier circuits causes the quiescent current, and in turn, the generated frequency, to change. The changes in quiescent current cause the transconductance and the load impedance of each amplifier circuit to vary, and this in turn results in opposing changes in the input susceptance of each amplifier circuit. Because the changes in input susceptance oppose each other, the changes in quiescent current also oppose each other. The net result is that frequency stability is enhanced.

  11. Amplified spontaneous emission spectrum and gain characteristic of a two-electrode semiconductor optical amplifier*

    Institute of Scientific and Technical Information of China (English)

    Wang Hanchao; Huang Lirong; Shi Zhongwei

    2011-01-01

    A two-electrode multi-quantum-well semiconductor optical amplifier is designed and fabricated. The amplified spontaneous emission (ASE) spectrum and gain were measured and analyzed. It is shown that the ASE spectrum and gain characteristic are greatly influenced by the distribution of the injection current density. By changing the injection current density of two electrodes, the full width at half maximum, peak wavelength, peak power of the ASE spectrum and the gain characteristic can be easily controlled.

  12. Tunable microstrip SQUID amplifiers for the Gen 2 Axion Dark Matter eXperiment (ADMX)

    Science.gov (United States)

    O'Kelley, Sean; Hilton, Gene; Clarke, John; ADMX Collaboration

    2016-03-01

    We present a series of tunable microstrip SQUID (Superconducting Quantum Interference Device) amplifiers (MSAs) for installation in ADMX. The axion dark matter candidate is detected via Primakoff conversion to a microwave photon in a high-Q (~100,000) tunable microwave cavity cooled with a dilution refrigerator in a 7-tesla magnetic field. The microwave photon frequency ν is a function of the unknown axion mass, so both the cavity and amplifier must be scanned over a wide frequency range. An MSA is a linear, phase-preserving amplifier consisting of a square washer loop, fabricated from a thin Nb film, incorporating two Josephson tunnel junctions with resistive shunts to prevent hysteresis. The input is coupled via a microstrip made from a square Nb coil deposited over the washer with an intervening insulating layer. Tunability is achieved by terminating the microstrip with GaAs varactors that operate below 100 mK. By varying the varactor capacitance with a bias voltage, the resonant frequency is varied by up to a factor of 2. We demonstrate several devices operating below 100 mK, matched to the discrete operating bands of ADMX at frequencies ranging from 560 MHz to 1 GHz. The MSAs exhibit gains exceeding 20 dB and the associated noise temperatures, measured with a hot/cold load, approach the standard quantum limit (hν/kB) . Supported by DOE Grants DE - FG02 - 97ER41029, DE - FG02 - 96ER40956, DE - AC52 - 07NA27344, DE - AC03 - 76SF00098, and the Livermore LDRD program.

  13. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  14. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  15. Design of an 1800 nm Raman Amplifier

    DEFF Research Database (Denmark)

    Svane, Ask Sebastian; Rottwitt, Karsten

    in the pump power requirement and deteriorated noise properties. Here we demonstrate a Raman amplifier designed for signal wavelengths around 1800 nm. The amplification fiber is an OFS PM Raman fiber, and is pumped by a Raman fiber laser emitting at 1680 nm [4]. The amplifier was pumped co......-polarized and backward, with respect to the singal. In Fig. 2 a measured Raman on/off gain exceeding 9 dB for 285 mW of injected pump power is obtained in a 4.35 km long fiber. A broadband supercontinuum source was used as a signal from 1700 nm to 1900 nm.......Different approaches are being explored to increase the capacity of communication systems [1,2], both long and short range systems. One approach is by exploiting new optical wavelength bands, outside the conventional communication window from 1530 nm to 1625 nm. Hollow core fibers have been...

  16. Behavioral modeling of Digitally Adjustable Current Amplifier

    Directory of Open Access Journals (Sweden)

    Josef Polak

    2015-03-01

    Full Text Available This article presents the digitally adjustable current amplifier (DACA and its analog behavioral model (ABM, which is suitable for both ideal and advanced analyses of the function block using DACA as active element. There are four levels of this model, each being suitable for simulation of a certain degree of electronic circuits design (e.g. filters, oscillators, generators. Each model is presented through a schematic wiring in the simulation program OrCAD, including a description of equations representing specific functions in the given level of the simulation model. The design of individual levels is always verified using PSpice simulations. The ABM model has been developed based on practically measured values of a number of DACA amplifier samples. The simulation results for proposed levels of the ABM model are shown and compared with the results of the real easurements of the active element DACA.

  17. Noise Gain Features of Fiber Raman Amplifier

    Directory of Open Access Journals (Sweden)

    Georgii S. Felinskyi

    2016-01-01

    Full Text Available The formation dynamics of the optical noise in a silica single mode fiber (SMF as function of the pump power variation in the counter pumped fiber Raman amplifier (FRA is experimentally studied. The ratio between the power of amplified spontaneous emission and the power of incoherent optical noise is quantitatively determined by detailed analysis of experimental data in the pump powers range of 100–300 mW within the full band of Stokes frequencies, including FRA working wavelengths over the C + L transparency windows. It is found out the maximum of Raman gain coefficient for optical noise does not exceed ~60% of corresponding peak at the gain profile maximum of coherent signal. It is shown that the real FRA noise figure may be considerably less than 3 dB over a wide wavelength range (100 nm at a pump power of several hundreds of mW.

  18. Cryogenic cooling for high power laser amplifiers

    Directory of Open Access Journals (Sweden)

    Perin J.P.

    2013-11-01

    Full Text Available Using DPSSL (Diode Pumped Solid State Lasers as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz. The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K–170 K with a heat flux of 1 MW*m−2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser.

  19. Linear control of oscillator and amplifier flows*

    Science.gov (United States)

    Schmid, Peter J.; Sipp, Denis

    2016-08-01

    Linear control applied to fluid systems near an equilibrium point has important applications for many flows of industrial or fundamental interest. In this article we give an exposition of tools and approaches for the design of control strategies for globally stable or unstable flows. For unstable oscillator flows a feedback configuration and a model-based approach is proposed, while for stable noise-amplifier flows a feedforward setup and an approach based on system identification is advocated. Model reduction and robustness issues are addressed for the oscillator case; statistical learning techniques are emphasized for the amplifier case. Effective suppression of global and convective instabilities could be demonstrated for either case, even though the system-identification approach results in a superior robustness to off-design conditions.

  20. Fundamentals of fiber lasers and fiber amplifiers

    CERN Document Server

    Ter-Mikirtychev, Valerii (Vartan)

    2014-01-01

    This book covers the fundamental aspects of fiber lasers and fiber amplifiers, and includes a wide range of material from laser physics fundamentals to state-of-the-art topics in this rapidly growing field of quantum electronics. Emphasis is placed on the nonlinear processes taking place in fiber lasers and amplifiers, their similarities, differences to, and their advantages over other solid-state lasers. The reader will learn basic principles of solid-state physics and optical spectroscopy of laser active centers in fibers, main operational laser regimes, and practical recommendations and suggestions on fiber laser research, laser applications, and laser product development. The book will be useful for students, researchers, and professionals who work with lasers, in the optical communications, chemical and biological industries, etc.

  1. Design and simulation of a gyroklystron amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Chauhan, M. S., E-mail: mschauhan.rs.ece@iitbhu.ac.in; Swati, M. V.; Jain, P. K. [Centre of Research in Microwave Tubes, Department of Electronics Engineering, Indian Institute of Technology, Banaras Hindu University, Varanasi 221005 (India)

    2015-03-15

    In the present paper, a design methodology of the gyroklystron amplifier has been described and subsequently used for the design of a typically selected 200 kW, Ka-band, four-cavity gyroklystron amplifier. This conceptual device design has been validated through the 3D particle-in-cell (PIC) simulation and nonlinear analysis. Commercially available PIC simulation code “MAGIC” has been used for the electromagnetic study at the different location of the device RF interaction structure for the beam-absent case, i.e., eigenmode study as well as for the electron beam and RF wave interaction behaviour study in the beam present case of the gyroklystron. In addition, a practical problem of misalignment of the RF cavities with drift tubes within the tube has been also investigated and its effect on device performance studied. The analytical and simulation results confirmed the validity of the gyroklystron device design. The PIC simulation results of the present gyroklystron produced a stable RF output power of ∼218 kW for 0% velocity spread at 35 GHz, with ∼45 dB gain, 37% efficiency, and a bandwidth of 0.3% for a 70 kV, 8.2 A gyrating electron beam. The simulated values of RF output power have been found in agreement with the nonlinear analysis results within ∼5%. Further, the PIC simulation has been extended to study a practical problem of misalignment of the cavities axis and drift tube axis of the gyroklystron amplifier and found that the RF output power is more sensitive to misalignments in comparison to the device bandwidth. The present paper, gyroklystron device design, nonlinear analysis, and 3D PIC simulation using commercially available code had been systematically described would be of use to the high-power gyro-amplifier tube designers and research scientists.

  2. High-Performance Operational and Instrumentation Amplifiers

    OpenAIRE

    Shahi, B.

    2015-01-01

    This thesis describes techniques to reduce the offset error in precision instrumentation and operational amplifiers. The offset error which is considered a major error source associated with gain blocks, together with other errors are reviewed. Conventional and newer approaches to remove offset and low frequency noise are discussed, with a focus on the work of this thesis “Chopper-Stabilized Auto-Zeroed Chopper Instrumentation Amplifiers”. The technique is demonstrated through the application...

  3. Self-amplifying mRNA vaccines.

    Science.gov (United States)

    Brito, Luis A; Kommareddy, Sushma; Maione, Domenico; Uematsu, Yasushi; Giovani, Cinzia; Berlanda Scorza, Francesco; Otten, Gillis R; Yu, Dong; Mandl, Christian W; Mason, Peter W; Dormitzer, Philip R; Ulmer, Jeffrey B; Geall, Andrew J

    2015-01-01

    This chapter provides a brief introduction to nucleic acid-based vaccines and recent research in developing self-amplifying mRNA vaccines. These vaccines promise the flexibility of plasmid DNA vaccines with enhanced immunogenicity and safety. The key to realizing the full potential of these vaccines is efficient delivery of nucleic acid to the cytoplasm of a cell, where it can amplify and express the encoded antigenic protein. The hydrophilicity and strong net negative charge of RNA impedes cellular uptake. To overcome this limitation, electrostatic complexation with cationic lipids or polymers and physical delivery using electroporation or ballistic particles to improve cellular uptake has been evaluated. This chapter highlights the rapid progress made in using nonviral delivery systems for RNA-based vaccines. Initial preclinical testing of self-amplifying mRNA vaccines has shown nonviral delivery to be capable of producing potent and robust innate and adaptive immune responses in small animals and nonhuman primates. Historically, the prospect of developing mRNA vaccines was uncertain due to concerns of mRNA instability and the feasibility of large-scale manufacturing. Today, these issues are no longer perceived as barriers in the widespread implementation of the technology. Currently, nonamplifying mRNA vaccines are under investigation in human clinical trials and can be produced at a sufficient quantity and quality to meet regulatory requirements. If the encouraging preclinical data with self-amplifying mRNA vaccines are matched by equivalently positive immunogenicity, potency, and tolerability in human trials, this platform could establish nucleic acid vaccines as a versatile new tool for human immunization.

  4. Fast Electrocardiogram Amplifier Recovery after Defibrillation Shock

    Directory of Open Access Journals (Sweden)

    Ivan Dotsinsky

    2005-04-01

    Full Text Available A procedure for fast ECG amplifier recovery after defibrillation shocks was developed and simulated in the MATLAB environment. Exponentially decaying post-shock voltages have been recorded. Signals from the AHA database are taken and mixed with the recorded exponential disturbances. The algorithm applies moving averaging (comb filter on the compound input signal, thereby obtaining the samples of the disturbance. They are currently subtracted from the input signal. The results obtained show that its recovery is practically instantaneous.

  5. Amplifying the Hawking Signal in BECs

    Directory of Open Access Journals (Sweden)

    Roberto Balbinot

    2014-01-01

    Full Text Available We consider simple models of Bose-Einstein condensates to study analog pair-creation effects, namely, the Hawking effect from acoustic black holes and the dynamical Casimir effect in rapidly time-dependent backgrounds. We also focus on a proposal by Cornell to amplify the Hawking signal in density-density correlators by reducing the atoms’ interactions shortly before measurements are made.

  6. Electrically Pumped Vertical-Cavity Amplifiers

    DEFF Research Database (Denmark)

    Greibe, Tine

    2007-01-01

    In this work, the design of electrically pumped vertical cavity semiconductor optical amplifiers (eVCAs) for use in a mode-locked external-cavity laser has been developed, investigated and analysed. Four different eVCAs, one top-emitting and three bottom emitting structures, have been designed...... and discussed. The thesis concludes with recommendations for further work towards the realisation of compact electrically pumped mode-locked vertical externalcavity surface emitting lasers....

  7. Transportable setup for amplifier phase fidelity measurements

    OpenAIRE

    Troebs, Michael; Bogan, C.; Barke, S.; Kuehn, G.; Reiche, J.; Heinzel, Gerhard; Danzmann, Karsten

    2015-01-01

    One possible laser source for the Laser Interferometer Space Antenna (LISA) consists of an Ytterbium-doped fiber amplifier originally developed for inter-satellite communication, seeded by the laser used for the technology demonstrator mission LISA Pathfinder. LISA needs to transmit clock information between its three spacecraft to correct for phase noise between the clocks on the individual spacecraft. For this purpose phase modulation sidebands at GHz frequencies will be imprinted on the la...

  8. Short wavelength regenerative amplifier free electron lasers

    OpenAIRE

    Dunning, D J; McNeil, B. W. J.; Thompson, N. R.

    2008-01-01

    In this paper we discuss extending the operating wavelength range of tunable Regenerative Amplifier FELs to shorter wavelengths than current design proposals, notably into the XUV regions of the spectrum and beyond where the reflectivity of broadband optics is very low. Simulation studies are presented which demonstrate the development of good temporal coherence in generic systems with a broadband radiation feedback of less than one part in ten thousand.

  9. Parallel reservoir computing using optical amplifiers.

    Science.gov (United States)

    Vandoorne, Kristof; Dambre, Joni; Verstraeten, David; Schrauwen, Benjamin; Bienstman, Peter

    2011-09-01

    Reservoir computing (RC), a computational paradigm inspired on neural systems, has become increasingly popular in recent years for solving a variety of complex recognition and classification problems. Thus far, most implementations have been software-based, limiting their speed and power efficiency. Integrated photonics offers the potential for a fast, power efficient and massively parallel hardware implementation. We have previously proposed a network of coupled semiconductor optical amplifiers as an interesting test case for such a hardware implementation. In this paper, we investigate the important design parameters and the consequences of process variations through simulations. We use an isolated word recognition task with babble noise to evaluate the performance of the photonic reservoirs with respect to traditional software reservoir implementations, which are based on leaky hyperbolic tangent functions. Our results show that the use of coherent light in a well-tuned reservoir architecture offers significant performance benefits. The most important design parameters are the delay and the phase shift in the system's physical connections. With optimized values for these parameters, coherent semiconductor optical amplifier (SOA) reservoirs can achieve better results than traditional simulated reservoirs. We also show that process variations hardly degrade the performance, but amplifier noise can be detrimental. This effect must therefore be taken into account when designing SOA-based RC implementations.

  10. Charge sensitive amplifies. The state of arts

    Energy Technology Data Exchange (ETDEWEB)

    Mori, Kunishiro [Clear Pulse Co., Tokyo (Japan)

    1996-07-01

    In the radiation detectors, signals are essentially brought with charges produced by radiation, then it is naturally the best way to use a charge sensitive amplifier (CSA) system to extract those signals. The CSA is thought to be the best amplifier suitable to almost all the radiation detectors, if neglecting economical points of view. The CSA has been only applied to special fields like radiation detection because the concept of `charges` is not so universal against the concepts of `voltage` and `current`. The CSA, however, is low in noise and a high speed amplifier and may be applicable not only to radiation measurement but also piezoelectric devices and also bolometers. In this article, noise in the CSA, basic circuit on the CSA, concepts of `equivalent noise charge` (ENC), a method for the ENC, and importance of the `open-loop gain` in the CSA to achieve better performance of it and how to realize in a practical CSA were described. And, characteristics on a counting rate of the CSA, various circuit used in the CSA, and CSAs which are commercially available at present and special purpose CSAs were also introduced. (G.K.)

  11. Microstrip SQUID amplifiers for quantum information science

    Science.gov (United States)

    Defeo, M. P.; Plourde, B. L. T.

    2012-02-01

    Recent progress in SQUID amplifiers suggests that these devices might approach quantum-limited sensitivity in the microwave range, thus making them a viable option for measurement of superconducting quantum systems. In the microstrip SQUID amplifier configuration, gains of around 20dB are possible at frequencies of several hundred MHz, and the gain is limited by the maximum voltage modulation available from the SQUID. One route for increasing the voltage modulation involves using larger resistive shunts, however maintaining non-hysteretic device operation requires smaller junction capacitances than is possible with conventional photolithographically patterned junctions. Operating at higher frequencies requires a shorter input coil which reduces mutual inductance between the coil and washer and therefore gain. We have fabricated microstrip SQUID amplifiers using submicron Al-AlOx-Al junctions and large shunts. The input coil and SQUID washer are optimized for producing high gain at frequencies in the gigahertz range. Recent measurements of gain and noise temperature will be discussed as well as demonstrations of these devices as a first stage of amplification for a superconducting system

  12. Transistor circuit increases range of logarithmic current amplifier

    Science.gov (United States)

    Gilmour, G.

    1966-01-01

    Circuit increases the range of a logarithmic current amplifier by combining a commercially available amplifier with a silicon epitaxial transistor. A temperature compensating network is provided for the transistor.

  13. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  14. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...

  15. The Dynamics of Semiconductor Optical Amplifiers – Modeling and Applications

    DEFF Research Database (Denmark)

    Mørk, Jesper; Nielsen, Mads Lønstrup; Berg, Tommy Winther

    2003-01-01

    The importance of semiconductor optical amplifiers is discussed. A semiconductor optical amplifier (SOA) is a semiconductor laser with anti-reflection coated facets that amplifies an injected light signal by means of stimulated emission. SOAs have a number of unique properties that open up...

  16. Microwave parametric amplifiers using externally pumped Josephson junctions

    DEFF Research Database (Denmark)

    Sørensen, O. H.; Mygind, Jesper; Pedersen, Niels Falsig

    1978-01-01

    Externally pumped parametric amplifiers are discussed. Theory and experiments on the singly degenerate parametric amplifier based on a Josephson junction are presented. Advantages and limitations of the singly degenerate and doubly degenerate parametric amplifiers are discussed. Some plans and pr...... and proposals for future research are presented....

  17. An integrated charge amplifier for a pyroelectric sensor

    NARCIS (Netherlands)

    Setiadi, D.; Armitage, A.; Binnie, T.D.; Regtien, P.P.L.; Sarro, P.M.

    1997-01-01

    This paper presents an integrated charge amplifier that measures a small charge. This charge is generated by a pyroelectric detector. The charge amplifier consists of a single-stage c-annon source configuration with a passive feedback network. The charge amplifier has a bandwidth of 700 kHz and an o

  18. Polarization of Tapered Semiconductor Travelling-Wave Amplifiers

    Institute of Scientific and Technical Information of China (English)

    Huang Dexiu; Li Hong

    2001-01-01

    The polarization of a tapered semi-conductor travelling-wave amplifier has been investigated with the transfer matrix method based on convective equation. It is shown that the apparent polarization mode competition exists, and polarization-independent tapered semiconductor travellingwave amplifiers can be obtained through the optimization of amplifier parameters.

  19. Differential transimpedance amplifier circuit for correlated differential amplification

    Science.gov (United States)

    Gresham, Christopher A.; Denton, M. Bonner; Sperline, Roger P.

    2008-07-22

    A differential transimpedance amplifier circuit for correlated differential amplification. The amplifier circuit increase electronic signal-to-noise ratios in charge detection circuits designed for the detection of very small quantities of electrical charge and/or very weak electromagnetic waves. A differential, integrating capacitive transimpedance amplifier integrated circuit comprising capacitor feedback loops performs time-correlated subtraction of noise.

  20. Dual-pump wave mixing in semiconductor optical amplifiers: performance enhancement with long amplifiers

    Science.gov (United States)

    Tomkos, Ioannis; Zacharopoulos, Ioannis; Syvridis, Dimitrios

    1999-05-01

    We demonstrate experimentally the improvement of the performance of the dual pump wave mixing scheme in semiconductor optical amplifiers, using long amplifier chips and high optical pump powers. The optical amplifiers used in the experiment had a ridge waveguide structure with bulk active layer and antireflective-coated angled facets. Measurements of the conversion efficiency and SBR as a function of wavelength shift are presented for a wavelength shift of more than 40 nm. The above measurements are carried out for three amplifier lengths (500 micrometers , 1000 micrometers , and 1500 micrometers ) and for different levels of the optical power of the two pumps. It will be shown that an increase in the amplifier length from 500 micrometers to 1500 micrometers results to an increase of more than 25 dB for the efficiency and more than 20 dB for the SBR. This improvement combined with the inherent advantages of the dual pump scheme (almost constant SBR and high efficiency for large wavelength shifts) results in a highly performing wavelength converter/phase conjugator, suitable for many applications.

  1. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  2. Increased long-flight activity triggered in beet armyworm by larval feeding on diet containing Cry1Ac protoxin.

    Directory of Open Access Journals (Sweden)

    Xing Fu Jiang

    Full Text Available Evaluating ecological safety and conducting pest risk analysis for transgenic crops are vitally important before their commercial planting. The beet armyworm, Spodoptera exigua, a long-distance migratory insect pest, is not a direct target of transgenic Cry1Ac-expressing cotton in China, but nevertheless it has recently become an important pest. Migrants leaving their natal field arrive in other appropriate habitat far away in a short time, often followed by larval outbreaks. S. exigua has low susceptibility to Cry1Ac. However, our results from laboratory experiments identified (i sublethal effects of Cry1Ac protoxin on larval development rate, larval and pupal weight, and adult lifetime fecundity, and (ii increased long-flight behavior triggered by Cry1Ac which may contribute to larval outbreaks elsewhere. No significant differences in larval mortality, pupation rate, adult emergence rate, longevity, pre-oviposition period, or oviposition period were observed between controls and larvae fed on artificial diet incorporating a low concentration of Cry1Ac protoxin. The negative sublethal effects on some developmental and reproductive traits and lack of effect on others suggest they do not contribute to the observed severity of S. exigua outbreaks after feeding on Cry1Ac cotton. Interestingly, the percentage of long fliers increased significantly when larvae were reared on diet containing either of two low-dose treatments of Cry1Ac, suggesting a possible increased propensity to disperse long distances triggered by Cry1Ac. We hypothesize that negative effects on development and reproduction caused by Cry1Ac in the diet are offset by increased flight propensity triggered by the poor food conditions, thereby improving the chances of escaping adverse local conditions before oviposition. Increased long-flight propensity in turn may amplify the area damaged by outbreak populations. This phenomenon might be common in other migratory insect pests receiving

  3. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  4. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  5. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  6. Enhanced propagation of photon density waves in random amplifying media

    CERN Document Server

    Renthlei, Lalruatfela; Ramakrishna, S A

    2013-01-01

    We demonstrate enhanced wave-like character of diffuse photon density waves (DPDW) in an amplifying random medium. The amplifying nature makes it contingent to choose the wave solution that grows inside the amplifying medium, and has a propagation vector pointing opposite to the growth direction. This results in negative refraction of the DPDW at an absorbing-amplifying random medium interface as well as the possibility of supporting "anti"-surface-like modes at the interface. A slab of amplifying random medium sandwiched between two absorbing random media supports waveguide resonances that can be utilized to extend the imaging capabilities of DPDW.

  7. Enhanced propagation of photon density waves in random amplifying media

    Science.gov (United States)

    Renthlei, Lalruatfela; Wanare, Harshawardhan; Ramakrishna, S. Anantha

    2015-04-01

    We demonstrate enhanced wavelike character of diffuse photon density waves (DPDW) in an amplifying random medium. The amplifying nature makes it necessary to choose the wave solution that grows inside the amplifying medium, and has a propagation vector pointing opposite to the growth direction. This results in negative refraction of the DPDW at an absorbing-amplifying random medium interface as well as the possibility of supporting "anti"-surface-like modes at the interface. A slab of an amplifying random medium sandwiched between two absorbing random media supports waveguide resonances that can be utilized to extend the imaging capabilities of DPDW.

  8. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  9. Time amplifying techniques towards atomic time resolution

    Institute of Scientific and Technical Information of China (English)

    LI JingZhen

    2009-01-01

    High speed imaging technology has opened applications in many fields,such as collision,detonating,high voltage discharge,disintegration and transfer of phonon and exciton in solid,photosynthesis primitive reaction,and electron dynamics inside atom shell.In principle,all of the transient processes need to be explained theoretically and,st the same time,the time amplifying technique is required for observations of these processes.The present review concerns the atomic time amplifying mechanism of optical information and the extremely-high speed imaging methods,which are expressed in terms of the short time amplifying techniques.It is well-known that for extremely-high speed imaging with the converter tube,the temporal resolution is in the order of sub-picosecond of the streak imaging,and the imaging frequency is 6×10~8-5×10~9 fps(frame per second)of the frame imaging.On the other hand,for the tubeless extremely-high speed imaging,the imaging frequency is 10~7-10~(14) fps,and its mechanism of forming high speed and framing could involve a lot of factors of the light under investigation,for instance,light speed,light parallelism,the parameters of light wave such as amplitude,phase,polarization and wavelength,and even quantum properties of photon.In the cascaded system of electromagnetic wave and particle wave,it is possible to simultaneously realize extremely-high resolution in time and space,which is higher than a kite resolution.Then it would be possible to break the limit of the Heisenberg uncertainty relation of the optical frequency band.

  10. Time amplifying techniques towards atomic time resolution

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    High speed imaging technology has opened applications in many fields,such as collision,detonating, high voltage discharge,disintegration and transfer of phonon and exciton in solid,photosynthesis primitive reaction,and electron dynamics inside atom shell.In principle,all of the transient processes need to be explained theoretically and,at the same time,the time amplifying technique is required for observations of these processes.The present review concerns the atomic time amplifying mechanism of optical information and the extremely-high speed imaging methods,which are expressed in terms of the short time amplifying techniques.It is well-known that for extremely-high speed imaging with the converter tube,the temporal resolution is in the order of sub-picosecond of the streak imaging,and the imaging frequency is 6×10 8 ―5×10 9 fps(frame per second)of the frame imaging.On the other hand,for the tubeless extremely-high speed imaging,the imaging frequency is 10 7 ―10 14 fps,and its mechanism of forming high speed and framing could involve a lot of factors of the light under investigation,for instance,light speed,light parallelism,the parameters of light wave such as amplitude,phase,polari- zation and wavelength,and even quantum properties of photon.In the cascaded system of electro- magnetic wave and particle wave,it is possible to simultaneously realize extremely-high resolution in time and space,which is higher than a kite resolution.Then it would be possible to break the limit of the Heisenberg uncertainty relation of the optical frequency band.

  11. Contributions to the development of microwave active circuits: metamaterial dual-band active filters and broadband differential low-noise amplifier

    OpenAIRE

    García Pérez, Óscar Alberto

    2011-01-01

    New telecommunication systems require electronic components with increasing performance. Microwave active circuits are not an exception. In fact, these active devices (such as amplifiers, active filters, oscillators, mixers, switches, modulators, etc.) are a key part of any modern communication device and, in many cases, the components that greatly limit the overall system performance. During the last decades, engineers have been improving the performance and operation capabilities of such ac...

  12. Investigations of electronic amplifiers supplying a piezobimorph actuator

    Science.gov (United States)

    Milecki, Andrzej; Regulski, Roman

    2016-10-01

    Piezoelectric bending actuators, also known as bimorphs, are characterized by very good dynamic properties and by displacements in a range of a few millimeters. Therefore these actuators are used in a wide range of applications. However their usage is limited because they require supplying amplifiers with output voltage of about 200 V, which are rather expensive. This paper presents investigation results of such amplifiers with high voltage output. The model of a piezobending actuator is proposed and implemented in Matlab-Simulink software in order to simulate the behavior of the actuator supplied by the amplifiers. The simulation results are presented and compared with investigation results of high voltage amplifier used for supplying a piezoactuator. The influence of current limitation of operational amplifier on the actuator current is tested. Finally, a low cost audio power amplifier is proposed to control the piezobender actuator (as a cheaper alternative to the high-voltage amplifier) and its investigations results are presented in the paper.

  13. Low power RF amplifier circuit for ion trap applications

    Science.gov (United States)

    Noriega, J. R.; García-Delgado, L. A.; Gómez-Fuentes, R.; García-Juárez, A.

    2016-09-01

    A low power RF amplifier circuit for ion trap applications is presented and described. The amplifier is based on a class-D half-bridge amplifier with a voltage mirror driver. The RF amplifier is composed of an RF class-D amplifier, an envelope modulator to ramp up the RF voltage during the ion analysis stage, a detector or amplitude demodulation circuit for sensing the output signal amplitude, and a feedback amplifier that linearizes the steady state output of the amplifier. The RF frequency is set by a crystal oscillator and the series resonant circuit is tuned to the oscillator frequency. The resonant circuit components have been chosen, in this case, to operate at 1 MHz. In testings, the class-D stage operated at a maximum of 78 mW at 1.1356 MHz producing 225 V peak.

  14. Gain flattened distributed fiber raman amplifiers

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    An S band and a C band distributed fiber Raman amplifiers (DFRAs) with flattened gain and compensated dispersion have been studied and implemented with 1 427 nm and 1 455 nm mono-wavelength fiber Raman lasers as the pumped sources respectively. The gain of single-wave pumped S band and C band can reach 10 dB and 15 dB respectively. And a 50 nm gain flattened width was successfully obtained by using a chirp fiber Bragg grating (CFBG) gain flattened filter with gain ripple of 0.6 dB. The C band DFRA has been applied to CDMA wireless communication system successfully.

  15. Feedback analysis of transimpedance operational amplifier circuits

    OpenAIRE

    Bruun, Erik

    1993-01-01

    The transimpedance or current feedback operational amplifier (CFB op-amp) is reviewed and compared to a conventional voltage mode op-amp using an analysis emphasizing the basic feedback characteristics of the circuit. With this approach the paradox of the constant bandwidth obtained from CFB op-amps is explained. It is demonstrated in a simple manner that the constant gain-bandwidth product of the conventional op-amp and the constant bandwidth of the CFB op-amp are both in accordance with bas...

  16. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  17. A cryo-amplifier working in a double loop-flux locked loop scheme for SQUID readout of TES detectors

    Science.gov (United States)

    Torrioli, Guido; Bastia, Paolo; Piro, Luigi; Macculi, Claudio; Colasanti, Luca

    2010-07-01

    In this paper we report on a novel SQUID readout scheme, called Double Loop-Flux Locked loop (DL-FLL), that we are investigating in the frame of ASI and ESA technological development contracts. This scheme is based on the realization of a cryogenic amplifier which is used in order to readout TES detectors in the Frequency Division Multiplexing technique, where high loop-gain is required up to few MHz. Loop-gain in feedback systems is, usually, limited by the propagation delay of the signals traveling in the loop because of the distance between the feedback loop elements. This problem is particularly evident in the case of SQUID systems, where the elements of the feedback loop are placed both at cryogenic and room temperature. To solve this issue we propose a low power dissipation cryo-amplifier capable to work at cryogenic temperatures so that it can be placed close to the SQUID realizing a local cryogenic loop. The adoption of the DL-FLL scheme allows to simplify considerably the cryo-amplifier which, being AC-coupled, don't require the features of a precision DC-coupled amplifier and can be made with a limited number of electronic components and with a consequent reduction of power dissipation.

  18. Design criteria for ultrafast optical parametric amplifiers

    Science.gov (United States)

    Manzoni, C.; Cerullo, G.

    2016-10-01

    Optical parametric amplifiers (OPAs) exploit second-order nonlinearity to transfer energy from a fixed frequency pump pulse to a variable frequency signal pulse, and represent an easy way of tuning over a broad range the frequency of an otherwise fixed femtosecond laser system. OPAs can also act as broadband amplifiers, transferring energy from a narrowband pump to a broadband signal and thus considerably shortening the duration of the pump pulse. Due to these unique properties, OPAs are nowadays ubiquitous in ultrafast laser laboratories, and are employed by many users, such as solid state physicists, atomic/molecular physicists, chemists and biologists, who are not experts in ultrafast optics. This tutorial paper aims at providing the non-specialist reader with a self-consistent guide to the physical foundations of OPAs, deriving the main equations describing their performance and discussing how they can be used to understand their most important working parameters (frequency tunability, bandwidth, pulse energy/repetition rate scalability, control over the carrier-envelope phase of the generated pulses). Based on this analysis, we derive practical design criteria for OPAs, showing how their performance depends on the type of the nonlinear interaction (crystal type, phase-matching configuration, crystal length), on the characteristics of the pump pulse (frequency, duration, energy, repetition rate) and on the OPA architecture.

  19. Hot prospect for new gene amplifier

    Energy Technology Data Exchange (ETDEWEB)

    1991-11-29

    Molecular biologist Francis Barany is investigating one of the hottest areas in biotechnology: a gene-amplification technique called ligase chain reaction, or LCR. Already scientists have used LCR to detect the tiny mutation that causes sickle cell anemia and have adapted it to screen for a handful of other genetic diseases simultaneously - in a single test-tube. Some experts, in fact, are predicting that LCR will supplement the polymerase chain reaction (PCR), and in some cases even supplant it. LCR could revolutionize DNA diagnostics just as PCR transformed basic molecular biology following its introduction 6 years ago. With its ease of automation and ability to produce useful quantitative results, LCR could become a major player in the rapidly growing market for DNA diagnostics. LCR, like PCR, uses snippets of nucleic acid, or oligonucleotides, that anneal to a specific, complementary sequence on the target DNA to be amplified. But where PCR uses oligos that bracket the stretch to be amplified, LCR uses pairs of oligos that completely cover the target sequence.

  20. Backward Raman Amplifier for Laser Wakefield Accelerator

    Science.gov (United States)

    Ludwig, Joshua; Masson-Laborde, Paul-Edouard; Huller, Stefan; Rozmus, Wojciech; Wilks, Scott C.

    2016-10-01

    Particle in cell simulations via SCPIC and theoretical work on Raman amplification and laser wake field acceleration will be presented. Laser energy depletion has been shown to be a limiting factor during wake field acceleration. This work focuses on optimizing parameters for Raman amplification to work in conjunction with wake field acceleration in order in order to sustain an accelerating laser pulse as it generates plasma waves. It has been shown that laser pulses undergo red shifting during wake generation. Our work demonstrates that this red shifting results in a detuning between pump and seed in the backward Raman Amplifier. This detuning limits the amount of energy that can be transferred from the pump to the seed, and places new limits on backward Raman amplification. To overcome this limiting factor, this study makes use of a chirped pump allowing for extended coupling to the accelerating pulse. Three wave coupling model of Raman amplifier with a frequency shift term due to wake field will also be discussed and compared with PIC simulations.

  1. Amplified Fiber-Loop Ringdown Spectroscopy

    Science.gov (United States)

    Litman, Jessica; Barnes, Jack; Loock, Hans-Peter

    2009-06-01

    Many commercial liquid chemical analysis systems, such as high-performance liquid chromatography (HPLC) or capillary electrophoresis consist of a separation followed by optical detection. Besides small volumes and low detection limits, the system should also allow the detection of a large variety of analytes. Existing absorption and fluorescence detectors are often not very sensitive or require labelling. Here, an absorption detector is presented based on cavity ring-down spectroscopy (CRDS) where the optical cavity is made from fibre optic waveguides and the light source is a continuous wave (cw) diode laser. The purpose of this project is to increase the detection of analytes through their overtone absorption in the telecom region at 1300 to 1500 nm. This is done by increasing the ratio of desired loss (extinction caused by the sample), to undesirable loss (due to the waveguides or solvents) through amplification of the ringdown signal using a gain-clamped erbium doped fibre amplifier (EDFA). The amplified cavity has a round-trip time of 750 ns and we achieved a detection limit of at most 250 ppm when measuring acetylene at 1532.83 nm. The application of our method to detection of dissolved analytes or particles in liquids will be discussed.

  2. Development of 3 kW at 325 MHz solid-state RF power amplifier using four power amplifier modules

    Science.gov (United States)

    Ramarao, B. V.; Sonal, S.; Mishra, J. K.; Pande, M.; Singh, P.; Kumar, G.; Mukherjee, J.

    2014-01-01

    A high power solid-state RF power amplifier of 3 kW at 325 MHz has been developed using only four RF power amplifier modules of 850 W power output each. The design and characterization of RF power modules have been presented. A four way Wilkinson power combiner adds the output of four power amplifier modules with a total transmission loss of less than 6%. The combined power amplifier has a power gain of 20.2 dB at 1-dB compression point, and the corresponding output power is 2.8 kW at 325 MHz. The drain efficiency of the power amplifier is 65.3% at 3 kW. All the harmonics of this amplifier are below -40 dBc. The amplifier has better characteristics like fewer numbers of active devices per kilo watt, high efficiency, high gain, and ruggedness etc for RF accelerator applications.

  3. Power amplifiers in CMOS technology : a contribution to power amplifier theory and techniques

    NARCIS (Netherlands)

    Acar, Mustafa

    2011-01-01

    In order to meet the demands from the market on cheaper, miniaturized mobile communications devices realization of RF power amplifiers(PAs) in the mainstream CMOS technology is essential. In general, CMOS PAs require high supply-voltage to decrease the matching network losses and for high output pow

  4. Electromechanical and Dynamic Characterization of In-House-Fabricated Amplified Piezo Actuator

    Directory of Open Access Journals (Sweden)

    P. K. Panda

    2012-01-01

    Full Text Available A diamond-shaped amplified piezo actuator (APA fabricated using six multilayered piezo stacks with maximum displacement of 173 μm at 175 V and the amplification factor of 4.3. The dynamic characterization of the actuator was carried out at different frequencies (100 Hz–1 kHz and at different AC voltages (20 V–40 V. The actuator response over this frequency range was found neat, without attenuation of the signal. Numerical modeling of multilayered stack actuator was carried out using empirical equations, and the electromechanical analysis was carried out using ABAQUS software. The block force of the APA was 81 N, calculated by electromechanical analysis. This is similar to that calculated by dynamic characterization method.

  5. Gender Differences on the Use of Amplifiers in Academic Writings

    Institute of Scientific and Technical Information of China (English)

    申利芬

    2012-01-01

      This study aims to investigate the use of amplifiers in term of gender and disciplinary groups in academic research arti⁃cles, which is based on the British Academic Written English Corpus (BAWE).18 amplifiers were examined across two dimen⁃sions:gender and disciplinary groups. The results show amplifiers are more common in males’ academic writings than in those of females in general, amplifiers are used more often in AH discipline. However, not all amplifiers show significant gender differ⁃ences between men and women. Six words show a significant difference between male and female writers:pretty, by far, perfect⁃ly, quite, a great deal, totally, which are used more often by males. However, the interesting is in LS discipline, most amplifiers are used more often by female than male writers and males tend to use by far more frequently than females.

  6. Multiple Differential-Amplifier MMICs Embedded in Waveguides

    Science.gov (United States)

    Kangaslahti, Pekka; Schlecht, Erich

    2010-01-01

    Compact amplifier assemblies of a type now being developed for operation at frequencies of hundreds of gigahertz comprise multiple amplifier units in parallel arrangements to increase power and/or cascade arrangements to increase gains. Each amplifier unit is a monolithic microwave integrated circuit (MMIC) implementation of a pair of amplifiers in differential (in contradistinction to single-ended) configuration. Heretofore, in cascading amplifiers to increase gain, it has been common practice to interconnect the amplifiers by use of wires and/or thin films on substrates. This practice has not yielded satisfactory results at frequencies greater than 200 Hz, in each case, for either or both of two reasons: Wire bonds introduce large discontinuities. Because the interconnections are typically tens of wavelengths long, any impedance mismatches give rise to ripples in the gain-vs.-frequency response, which degrade the performance of the cascade.

  7. ANALYSIS OF INTERNALLY GENERATED NOISE OF BIOELECTRIC AMPLIFIERS

    Institute of Scientific and Technical Information of China (English)

    Mashhour Mustafa; Bani Amer

    2003-01-01

    This paper deals with internally generated noise of bioelectric amplifiers that are usually used for processing of bioelectric events. The main purpose of this paper is to present a procedure for analysis of the effects of internal noise generated by the active circuits and to evaluate the output noise of the author's new designed bioelectric amplifier that caused by internal effects to the amplifier circuit itself in order to compare it with the noise generated by conventional amplifiers. The obtained analysis results of internally generated noise showed that the total output noise of bioelectric active circuits does not increase when some of their resistors have a larger value. This behavior is caused by the different transfer functions for the signal and the respective noise sources associated with these resistors. Moreover, the new designed bioelectric amplifier has an output noise less than that for conventional amplifiers. The obtained analysis results were also experimentally verified and the final conclusions were drawn.

  8. Low-noise amplifiers for satellite communications

    Science.gov (United States)

    Whelehan, J.

    1984-02-01

    It is pointed out that over the past several years significant advances have been made in the overall capability of both microwave and mm-wave receivers. This is particularly apparent in the telecom market. Integral parts of advanced receiver technology are low-noise receivers. The advances currently being achieved in low-noise technology are partly based on developments in GaAs semiconductor technology. The development of high-cutoff-frequency beam lead mixer diodes has led to the development of mm-wave low-noise mixers with excellent low-noise capability. The advanced techniques are now being employed in field-deployable systems. Low noise is an important factor in satellite communications applications. Attention is given to C-band fixed satellite service, C-band parametric amplifiers, C-band FET, and X band, the Ku band, and the 30/20 GHz band.

  9. Current feedback operational amplifiers and their applications

    CERN Document Server

    Senani, Raj; Singh, A K; Singh, V K

    2013-01-01

    This book describes a variety of current feedback operational amplifier (CFOA) architectures and their applications in analog signal processing/generation. Coverage includes a comprehensive survey of commercially available, off-the-shelf integrated circuit CFOAs, as well as recent advances made on the design of CFOAs, including design innovations for bipolar and CMOS CFOAs.  This book serves as a single-source reference to the topic, as well as a catalog of over 200 application circuits which would be useful not only for students, educators and researchers in apprising them about the recent developments in the area but would also serve as a comprehensive repertoire of useful circuits for practicing engineers who might be interested in choosing an appropriate CFOA-based topology for use in a given application.

  10. Stochastic phenomena in a fiber Raman amplifier

    CERN Document Server

    Kalashnikov, Vladimir; Ania-Castanón, Juan Diego; Jacobsen, Gunnar; Popov, Sergei

    2016-01-01

    The interplay of such cornerstones of modern nonlinear fiber optics as a nonlinearity, stochasticity and polarization leads to variety of the noise induced instabilities including polarization attraction and escape phenomena harnessing of which is a key to unlocking the fiber optic systems specifications required in high resolution spectroscopy, metrology, biomedicine and telecommunications. Here, by using direct stochastic modeling, the mapping of interplay of the Raman scattering-based nonlinearity, the random birefringence of a fiber, and the pump-to-signal intensity noise transfer has been done in terms of the fiber Raman amplifier parameters, namely polarization mode dispersion, the relative intensity noise of the pump laser, fiber length, and the signal power. The obtained results reveal conditions for emergence of the random birefringence-induced resonance-like enhancement of the gain fluctuations (stochastic anti-resonance) accompanied by pulse broadening and rare events in the form of low power outpu...

  11. Gain Characteristics of Fiber Optical Parametric Amplifier

    Institute of Scientific and Technical Information of China (English)

    高明义; 姜淳; 胡卫生

    2004-01-01

    The theory model of fiber optical parametric amplifier (FOPA) was introduced, which is based on optical nonlinear effect. And then numerical simulation was done to analyze and discuss the gain spectral characteristics of one-pump and two-pump FOPA. The results show that for one-pump FOPA, when pump wavelength is near to fiber zero-dispersion wavelength(ZDW), the gain flatness is better, and with the increase of the pump power, fiber length and its nonlinear coefficient, the gain value will increase while the gain bandwidth will become narrow. For two-pump FOPA, when the pump central wavelength is near to fiber ZDW, the gain flatness is better. Moreover, by decreasing the space of two pumps wavelength, the gain flatness can be improved. Finally, some problems existing in FOPA were addressed.

  12. Modeling and design techniques for RF power amplifiers

    CERN Document Server

    Raghavan, Arvind; Laskar, Joy

    2008-01-01

    The book covers RF power amplifier design, from device and modeling considerations to advanced circuit design architectures and techniques. It focuses on recent developments and advanced topics in this area, including numerous practical designs to back the theoretical considerations. It presents the challenges in designing power amplifiers in silicon and helps the reader improve the efficiency of linear power amplifiers, and design more accurate compact device models, with faster extraction routines, to create cost effective and reliable circuits.

  13. InP Heterojunction Bipolar Transistor Amplifiers to 255 GHz

    Science.gov (United States)

    Radisic, Vesna; Sawdai, Donald; Scott, Dennis; Deal, William; Dang, Linh; Li, Danny; Cavus, Abdullah; To, Richard; Lai, Richard

    2009-01-01

    Two single-stage InP heterojunction bipolar transistor (HBT) amplifiers operate at 184 and 255 GHz, using Northrop Grumman Corporation s InP HBT MMIC (monolithic microwave integrated circuit) technology. At the time of this reporting, these are reported to be the highest HBT amplifiers ever created. The purpose of the amplifier design is to evaluate the technology capability for high-frequency designs and verify the model for future development work.

  14. Numerical Analysis of Modal Instability Onset in Fiber Amplifiers

    Science.gov (United States)

    2014-03-11

    Evolution of the logarithmic frequency spectrum of the off-center optical intensity probe along the length of the co-pumped amplifier for the case of...Evolution of the logarithmic frequency spectrum of the off-center optical intensity probe along the length of the counter-pumped amplifier for the...ABSTRACT 16. SECURITY CLASSIFICATION OF: Numerical analysis of the onset of modal instability in fiber amplifiers is presented. Specifically calculations

  15. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  16. Dual Band High Efficiency Power Amplifier Based on CRLH Lines

    Directory of Open Access Journals (Sweden)

    D. Segovia-Vargas

    2009-12-01

    Full Text Available In this paper we propose the use of Composite Right/Left Hand (CRLH and Extended Composite Right/Left Hand (ECRLH transmission lines for the design of dual band high efficiency power amplifiers working in CE class. The harmonic termination can be synthesized using the meta-lines is particularly suitable for CE class amplifiers, which have a termination not as sensitive to the third harmonic as F class amplifier. This paper presents the design procedure and the design equations. The nonlinear phase response of a CRLH and ECRLH transmission line has been utilized to design arbitrary dual-band amplifiers.

  17. Nylon Sleeve for Cavity Amplifier Holds Tuning Despite Heat

    Science.gov (United States)

    Derr, Lloyd

    1964-01-01

    The problem: Detuning of cavity amplifiers with change in temperature. This results in deterioration of the performance of the amplifier at its design frequency. In cavity amplifiers and filters it is desirable that constant performance be maintained regardless of thermal changes. These changes often cause an "off resonance shift" in a cavity filter and a deterioration of performance in a cavity amplifier. The solution: Mount the tuning probe in a nylon sleeve. Thermal expansion and contraction of the nylon nullifies unwanted capacitive and inductive changes in the resonant elements.

  18. Modeling a Common-Source Amplifier Using a Ferroelectric Transistor

    Science.gov (United States)

    Sayyah, Rana; Hunt, Mitchell; MacLeond, Todd C.; Ho, Fat D.

    2010-01-01

    This paper presents a mathematical model characterizing the behavior of a common-source amplifier using a FeFET. The model is based on empirical data and incorporates several variables that affect the output, including frequency, load resistance, and gate-to-source voltage. Since the common-source amplifier is the most widely used amplifier in MOS technology, understanding and modeling the behavior of the FeFET-based common-source amplifier will help in the integration of FeFETs into many circuits.

  19. Controlling the dynamic range of a Josephson parametric amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, Christopher; Wallraff, Andreas [ETH Zuerich, Department of Physics, Zuerich (Switzerland)

    2014-12-01

    One of the central challenges in the development of parametric amplifiers is the control of the dynamic range relative to its gain and bandwidth, which typically limits quantum limited amplification to signals which contain only a few photons per inverse bandwidth. Here, we discuss the control of the dynamic range of Josephson parametric amplifiers by using Josephson junction arrays. We discuss gain, bandwidth, noise, and dynamic range properties of both a transmission line and a lumped element based parametric amplifier. Based on these investigations we derive useful design criteria, which may find broad application in the development of practical parametric amplifiers. (orig.)

  20. Pulse-distortion in a quantum-dot optical amplifier

    DEFF Research Database (Denmark)

    Romstad, Francis Pascal; Borri, Paola; Mørk, Jesper;

    2000-01-01

    Distortion of a -150fs optical pulse after propagation through an InAs/InGaAs quantum-dot optical amplifier is measured for different input energies an bias currents. Pulse distortion is observed and compared with results on a bulk amplifier.......Distortion of a -150fs optical pulse after propagation through an InAs/InGaAs quantum-dot optical amplifier is measured for different input energies an bias currents. Pulse distortion is observed and compared with results on a bulk amplifier....

  1. Combination ring cavity and backward Raman waveguide amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Kurnit, N.A.

    1981-03-13

    A combination regenerative ring and backward Raman waveguide amplifier and a combination regenerative ring oscillator and backward Raman waveguide amplifier which produce Raman amplification, pulse compression, and efficient energy extraction from the CO/sub 2/ laser pump signal for conversion into a Stokes radiation signal. The ring cavity configuration allows the CO/sub 2/ laser pump signal and Stokes signal to copropagate through the Raman waveguide amplifier. The backward Raman waveguide amplifier configuration extracts a major portion of the remaining energy from the CO/sub 2/ laser pump signal for conversion to Stokes radiation.

  2. Parametric Amplifiers for Microwave Kinectic Inductance Detector (MKID) Readout Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Find numerical solutions to the non-linear partial differential equations describing our amplifier transmission lines. Optimize periodic choke structure to block...

  3. Recovery of slow potentials in AC-coupled electrocorticography: application to spreading depolarizations in rat and human cerebral cortex.

    Science.gov (United States)

    Hartings, Jed A; Watanabe, Tomas; Dreier, Jens P; Major, Sebastian; Vendelbo, Leif; Fabricius, Martin

    2009-10-01

    Cortical spreading depolarizations (spreading depressions and peri-infarct depolarizations) are a pathology intrinsic to acute brain injury, generating large negative extracellular slow potential changes (SPCs) that, lasting on the order of minutes, are studied with DC-coupled recordings in animals. The spreading SPCs of depolarization waves are observed in human cortex with AC-coupled electrocorticography (ECoG), although SPC morphology is distorted by the high-pass filter stage of the amplifiers. Here, we present a signal processing method to reverse these distortions and recover approximate full-band waveforms from AC-coupled recordings. We constructed digital filters that reproduced the phase and amplitude distortions introduced by specific AC-coupled amplifiers and, based on this characterization, derived digital inverse filters to remove these distortions from ECoG recordings. Performance of the inverse filter was validated by its ability to recover both simulated and real low-frequency input test signals. The inverse filter was then applied to AC-coupled ECoG recordings from five patients who underwent invasive monitoring after aneurysmal subarachnoid hemorrhage. For 117 SPCs, the inverse filter recovered full-band waveforms with morphologic characteristics typical of the negative DC shifts recorded in animals. Compared with those recorded in the rat cortex with the same analog and digital methods, the negative DC shifts of human depolarizations had significantly greater durations (1:47 vs. 0:45 min:sec) and peak-to-peak amplitudes (10.1 vs. 4.2 mV). The inverse filter thus permits the study of spreading depolarizations in humans, using the same assessment of full-band DC potentials as that in animals, and suggests a particular solution for recovery of biosignals recorded with frequency-limited amplifiers.

  4. Modeling and analysis of overmodulation in erbium-doped fiber amplifiers including amplified spontaneous emission

    Science.gov (United States)

    Sharma, Reena; Raghuwanshi, Sanjeev Kumar

    2017-02-01

    Line surveillance and management information in erbium-doped fiber amplifiers (EDFAs) can be broadcast by modulating the amplitude of the low-frequency lightwave information signal, the process termed as overmodulation in the literature. This paper presents systematic solutions for the overmodulated pump and information signal transfer functions for EDFA. It includes amplified spontaneous emission (ASE) that has an impact on outcomes in the high-gain system. To the extent of our belief, the methodical model simulated with the current approach leads to a distinct perspective of an outcome in the respective field. The test bed described here is realistic. It specifically represents the overmodulation behavior in an EDFA under the influence of ASE.

  5. Optimal Relay Power Allocation for Amplify-and-Forward Relay Networks with Non-linear Power Amplifiers

    OpenAIRE

    Zhang, Chao; Ren, Pinyi; Peng, Jingbo; Wei, Guo; Du, Qinghe; Wang, Yichen

    2011-01-01

    In this paper, we propose an optimal relay power allocation of an Amplify-and-Forward relay networks with non-linear power amplifiers. Based on Bussgang Linearization Theory, we depict the non-linear amplifying process into a linear system, which lets analyzing system performance easier. To obtain spatial diversity, we design a complete practical framework of a non-linear distortion aware receiver. Consider a total relay power constraint, we propose an optimal power allocation scheme to maxim...

  6. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  7. Wideband high efficiency CMOS envelope amplifiers for 4G LTE handset envelope tracking RF power amplifiers

    OpenAIRE

    Hassan, Muhammad

    2012-01-01

    Fourth generation cellular networks offer performance similar to cable modems while allowing wide mobility. Although the use of orthogonal frequency division multiplexing in fourth generation increases its spectral efficiency but it also increases the peak-to-average power ratio of the transmitted signal. If a conventional power amplifier is used to transmit a high peak-to-average power ratio signal, then to meet the stringent linearity requirements, it will be operating 6 to 10 dB back-off f...

  8. The first complete genome sequences of the acI lineage, the most abundant freshwater Actinobacteria, obtained by whole-genome-amplification of dilution-to-extinction cultures

    Science.gov (United States)

    Kang, Ilnam; Kim, Suhyun; Islam, Md. Rashedul; Cho, Jang-Cheon

    2017-01-01

    The acI lineage of the phylum Actinobacteria is the most abundant bacterial group in most freshwater lakes. However, due to difficulties in laboratory cultivation, only two mixed cultures and some incomplete single-amplified or metagenome-derived genomes have been reported for the lineage. Here, we report the initial cultivation and complete genome sequences of four novel strains of the acI lineage from the tribes acI-A1, -A4, -A7, and -C1. The acI strains, initially isolated by dilution-to-extinction culturing, eventually failed to be maintained as axenic cultures. However, the first complete genomes of the acI lineage were successfully obtained from these initial cultures through whole genome amplification applied to more than hundreds of cultured acI cells. The genome sequences exhibited features of genome streamlining and showed that the strains are aerobic chemoheterotrophs sharing central metabolic pathways, with some differences among tribes that may underlie niche diversification within the acI lineage. Actinorhodopsin was found in all strains, but retinal biosynthesis was complete in only A1 and A4 tribes. PMID:28186143

  9. AC Read-Out Circuits for Single Pixel Characterization of TES Microcalorimeters and Bolometers

    Science.gov (United States)

    Gottardi, L.; van de Kuur, J.; Bandler, S.; Bruijn, M.; de Korte, P.; Gao, J. R.; den Hartog, R.; Hijmering, R. A.; Hoevers, H.; Koshropanah, P.; Kilbourne, C.; Lindemann, M. A.; Parra Borderias, M.; Ridder, M.

    2011-01-01

    SRON is developing Frequency Domain Multiplexing (FDM) for the read-out of transition edge sensor (TES) soft x-ray microcalorimeters for the XMS instrument of the International X-ray Observatory and far-infrared bolometers for the SAFARI instrument on the Japanese mission SPICA. In FDM the TESs are AC voltage biased at frequencies from 0.5 to 6 MHz in a superconducting LC resonant circuit and the signal is read-out by low noise and high dynamic range SQUIDs amplifiers. The TES works as an amplitude modulator. We report on several AC bias experiments performed on different detectors. In particular, we discuss the results on the characterization of Goddard Space Flight Center x-ray pixels and SRON bolometers. The paper focuses on the analysis of different read-out configurations developed to optimize the noise and the impedance matching between the detectors and the SQUID amplifier. A novel feedback network electronics has been developed to keep the SQUID in flux locked loop, when coupled to superconducting high Q circuits, and to optimally tune the resonant bias circuit. The achieved detector performances are discussed in view of the instrument requirement for the two space missions.

  10. Development of 3 kW at 325 MHz solid-state RF power amplifier using four power amplifier modules

    Energy Technology Data Exchange (ETDEWEB)

    Ramarao, B.V., E-mail: bvram@barc.gov.in [Ion Accelerator Development Division, Bhabha Atomic Research Center, Mumbai 400085 (India); Sonal, S.; Mishra, J.K.; Pande, M.; Singh, P. [Ion Accelerator Development Division, Bhabha Atomic Research Center, Mumbai 400085 (India); Kumar, G.; Mukherjee, J. [Indian Institute of Technology, Powai, Mumbai 400076 (India)

    2014-01-21

    A high power solid-state RF power amplifier of 3 kW at 325 MHz has been developed using only four RF power amplifier modules of 850 W power output each. The design and characterization of RF power modules have been presented. A four way Wilkinson power combiner adds the output of four power amplifier modules with a total transmission loss of less than 6%. The combined power amplifier has a power gain of 20.2 dB at 1-dB compression point, and the corresponding output power is 2.8 kW at 325 MHz. The drain efficiency of the power amplifier is 65.3% at 3 kW. All the harmonics of this amplifier are below −40 dBc. The amplifier has better characteristics like fewer numbers of active devices per kilo watt, high efficiency, high gain, and ruggedness etc for RF accelerator applications. -- Highlights: • High gain power amplifier, power gain at 20 dB. • High efficiency amplifier, efficiency >65%. • Minimum number of modules per kilo watt power output. • Heat sink with modules on both side, high density.

  11. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  12. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  13. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  14. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  15. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  16. Gain characteristics of a saturated fiber optic parametric amplifier

    DEFF Research Database (Denmark)

    Rottwitt, Karsten; Lorenzen, Michael Rodas; Noordegraaf, Danny

    2008-01-01

    In this work we discuss saturation performance of a fiber optic parametric amplifier. A simple numerical model is described and applied to specific cases. A system experiment using a saturated amplifier illustrates a 4 dB improvement in required signal to noise ratio for a fixed bit error ratio....

  17. Optically amplifying planar glass waveguides: Laser on a chip

    DEFF Research Database (Denmark)

    Guldberg-Kjær, Søren Andreas

    The objective of this work was to devlop optically amplifying planar wavguides, using erbium-doped germano-silicate glass films deposited by PECVD (Plasma Enhanced Chemical Vapour Deposition). The waveguides should exhibit enough gain to be useful as optical amplifiers in integrated planar lightw...

  18. The design of erbium-doped fiber amplifiers

    DEFF Research Database (Denmark)

    Pedersen, Bo; Bjarklev, Anders Overgaard; Povlsen, Jørn Hedegaard

    1991-01-01

    An accurate model for the erbium-doped fiber amplifier is presented. The model is used to design the index profile of the doped fiber, optimizing with regard to efficiency for inline- and preamplifiers as well as for power booster amplifiers. The predicted pump efficiencies (maximum gain to pump...

  19. Amplifying Islam : Pluralism, Secularism, and Religious Sounds in The Netherlands

    NARCIS (Netherlands)

    Tamimi Arab, P.

    2015-01-01

    This dissertation is an ethnographic study of the amplified azan, the Islamic call to prayer, in the Netherlands, adding a sonic dimension to analyses of the politics of Islamic aesthetics in the western world. Often rejected by opponents as noise pollution, facilitating the amplified azan is an exa

  20. Ferroelectric Field-Effect Transistor Differential Amplifier Circuit Analysis

    Science.gov (United States)

    Phillips, Thomas A.; MacLeod, Todd C.; Ho, Fat D.

    2008-01-01

    There has been considerable research investigating the Ferroelectric Field-Effect Transistor (FeFET) in memory circuits. However, very little research has been performed in applying the FeFET to analog circuits. This paper investigates the use of FeFETs in a common analog circuit, the differential amplifier. The two input Metal-Oxide-Semiconductor (MOS) transistors in a general MOS differential amplifier circuit are replaced with FeFETs. Resistors are used in place of the other three MOS transistors. The FeFET model used in the analysis has been previously reported and was based on experimental device data. Because of the FeFET hysteresis, the FeFET differential amplifier has four different operating modes depending on whether the FeFETs are positively or negatively polarized. The FeFET differential amplifier operation in the different modes was analyzed by calculating the amplifier voltage transfer and gain characteristics shown in figures 2 through 5. Comparisons were made between the FeFET differential amplifier and the standard MOS differential amplifier. Possible applications and benefits of the FeFET differential amplifier are discussed.

  1. Saturation and noise properties of quantum-dot optical amplifiers

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper

    2004-01-01

    Based on extensive numerical calculations, quantum-dot (QD) amplifiers are predicted to offer higher output power and lower noise figure compared to bulk as well as quantum well amplifiers. The underlying physical mechanisms are analyzed in detail, leading to the identification of a few key...

  2. Energy Efficient and Compact RF High-Power Amplifiers

    NARCIS (Netherlands)

    Calvillo Cortés, D.A.

    2014-01-01

    The main objectives of this thesis are to improve the energy efficiency and physical form-factor of high-power amplifiers in base station applications. As such, the focus of this dissertation is placed on the outphasing amplifier concept, which can offer high-efficiency, good linearity and excellent

  3. Influence of higher order modes on angled-facet amplifiers

    DEFF Research Database (Denmark)

    Wang, Z.; Mikkelsen, B.; Stubkjær, Kristian

    1991-01-01

    The influence of the first-order mode on the residual reflectivity of angled-facet amplifiers is analyzed. For a 7 degrees angled-facet ridge waveguide amplifier with a single-layer antireflective (AR) coating, a gain ripple lower than 1-dB at 25-dB gain can be obtained independent...... by increasing the facet angles to 10 degrees...

  4. Design and Analysis of Hybrid CMOS SRAM Sense Amplifier

    Directory of Open Access Journals (Sweden)

    Karishma Bajaj

    2012-03-01

    Full Text Available Sense amplifiers are one of the very important peripheral components of CMOS memories. In a Hybrid Sense amplifier both current and voltage sensing techniques are used which makes it a better selection than a conventional current or voltage sense amplifiers. The hybrid sense amplifier works in three phases-Offset cancellation (200ps, Access phase (500ps and Evaluation phase. The offset cancellation is done simultaneously with word line decoding, so as to speed up the process. The sensing range of the hybrid sense amplifier is improved from 1.18mV to 92mV. Also hybrid sense amplifier consumes very low energy of about 6.84fj. This sense amplifier is analyzed with a column of 512 SRAM cells at 180nm technology node and compared to CMOS conventional voltage sense amplifier. The circuit consumes an average power of 1.57 µW with a negligible offset of 149.3µV.

  5. External Peltier Cooler For Low-Noise Amplifier

    Science.gov (United States)

    Soper, Terry A.

    1990-01-01

    Inexpensive Peltier-effect cooling module made of few commercially available parts used to reduce thermal noise in microwave amplifier. Retrofitted to almost any microwave low-noise amplifier or receiver preamplifier used in communication, telemetry, or radar. Includes copper or aluminum cold plate held tightly against unit to be cooled by strap-type worm-gear clamps.

  6. An RF Power Amplifier in a Digital CMOS Process

    DEFF Research Database (Denmark)

    Nielsen, Per Asbeck; Fallesen, Carsten

    2002-01-01

    A two stage class B power amplifier for 1.9 GHz is presented. The amplifier is fabricated in a standard digital EPI-CMOS process with low resistivity substrate. The measured output power is 29 dBm in a 50 Omega load. A design method to find the large signal parameters of the output transistor...

  7. Phase Sensitive Amplifier Based on Ultrashort Pump Pulses

    CERN Document Server

    Gershikov, Alexander

    2016-01-01

    We demonstrate a narrow band phase sensitive amplifier in the pump degenerate configuration which employs ps pump pulses. Control of the amplifier bandwidth is achieved via changes of the pump spectral width. A phase sensitive gain between -6 and 6 decibels, with an overall system gain of 28dB was demonstrated.

  8. Series-Tuned High Efficiency RF-Power Amplifiers

    DEFF Research Database (Denmark)

    Vidkjær, Jens

    2008-01-01

    An approach to high efficiency RF-power amplifier design is presented. It addresses simultaneously efficiency optimization and peak voltage limitations when transistors are pushed towards their power limits.......An approach to high efficiency RF-power amplifier design is presented. It addresses simultaneously efficiency optimization and peak voltage limitations when transistors are pushed towards their power limits....

  9. A 300°C Dynamic-Feedback Instrumentation Amplifier

    NARCIS (Netherlands)

    Jong, P.C. de; Meijer, G.C.M.; Roermund, A.H.M. van

    1998-01-01

    A high-temperature instrumentation amplifier that uses dynamic feedback is presented. It realizes dynamic feedback by means of a rotating chain of resistors to compensate for resistor mismatches. An 11x dynamic-feedback instrumentation amplifier has been integrated in a standard junction-isolated 1.

  10. Implantable neurotechnologies: a review of integrated circuit neural amplifiers.

    Science.gov (United States)

    Ng, Kian Ann; Greenwald, Elliot; Xu, Yong Ping; Thakor, Nitish V

    2016-01-01

    Neural signal recording is critical in modern day neuroscience research and emerging neural prosthesis programs. Neural recording requires the use of precise, low-noise amplifier systems to acquire and condition the weak neural signals that are transduced through electrode interfaces. Neural amplifiers and amplifier-based systems are available commercially or can be designed in-house and fabricated using integrated circuit (IC) technologies, resulting in very large-scale integration or application-specific integrated circuit solutions. IC-based neural amplifiers are now used to acquire untethered/portable neural recordings, as they meet the requirements of a miniaturized form factor, light weight and low power consumption. Furthermore, such miniaturized and low-power IC neural amplifiers are now being used in emerging implantable neural prosthesis technologies. This review focuses on neural amplifier-based devices and is presented in two interrelated parts. First, neural signal recording is reviewed, and practical challenges are highlighted. Current amplifier designs with increased functionality and performance and without penalties in chip size and power are featured. Second, applications of IC-based neural amplifiers in basic science experiments (e.g., cortical studies using animal models), neural prostheses (e.g., brain/nerve machine interfaces) and treatment of neuronal diseases (e.g., DBS for treatment of epilepsy) are highlighted. The review concludes with future outlooks of this technology and important challenges with regard to neural signal amplification.

  11. Slow Light at High Frequencies in an Amplifying Semiconductor Waveguide

    DEFF Research Database (Denmark)

    Öhman, Filip; Yvind, Kresten; Mørk, Jesper

    2006-01-01

    We demonstrate slow-down of a modulated light signal in a semiconductor waveguide. Concatenated amplifying and absorbing sections simultaneously achieve both amplification and a controllable time delay at 15 GHz.......We demonstrate slow-down of a modulated light signal in a semiconductor waveguide. Concatenated amplifying and absorbing sections simultaneously achieve both amplification and a controllable time delay at 15 GHz....

  12. Coherent Beam Combination of Two Polarization Maintaining Ytterbium Fibre Amplifiers

    Institute of Scientific and Technical Information of China (English)

    HOU Jing; XIAO Rui; JIANG Zong-Fu; CHENG Xiang-Ai; SHU Bai-Hong; CHEN Jin-Bao; LIU Ze-Jin

    2005-01-01

    @@ We investigate coherent beam combination of fibre laser beams by phase locking. Phase noise of a polarization maintaining ytterbium fibre amplifier is inspected with a fibre interferometer. In a feed back control loop, two fibre polarization maintaining ytterbium amplifiers are phase locked and coherent combined when the phase noise is properly controlled by a LiNO3 phase modulator.

  13. A 24 channel acoustic/vibration test power amplifier

    Science.gov (United States)

    Barlett, F. R.

    1978-01-01

    In the present paper, the advantages and drawbacks of a multichannel amplifier operating in a vibration or acoustic facility are discussed. The configuration of the facility and the multichannel amplifier proposed is a compromise based on the particular requirements and anticipated work load in a specific case under consideration.

  14. Ultrafast Dynamics of Quantum-Dot Semiconductor Optical Amplifiers

    DEFF Research Database (Denmark)

    Poel, Mike van der; Hvam, Jørn Märcher

    2007-01-01

    We report on a series of experiments on the dynamical properties of quantum-dot semiconductor optical amplifiers. We show how the amplifier responds to one or several ultrafast (170 fs) pulses in rapid succession and our results demonstrate applicability and ultimate limitations to application...

  15. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  16. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  17. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  18. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  19. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  20. Fishing amplifies forage fish population collapses.

    Science.gov (United States)

    Essington, Timothy E; Moriarty, Pamela E; Froehlich, Halley E; Hodgson, Emma E; Koehn, Laura E; Oken, Kiva L; Siple, Margaret C; Stawitz, Christine C

    2015-05-26

    Forage fish support the largest fisheries in the world but also play key roles in marine food webs by transferring energy from plankton to upper trophic-level predators, such as large fish, seabirds, and marine mammals. Fishing can, thereby, have far reaching consequences on marine food webs unless safeguards are in place to avoid depleting forage fish to dangerously low levels, where dependent predators are most vulnerable. However, disentangling the contributions of fishing vs. natural processes on population dynamics has been difficult because of the sensitivity of these stocks to environmental conditions. Here, we overcome this difficulty by collating population time series for forage fish populations that account for nearly two-thirds of global catch of forage fish to identify the fingerprint of fisheries on their population dynamics. Forage fish population collapses shared a set of common and unique characteristics: high fishing pressure for several years before collapse, a sharp drop in natural population productivity, and a lagged response to reduce fishing pressure. Lagged response to natural productivity declines can sharply amplify the magnitude of naturally occurring population fluctuations. Finally, we show that the magnitude and frequency of collapses are greater than expected from natural productivity characteristics and therefore, likely attributed to fishing. The durations of collapses, however, were not different from those expected based on natural productivity shifts. A risk-based management scheme that reduces fishing when populations become scarce would protect forage fish and their predators from collapse with little effect on long-term average catches.

  1. Chemically amplified resist modeling in OPC

    Science.gov (United States)

    Zheng, Xin; Huang, Jason; Kuo, Fred; Kazarian, Aram; Chin, Fook; Fan, Yongfa

    2009-03-01

    The mechanism of chemically amplified resist plays a critical role in the modeling of the latent image. To achieve a practical model which can fit into the time frame of OPC, some simplifications and assumptions have to be made. We introduced regression kernels that take into account best exposure focus difference between isotropic pitch, dense, and line end features for the evaluation of image intensity. It compares the image intensity (signal) over small changes above and/or below the regressed "nominal" image position, which in principle corresponds to evaluating the intensity signal at various depths of a fixed resist profile thus can also be regressed for optimization during model development. Our calibration has shown that the model brought a great improvement in prediction for difficult structures such as dense features at or near the optical resolution limit and 2-dimensional features, which are the limiter of the overall model fitting accuracy for 45nm node and below. By replacing other existing techniques, total number of output kernels used for OPC operation is actually reduced with improvement of model accuracy. This model is proven to be a very effective yet accurate addition to the current OPC technology.

  2. Gold Nanoparticle Labels Amplify Ellipsometric Signals

    Science.gov (United States)

    Venkatasubbarao, Srivatsa

    2008-01-01

    The ellipsometric method reported in the immediately preceding article was developed in conjunction with a method of using gold nanoparticles as labels on biomolecules that one seeks to detect. The purpose of the labeling is to exploit the optical properties of the gold nanoparticles in order to amplify the measurable ellipsometric effects and thereby to enable ultrasensitive detection of the labeled biomolecules without need to develop more-complex ellipsometric instrumentation. The colorimetric, polarization, light-scattering, and other optical properties of nanoparticles depend on their sizes and shapes. In the present method, these size-and-shape-dependent properties are used to magnify the polarization of scattered light and the diattenuation and retardance of signals derived from ellipsometry. The size-and-shape-dependent optical properties of the nanoparticles make it possible to interrogate the nanoparticles by use of light of various wavelengths, as appropriate, to optimally detect particles of a specific type at high sensitivity. Hence, by incorporating gold nanoparticles bound to biomolecules as primary or secondary labels, the performance of ellipsometry as a means of detecting the biomolecules can be improved. The use of gold nanoparticles as labels in ellipsometry has been found to afford sensitivity that equals or exceeds the sensitivity achieved by use of fluorescence-based methods. Potential applications for ellipsometric detection of gold nanoparticle-labeled biomolecules include monitoring molecules of interest in biological samples, in-vitro diagnostics, process monitoring, general environmental monitoring, and detection of biohazards.

  3. Efficient and Compact Optical Amplifier Using EYDF

    Directory of Open Access Journals (Sweden)

    Sulaiman Wadi Harun

    2010-09-01

    Full Text Available An efficient Erbium/Ytterbium doped fiber amplifier (EYDFA is demonstrated using a 1058nm pumping wavelength, where the amplification is assisted by energy transfer between Yb and Er ions. The energy transfer increases the limit of erbium doping concentration that is imposed by concentration quenching in Erbium-doped fiber (EDF. Therefore, the gain and noise figure are severely degraded with 1480 nm pumping, where the energy transfer cannot be achieved. The use of optical isolator improves the small signal gain and noise figure by about 4.8 dB and 1.6 dB, respectively. By employing a double-pass configuration, a higher gain can be obtained with an expense of a noise figure penalty. The gain improvement of 17.0 dB is obtained at 20 mW and -50 dBm of pump and input signal powers. This shows that the double-pass configuration is an important aspect to consider when designing an efficient EYDFA.

  4. Globalization to amplify economic climate losses

    Science.gov (United States)

    Otto, C.; Wenz, L.; Levermann, A.

    2015-12-01

    Economic welfare under enhanced anthropogenic carbon emissions and associated future warming poses a major challenge for a society with an evolving globally connected economy. Unabated climate change will impact economic output for example through heat-stress-related reductions in productivity. Since meteorologically-induced production reductions can propagate along supply chains, structural changes in the economic network may influence climate-related losses. The role of the economic network evolution for climate impacts has been neither quantified nor qualitatively understood. Here we show that since the beginning of the 21st century the structural change of the global supply network has been such that an increase of spillover losses due to unanticipated climatic events has to be expected. We quantify primary, secondary and higher-order losses from reduced labor productivity under past and present economic and climatic conditions and find that indirect losses are significant and increase with rising temperatures. The connectivity of the economic network has increased in such a way as to foster the propagation of production loss. This supply chain connectivity robustly exhibits the characteristic distribution of self-organized criticality which has been shifted towards higher values since 2001. Losses due to this structural evolution dominated over the effect of comparably weak climatic changes during this decade. Our finding suggests that the current form of globalization may amplify losses due to climatic extremes and thus necessitate structural adaptation that requires more foresight than presently prevalent.

  5. Single Ion Quantum Lock-In Amplifier

    CERN Document Server

    Kotler, Shlomi; Glickman, Yinnon; Keselman, Anna; Ozeri, Roee

    2011-01-01

    We report on the implementation of a quantum analog to the classical lock-in amplifier. All the lock-in operations: modulation, detection and mixing, are performed via the application of non-commuting quantum operators on the electronic spin state of a single trapped Sr+ ion. We significantly increase its sensitivity to external fields while extending phase coherence by three orders of magnitude, to more than one second. With this technique we measure magnetic fields with sensitivity of 25 pT/sqrt(Hz) and light shifts with an uncertainty below 140 mHz after 1320 seconds of averaging. These sensitivities are limited by quantum projection noise and, to our knowledge, are more than two orders of magnitude better than with other single-spin probe technologies. In fact, our reported sensitivity is sufficient for the measurement of parity non-conservation, as well as the detection of the magnetic field of a single electronic-spin one micrometer from an ion-detector with nanometer resolution. As a first application ...

  6. Status Report on the Energy Amplifier

    CERN Document Server

    Rubbia, Carlo

    1994-01-01

    0ne year after its first presentation,the Energy Amplifier (EA) Project holds its promises for a environmentally acceptable form of energy extraction from nuclei, namely to eliminate or at least greatly reduce(i) the environmental impact of the long-lived highly radioactive waste;(ii) the possibility of diversions toward military applications;(iii) the risks of an accidental divergence related to the critical operation of the chain reaction and (iv) make a more efficient use of a fuel which is less radio-toxic to extract and more abundant on Earth than Uranium. In these respects the EA (or equivalent scenarios from Los Alamos and elsewhere) is comparable in performance to Thermonuclear Fusion. Bot h approches offer pratically unl;imited fuel resources: the energetic content of Lithium on the Earth's crust needed by Fusion is estimated to be seven times the one of Thorium and they are both adequate for millions of years of very intensived utilisation.However the EA can be built economically,in a variety of siz...

  7. Pulse laser imaging amplifier for advanced ladar systems

    Science.gov (United States)

    Khizhnyak, Anatoliy; Markov, Vladimir; Tomov, Ivan; Murrell, David

    2016-05-01

    Security measures sometimes require persistent surveillance of government, military and public areas Borders, bridges, sport arenas, airports and others are often surveilled with low-cost cameras. Their low-light performance can be enhanced with laser illuminators; however various operational scenarios may require a low-intensity laser illumination with the object-scattered light intensity lower than the sensitivity of the Ladar image detector. This paper discusses a novel type of high-gain optical image amplifier. The approach enables time-synchronization of the incoming and amplifying signals with accuracy <= 1 ns. The technique allows the incoming signal to be amplified without the need to match the input spectrum to the cavity modes. Instead, the incoming signal is accepted within the spectral band of the amplifier. We have gauged experimentally the performance of the amplifier with a 40 dB gain and an angle of view 20 mrad.

  8. GHz bandwidth noise eater hybrid optical amplifier: design guidelines.

    Science.gov (United States)

    Danion, Gwennaël; Bondu, François; Loas, Goulc'hen; Alouini, Mehdi

    2014-07-15

    This Letter describes the design of an optical amplifier system optimized to reduce the relative intensity noise (RIN) of the input signal, and discloses its performance in terms of intensity noise reduction and bandwidth, without phase noise degradation. This polarization-maintaining amplifier is composed of an erbium-doped fiber amplifier (EDFA) cascaded with a semiconductor optical amplifier (SOA). The EDFA is sized to feed the SOA with a constant power corresponding to the optimal saturation level for noise reduction, through coherent population oscillations. When properly optimized, such an amplifier provides, simultaneously, 17 dB optical gain, 5.4 dB noise factor, and 20 dB reduction of the input-RIN across a 3 GHz bandwidth, without any electronics feedback loop.

  9. Quantum Dot Semiconductor Optical Amplifiers - Physics and Applications

    DEFF Research Database (Denmark)

    Berg, Tommy Winther

    2004-01-01

    This thesis describes the physics and applications of quantum dot semiconductor optical amplifiers based on numerical simulations. These devices possess a number of unique properties compared with other types of semiconductor amplifiers, which should allow enhanced performance of semiconductor...... respects is comparable to those of fiber amplifiers. The possibility of inverting the optically active states to a large degree is essential in order to achieve this performance. Optical signal processing through cross gain modulation and four wave mixing is modeled and described. For both approaches...... and QW devices and to experiments on quantum dot amplifiers. These comparisons outline the qualitative differences between the different types of amplifiers. In all cases focus is put on the physical processes responsible the differences....

  10. A Review of High Voltage Drive Amplifiers for Capacitive Actuators

    DEFF Research Database (Denmark)

    Huang, Lina; Zhang, Zhe; Andersen, Michael A. E.

    2012-01-01

    This paper gives an overview of the high voltage amplifiers, which are used to drive capacitive actuators. The amplifiers for both piezoelectric and DEAP (dielectric electroactive polymer) actuator are discussed. The suitable topologies for driving capacitive actuators are illustrated in detail, ......, including linear as well as switched mode amplifiers. In the past much attention has been paid on the driver for piezoelectric actuator. As DEAP is a type of new material, there is not much literature reference for it.......This paper gives an overview of the high voltage amplifiers, which are used to drive capacitive actuators. The amplifiers for both piezoelectric and DEAP (dielectric electroactive polymer) actuator are discussed. The suitable topologies for driving capacitive actuators are illustrated in detail...

  11. Digital Lock-in Amplifier Based on Microcontroller

    Institute of Scientific and Technical Information of China (English)

    An-li TAO; Guo-dong XU; Ke-xue LUO; Gang-ling ZHANG

    2010-01-01

    A method of implementing high cost-effective and highly integrated digital lock-in amplifier with microcontroller is discussed. And the digital lock-in amplifier is more suitable for measuring low-frequency weak signal.Digital signal sequence is obtained through sampling signal measured over an integer number of signal periods, but digital reference sequence is acquired through mathematical operation, then digital phase sensitive detection can be implemented by calculating the cross-correlation function of digital signal sequence and digital reference sequence.In addition, the frequency response and phase character of the digital lock-in amplifier is analyzed. Finally, the designed digital lock-in amplifier is achieved. Experimental results show that the digital lock-in amplifier can be used for measuring weak signal with low ignal-to-noise ratio.

  12. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  13. Optimisation of the Low-Frequency Response of a Multi-stage Bioelectric Amplifier for Electrocardiogram (ECG Recording

    Directory of Open Access Journals (Sweden)

    Burke Martin J.

    2016-01-01

    Full Text Available This paper reports the optimisation of the low-frequency response of a multi-stage bioelectric amplifier intended for use in the measurement of the human electrocardiogram (ECG using high-impedance un-gelled electrodes. The frequency response was optimised to meet international performance requirements for electrocardiographic recorders, in particular the International Electrotechnical Commission 60601 standards [1,2]. The pole and zero locations of a multi-stage amplifier configuration were optimised to meet both time and frequency domain specifications. The optimum assignment for a three stage amplifier, having two differential stages and a differential-to-single-ended conversion stage was established by evaluating the performance of a number of circuit configurations. The optimum configuration was found to be two differential stages with a gain of 20dB each and a differential-to single-ended output stage with unity gain. The -3dB pole is placed at 0.028Hz and a zero at 0.0028Hz in the first and second stages to give an overall -3dB bandwidth of 0.043Hz. In addition, the pole of the input ac coupling network was placed at 0.0028Hz in order to meet the undershoot and recovery slope requirements in the narrow pulse response.

  14. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  15. Transpositional behaviour of the Ds element in the Ac/Ds system in rice

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Insertional mutagenesis based on maize Activator/Dissociator (Ac/Ds) transposons is becoming a major approach used to produce a saturated mutant collection in rice. In this research, Ds-T-DNA transformed homozygotes were crossed with Ac-T-DNA transformed homozygotes in order to establish an Ac/Ds transposon system in rice. The successive investigation of Ds transposition from F1 to F5 generations indicated that the frequencies of germinal transposition increased over successive generations and reached 54.2% in F3 generation. The Ds transposition pattern revealed that a Ds transposition induced an approximately 170-bp deletion of T-DNA sequence and another Ds transposition carried a 272-bp T-DNA sequence. Using thermal asymmetric interlaced PCR (TAIL-PCR), some flanking sequences of the Ds element were amplified. Analyses of 17 Ds-flanking sequences showed that five Ds were inserted into gene regions. The Ds could transpose not only to the linked sites but also to the unlinked sites. The frequency of inter-chromosomal transposition of Ds was 33.3%.

  16. A Gallium Arsenide MESFET Operational Amplifier for Use in Composite Operational Amplifiers

    Science.gov (United States)

    1993-12-01

    F., Operational Amplifiers and Linear Integrated Circuits, 4th ed., Prentice Hall, 1991. 6. Sedra , A. S., and Smith , K. C., Microelectronic Circuits...7, pp. 1422-1429, July 1992. 17. McCamant, A. J., McCormack G. D., and Smith , D. H., "An Improved GaAs MESFET Model for SPICE," IEEE Transactions of...34Modeling Frequency Dependence of out Impedance of a Microwave MESFET at Low Frequencies," Electronics Letters, pp. 528-529, June 1985. 39. Smith , M. et al

  17. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  18. High Power Amplifier and Power Supply

    Science.gov (United States)

    Duong, Johnny; Stride, Scot; Harvey, Wayne; Haque, Inam; Packard, Newton; Ng, Quintin; Ispirian, Julie Y.; Waian, Christopher; Janes, Drew

    2008-01-01

    A document discusses the creation of a high-voltage power supply (HVPS) that is able to contain voltages up to -20 kV, keep electrical field strengths to below 200 V/mil (approximately equal to 7.87 kV/mm), and can provide a 200-nanosecond rise/fall time focus modulator swinging between cathode potential of 16.3 kV and -19.3 kV. This HVPS can protect the 95-GHz, pulsed extended interaction klystron (EIK) from arcs/discharges from all sources, including those from within the EIK fs vacuum envelope. This innovation has a multi-winding pulse transformer design, which uses new winding techniques to provide the same delays and rise/fall times (less than 10 nanoseconds) at different potential levels ranging from -20 kV to -16 kV. Another feature involves a high-voltage printed-wiring board that was corona-free at -20 kV DC with a 3- kV AC swing. The corona-free multilayer high-voltage board is used to simulate fields of less than 200 V/mil (approximately equal to 7.87 kV/mm) at 20 kV DC. Drive techniques for the modulator FETs (field-effect transistors) (four to 10 in a series) were created to change states (3,000-V swing) without abrupt steps, while still maintaining required delays and transition times. The packing scheme includes a potting mold to house a ten-stage modulator in the space that, in the past, only housed a four-stage modulator. Problems keeping heat down were solved using aluminum oxide substrate in the high-voltage section to limit temperature rise to less than 10 while withstanding -20 kV DC voltage and remaining corona-free.

  19. A modular positive feedback-based gene amplifier

    Directory of Open Access Journals (Sweden)

    Bhalerao Kaustubh D

    2010-02-01

    Full Text Available Abstract Background Positive feedback is a common mechanism used in the regulation of many gene circuits as it can amplify the response to inducers and also generate binary outputs and hysteresis. In the context of electrical circuit design, positive feedback is often considered in the design of amplifiers. Similar approaches, therefore, may be used for the design of amplifiers in synthetic gene circuits with applications, for example, in cell-based sensors. Results We developed a modular positive feedback circuit that can function as a genetic signal amplifier, heightening the sensitivity to inducer signals as well as increasing maximum expression levels without the need for an external cofactor. The design utilizes a constitutively active, autoinducer-independent variant of the quorum-sensing regulator LuxR. We experimentally tested the ability of the positive feedback module to separately amplify the output of a one-component tetracycline sensor and a two-component aspartate sensor. In each case, the positive feedback module amplified the response to the respective inducers, both with regards to the dynamic range and sensitivity. Conclusions The advantage of our design is that the actual feedback mechanism depends only on a single gene and does not require any other modulation. Furthermore, this circuit can amplify any transcriptional signal, not just one encoded within the circuit or tuned by an external inducer. As our design is modular, it can potentially be used as a component in the design of more complex synthetic gene circuits.

  20. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  1. Design of IRIG-B(AC)encoder based on FPGA%基于FPGA的IRIG-B(AC)编码器设计

    Institute of Scientific and Technical Information of China (English)

    周彩亲; 李世中; 梁国强

    2015-01-01

    InterRange Instrumentation Group (IRIG-B(AC))code is usually used in the shooting range test for time information transmission and systems time synchronization.According to IRIG-B(AC)code format and modulation principle,this paper presents IRIG-B(AC)coding circuit design scheme based on field programmable gate array (FPGA).The B(AC)code signal is generated by AD7245,a digital-to-analog (D/A)converter.After amplified,the signal can be used directly for system time synchronization,and the amplitude of the signal can be adj usted according to different requirements.The IRIG-B(AC)encoder designed has been verified by test.The test results show that it can output accurate time information and has higher practicali-ty.%IRIG-B(AC)码常用于靶场试验中传递时间信息和同步各系统时间。根据 IRIG-B(AC)码的格式及调制原理,介绍了基于 FPGA的 IRIG-B(AC)编码电路的设计。利用 AD7245实现 D/A 转换转换产生 B (AC)码信号,信号经放大后可直接用于系统时间同步,而且信号幅度可根据不同的使用需求进行调节。经测试验证,本系统输出的时间信息准确无误,有较高的实用性。

  2. AC susceptibilities of grain-textured superconductors

    Science.gov (United States)

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  3. Efficient performance simulation of class D amplifier output stages

    DEFF Research Database (Denmark)

    Nyboe, Flemming; Risbo, Lars; Andreani, Pietro

    2005-01-01

    Straightforward simulation of amplifier distortion involves transient simulation of operation on a sine wave input signal, and a subsequent FFT of the output voltage. This approach is very slow on class D amplifiers, since the switching behavior forces simulation time steps that are many orders...... of magnitude smaller than the duration of one period of an audio sine wave. This work presents a method of simulating the amplifier transfer characteristic using a minimum amount of simulation time, and then deriving THD from the results....

  4. Introduction to RF power amplifier design and simulation

    CERN Document Server

    Eroglu, Abdullah

    2015-01-01

    Introduction to RF Power Amplifier Design and Simulation fills a gap in the existing literature by providing step-by-step guidance for the design of radio frequency (RF) power amplifiers, from analytical formulation to simulation, implementation, and measurement. Featuring numerous illustrations and examples of real-world engineering applications, this book:Gives an overview of intermodulation and elaborates on the difference between linear and nonlinear amplifiersDescribes the high-frequency model and transient characteristics of metal-oxide-semiconductor field-effect transistorsDetails activ

  5. Investigation of a background suppression transimpedance amplifier for photovoltaic detectors

    Science.gov (United States)

    Metzger, Ferdinand J., Jr.

    1992-12-01

    The current generation of transimpedance amplifier based detector systems are limited by opamp saturation when operating at a high gain or in the presence of a large background signal. To eliminate saturation, an amplifier that is frequency dependent is developed. Additionally, the noise sources in the conventional transimpedance amplifier and photovoltaic detector are quantified for comparison to any modified circuit. Initial results indicate that the frequency dependent detector system is a viable system, however, further development is required. Further research of this technology is expected to support future infrared and long range detection applications.

  6. Design procedure for optimizing CMOS low noise operational amplifiers

    Institute of Scientific and Technical Information of China (English)

    Li Zhiyuan; Ye Yizheng; Ma Jianguo

    2009-01-01

    This paper presents and experimentally verifies an optimized design procedure for a CMOS low noise operational amplifier.The design procedure focuses on the noise performance,which is the key requirement for low noise operational amplifiers.Based on the noise level and other specifications such as bandwidth,signal swing,slew rate,and power consumption,the device sizes and the biasing conditions are derived.In order to verify the proposed design procedure,a three-stage operational amplifier has been designed.The device parameters obtained from the proposed design procedure closely agree with the simulated results obtained by using HSPICE.

  7. Optimization and Performance Analysis of Bulk-Driven Differential Amplifier

    Directory of Open Access Journals (Sweden)

    Antarpreet kaur

    2014-04-01

    Full Text Available In recent years, there has been an increasing demand for high-speed digital circuits at low power consumption. This paper presents a design of input stage of Operational Amplifier i.e cascode differential amplifier using a standard 65nm CMOS Technology.A comparison betweem gate-driven, bulk-driven and cascode bulk driven bulk-driven differential amplifier is described. The Results demonstrate that CMMR is 83.98 dB, 3-dB Bandwidth is 1.04 MHz. The circuit dissipate power of 28uWunder single supply of 1.0V.

  8. Amplifier circuit operable over a wide temperature range

    Science.gov (United States)

    Kelly, Ronald D.; Cannon, William L.

    1979-01-01

    An amplifier circuit having stable performance characteristics over a wide temperature range from approximately 0.degree. C up to as high as approximately 500.degree. C, such as might be encountered in a geothermal borehole. The amplifier utilizes ceramic vacuum tubes connected in directly coupled differential amplifier pairs having a common power supply and a cathode follower output stage. In an alternate embodiment, for operation up to 500.degree. C, positive and negative power supplies are utilized to provide improved gain characteristics, and all electrical connections are made by welding. Resistor elements in this version of the invention are specially heat treated to improve their stability with temperature.

  9. High power solid state rf amplifier for proton accelerator.

    Science.gov (United States)

    Jain, Akhilesh; Sharma, Deepak Kumar; Gupta, Alok Kumar; Hannurkar, P R

    2008-01-01

    A 1.5 kW solid state rf amplifier at 352 MHz has been developed and tested at RRCAT. This rf source for cw operation will be used as a part of rf system of 100 MeV proton linear accelerator. A rf power of 1.5 kW has been achieved by combining output power from eight 220 W rf amplifier modules. Amplifier modules, eight-way power combiner and divider, and directional coupler were designed indigenously for this development. High efficiency, ease of fabrication, and low cost are the main features of this design.

  10. 2250-MHz High Efficiency Microwave Power Amplifier (HEMPA)

    Science.gov (United States)

    Sims, W. Herbert; Bell, Joseph L. (Technical Monitor)

    2001-01-01

    Tnis paper will focus on developing an exotic switching technique that enhances the DC-to-RF conversion efficiency of microwave power amplifiers. For years, switching techniques implemented in the 10 kHz to 30 MHz region have resulted in DC-to-RF conversion efficiencies of 90-95-percent. Currently amplifier conversion efficiency, in the 2-3 GHz region approaches, 10-20-percent. Using a combination of analytical modeling and hardware testing, a High Efficiency Microwave Power Amplifier was built that demonstrated conversion efficiencies four to five times higher than current state of the art.

  11. Externally pumped millimeter-wave Josephson-junction parametric amplifier

    DEFF Research Database (Denmark)

    Levinsen, M.T; Pedersen, Niels Falsig; Sørensen, Ole;

    1980-01-01

    A unified theory of the singly and doubly degenerate Josephson-junction parametric amplifier is presented. Experiments with single junctions on both amplifier modes at frequencies 10, 35, and 70 GHz are discussed. Low-noise temperature (∼100 K, single sideband (SSB)) and reasonable gain (∼8 d......B) were obtained at 35 GHz in the singly degenerate mode. On the basis of the theory and experiments, a general procedure for optimizing junction parameters is discussed and illustrated by the specific design of a 100-GHz amplifier....

  12. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  13. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  14. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  15. AC410 Unit 2 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  16. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    Institute of Scientific and Technical Information of China (English)

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  17. Amplified spontaneous emission spectrum at the output of a diode amplifier saturated by an input monochromatic wave

    Science.gov (United States)

    Bogatov, A. P.; Drakin, A. E.; D'yachkov, N. V.; Gushchik, T. I.

    2016-08-01

    Expressions for the amplitudes of amplified spontaneous emission waves in a diode amplifier near the frequency ω0 of a 'strong' input monochromatic wave have been derived in terms of a random function of a stationary Gaussian process. We have found expressions for the spectral density of the amplitudes and shown that, on the red side of the spectrum with respect to frequency ω0, spontaneous emission waves obtain additional nonlinear gain, induced by the strong wave, whereas on the blue side of the spectrum an additional loss is induced. Such behaviour of the amplitudes of amplified waves agrees with previous results.

  18. Amplifying waveguide optical isolator with an integrated electromagnet

    OpenAIRE

    2007-01-01

    We have demonstrated an amplifying waveguide optical isolator with an integrated electromagnet. This provides a solution to the generally poor magnetic remanence of this type of isolator. The proof of principle is presented and optimization routes are discussed.

  19. Fast terahertz imaging using a quantum cascade amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Yuan, E-mail: yr235@cam.ac.uk; Wallis, Robert; Jessop, David Stephen; Degl' Innocenti, Riccardo; Klimont, Adam; Beere, Harvey E.; Ritchie, David A. [Cavendish Laboratory, University of Cambridge, JJ Thomson Avenue, Cambridge CB3 0HE (United Kingdom)

    2015-07-06

    A terahertz (THz) imaging scheme based on the effect of self-mixing in a 2.9 THz quantum cascade (QC) amplifier has been demonstrated. By coupling an antireflective-coated silicon lens to the facet of a QC laser, with no external optical feedback, the laser mirror losses are enhanced to fully suppress lasing action, creating a THz QC amplifier. The addition of reflection from an external target to the amplifier creates enough optical feedback to initiate lasing action and the resulting emission enhances photon-assisted transport, which in turn reduces the voltage across the device. At the peak gain point, the maximum photon density coupled back leads to a prominent self-mixing effect in the QC amplifier, leading to a high sensitivity, with a signal to noise ratio up to 55 dB, along with a fast data acquisition speed of 20 000 points per second.

  20. A dual-amplifier hot-wire anemometer

    Science.gov (United States)

    Sadeh, W. Z.; Finn, C. L.

    1979-01-01

    The conceptual design of a dual-amplifier constant-temperature hot-wire anemometer is described. This hot-wire anemometer consists of three basic independent modules: a Wheatstone bridge in which the hot wire is one of its arms, an error-correction amplifier, and a voltage-controlled current source. The last two modules constitute the feedback network of this hot-wire anemometer. Thus the output voltage across the wire is a true function of the instantaneous changes in the wire resistance induced by the cooling effect of the flow. The dual-amplifier is capable of reaching relatively high frequency response through adequate selection of its active elements. Suitable gain of the error-correction amplifier and proper choice of the transfer function of the current source has yielded a frequency bandwidth up to 200 kHz.

  1. Distributed CMOS Bidirectional Amplifiers Broadbanding and Linearization Techniques

    CERN Document Server

    El-Khatib, Ziad; Mahmoud, Samy A

    2012-01-01

    This book describes methods to design distributed amplifiers useful for performing circuit functions such as duplexing, paraphrase amplification, phase shifting power splitting and power combiner applications.  A CMOS bidirectional distributed amplifier is presented that combines for the first time device-level with circuit-level linearization, suppressing the third-order intermodulation distortion. It is implemented in 0.13μm RF CMOS technology for use in highly linear, low-cost UWB Radio-over-Fiber communication systems. Describes CMOS distributed amplifiers for optoelectronic applications such as Radio-over-Fiber systems, base station transceivers and picocells; Presents most recent techniques for linearization of CMOS distributed amplifiers; Includes coverage of CMOS I-V transconductors, as well as CMOS on-chip inductor integration and modeling; Includes circuit applications for UWB Radio-over-Fiber networks.

  2. Experimental examinations of semiconductor laser amplifiers for optical communication technology

    Science.gov (United States)

    Ludwig, Reinhold

    1993-01-01

    Properties of SLA (Semiconductor Laser Amplifier), which are particularly interesting for application to linear repeaters in coherent multichannel systems, are studied and design rules for future optimized amplifier structure are deduced. Laser diode antireflection was examined and reflection factor was measured. Low signal properties were discussed considering injection current, wavelengths, temperature and polarization. The coupling between amplifiers and glass fibers was examined. The utilization of cascade amplifiers as linear repeaters in multichannel heterodyne systems and television distribution systems was investigatied. The following results are obtained: measurement and calculation of the paradiaphony between two signals radiated in a SLA; multichannel data transfer through a SLA; polarization independent amplification with SLA configurations; measurement of the frequency dependence of four wave mixing sidelines in a SLA; measurement of the system degradation through echoes in a bidirectional SLA chain; data transmission with frequency conversion and calculation of multichannel transmission systems with cascade SLA, taking into account saturation, signal to noise ratio, bandwidth reduction and echo.

  3. On the unlimited gain of a nonlinear parametric amplifier

    DEFF Research Database (Denmark)

    Sorokin, Vladislav

    2014-01-01

    The present paper is concerned with analysis of the response of a nonlinear parametric amplifier in abroad range of system parameters, particularly beyond resonance. Such analysis is of particular interestfor micro- and nanosystems, since many small-scale parametric amplifiers exhibit a distinctly...... nonlinearbehavior when amplitude of their response is sufficiently large. The modified method of direct separa-tion of motions is employed to study the considered system. As the result it is obtained that steady-stateamplitude of the nonlinear parametric amplifier response can reach large values in the case...... of arbitrarilysmall amplitude of external excitation, so that the amplifier gain tends to infinity. Very large amplifiergain can be achieved in a broad range of system parameters, in particular when the amplitude of para-metric excitation is comparatively small. The obtained results clearly demonstrate that very...

  4. A high-fidelity noiseless amplifier for quantum light states

    CERN Document Server

    Zavatta, A; Bellini, M

    2010-01-01

    Noise is the price to pay when trying to clone or amplify arbitrary quantum states. The quantum noise associated to linear phase-insensitive amplifiers can only be avoided by relaxing the requirement of a deterministic operation. Here we present the experimental realization of a probabilistic noiseless linear amplifier that is able to amplify coherent states at the highest level of effective gain and final state fidelity ever reached. Based on a sequence of photon addition and subtraction, and characterized by a significant amplification and low distortions, this high-fidelity amplification scheme may become an essential tool for quantum communications and metrology, by enhancing the discrimination between partially overlapping quantum states or by recovering the information transmitted over lossy channels.

  5. Fiber amplifiers under thermal loads leading to transverse mode instability

    DEFF Research Database (Denmark)

    Johansen, Mette Marie; Hansen, Kristian Rymann; Alkeskjold, Thomas Tanggaard;

    2014-01-01

    Transverse mode instability (TMI) in rare-earth doped fiber amplifiers operating above an average power threshold is caused by intermodal stimulated thermal Rayleigh scattering due to quantum defect heating. We investigate thermally induced longitudinal waveguide perturbations causing power trans...

  6. 1.55 Micron High Peak Power Fiber Amplifier Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In this proposal, we propose to demonstrate and build a 1.55 micron single frequency high energy and high peak power fiber amplifier by developing an innovative...

  7. Gain Variation with Raman Amplifier Parameters and Its Restoration

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    We demonstrate that gain profile of a distributed Raman amplifier is sensitive to its parameter variation, such as loss/gain coefficients change or partial pump failure. Gain flatness can be restored by adjusting power of pump lasers.

  8. High-Frequency RIN Transfer in Fibre Optic Parametric Amplifiers

    DEFF Research Database (Denmark)

    Lali-Dastjerdi, Zohreh; Lund-Hansen, Toke; Kang, Ning

    2011-01-01

    ibre optic parametric amplifiers (FOPAs) are versatile devices for amplification at arbitrary wavelengths, as well as a wide range of optical signal processing applications, including switching, wavelength conversion, regeneration, pulse generation etc [1]. Transfer of intensity fluctuations from...

  9. A CMOS single-supply logarithmic amplifier for hearing aids

    Science.gov (United States)

    Jarng, Soon Suck; Chen, Lingfeng; Kwon, You Jung

    2005-12-01

    The Log Amplifier described in this paper is designed for hearing aids (HA) application. It works on a low single-supply voltage (1.3V). The input signal varies between 0.01mV and 100mV. To give enough compensation to the hearing impairment, the amplifier provides a very large gain. The output swing is limited because of the low supply voltage and the large gain. Therefore, the logarithmic amplifier introduced into the design of HA to compress input signal so that the output distortion can be avoid. Another factor we use it here is that the amplifier has enough sensitivity and gain to deal with the compressed input signal without getting extra distortion coursed by the pre-process on input signal. The short channel CMOS devices play an important role in reduction of the supply voltage. DONG-BU ANAM 0.18 μm process is selected.

  10. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  11. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  12. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  13. Recovery of slow potentials in AC-coupled electrocorticography: application to spreading depolarizations in rat and human cerebral cortex

    DEFF Research Database (Denmark)

    Hartings, Jed A; Watanabe, Tomas; Dreier, Jens P;

    2009-01-01

    Cortical spreading depolarizations (spreading depressions and peri-infarct depolarizations) are a pathology intrinsic to acute brain injury, generating large negative extracellular slow potential changes (SPCs) that, lasting on the order of minutes, are studied with DC-coupled recordings in animals....... The spreading SPCs of depolarization waves are observed in human cortex with AC-coupled electrocorticography (ECoG), although SPC morphology is distorted by the high-pass filter stage of the amplifiers. Here, we present a signal processing method to reverse these distortions and recover approximate full...... of the inverse filter was validated by its ability to recover both simulated and real low-frequency input test signals. The inverse filter was then applied to AC-coupled ECoG recordings from five patients who underwent invasive monitoring after aneurysmal subarachnoid hemorrhage. For 117 SPCs, the inverse filter...

  14. Design of low noise transimpedance amplifier for intravascular ultrasound

    KAUST Repository

    Reda, Dina

    2009-11-01

    In this paper, we study transimpedance amplifiers for capacitive sensing applications with a focus on Intravascular Ultra Sound (IVUS). We employ RF noise cancellation technique on capacitive feedback based transimpedance amplifiers. This technique eliminates the input-referred noise of TIAs completely and enhances the dynamic range of front-end electronics. Simulation results verify the proposed technique used in two different TIA topologies employing shunt-shunt feedback. ©2009 IEEE.

  15. Thermal Effects in High-Power Fiber Amplifiers

    DEFF Research Database (Denmark)

    Hansen, Kristian Rymann; Lægsgaard, Jesper

    2011-01-01

    The effect of temperature gradients in Yb-doped fiber amplifiers is studied numerically. We investigate the dependence of the mode area on the signal power, and compare forward and backward pumping schemes.......The effect of temperature gradients in Yb-doped fiber amplifiers is studied numerically. We investigate the dependence of the mode area on the signal power, and compare forward and backward pumping schemes....

  16. On the dual symmetry between absorbing and amplifying random media

    Indian Academy of Sciences (India)

    S Anantha Ramakrishna

    2004-06-01

    We re-examine the dual symmetry between absorbing and amplifying random media. By analysing the physically allowed choice of the sign of the square root to determine the complex wave vector in a medium, we draw a broad set of conclusions that enables us to resolve the apparent paradox of the dual symmetry and also to anticipate the large local electromagnetic field enhancements in amplifying random media.

  17. Ultrafast optical signal processing using semiconductor quantum dot amplifiers

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper

    2002-01-01

    The linear and nonlinear properties of quantum dot amplifiers are discussed on the basis of an extensive theoretical model. These devices show great potential for linear amplification as well as ultrafast signal processing.......The linear and nonlinear properties of quantum dot amplifiers are discussed on the basis of an extensive theoretical model. These devices show great potential for linear amplification as well as ultrafast signal processing....

  18. Characterization of a multimode coplanar waveguide parametric amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Simoen, M., E-mail: simoen@chalmers.se; Krantz, P.; Bylander, Jonas; Shumeiko, V.; Delsing, P. [Department of Microtechnology and Nanoscience (MC2), Chalmers University of Technology, Göteborg SE-412 96 (Sweden); Chang, C. W. S.; Wilson, C. M. [Institute for Quantum Computing and Department of Electrical and Computer Engineering, University of Waterloo, Waterloo, Ontario N2L 3G1 (Canada); Wustmann, W. [Department of Microtechnology and Nanoscience (MC2), Chalmers University of Technology, Göteborg SE-412 96 (Sweden); Laboratory for Physical Sciences, College Park, Maryland 20740 (United States)

    2015-10-21

    We characterize a Josephson parametric amplifier based on a flux-tunable quarter-wavelength resonator. The fundamental resonance frequency is ∼1 GHz, but we use higher modes of the resonator for our measurements. An on-chip tuning line allows for magnetic flux pumping of the amplifier. We investigate and compare degenerate parametric amplification, involving a single mode, and nondegenerate parametric amplification, using a pair of modes. We show that we reach quantum-limited noise performance in both cases.

  19. EXAMINING OF ASE AT THE ERBIUM DOPED FIBER AMPLIFIERS

    Directory of Open Access Journals (Sweden)

    H. Haldun GÖKTAŞ

    2004-02-01

    Full Text Available In this study, the effect of Amplified Spontaneous Emission (ASE which is the main cause of noise in Erbium Doped-Fiber Amplifiers (EDFA used in long distance signal transmission has been examined. For this purpose an EDFA pumped with a 1480nm pump source has been analysed to see the effect of ASE, by taking into account the noise and removing it from the simulation.

  20. An Artefact suppressing fast-recovery myoelectric amplifier

    OpenAIRE

    1999-01-01

    An amplifier for recording myoelectric signals using surface electrodes has been developed. The special features are suppression of stimulation artefacts and motion artefacts from electrodes. It is designed for recording of myoelectric signals from a muscle that is being stimulated with short impulses. The artifact suppression is achieved by using fast-recovery instrumentation amplifiers and having a nonlinear feedback loop for automatic compensation of changes in DC-offset

  1. Thermally induced nonlinear mode coupling in high power fiber amplifiers

    DEFF Research Database (Denmark)

    Johansen, Mette Marie; Hansen, Kristian Rymann; Alkeskjold, Thomas T.;

    2013-01-01

    Thermally induced nonlinear mode coupling leads to transverse mode instability (TMI) in high power fiber amplifiers. A numerical model including altering mode profiles from thermal effects and waveguide perturbations predicts a TMI threshold of ~200W.......Thermally induced nonlinear mode coupling leads to transverse mode instability (TMI) in high power fiber amplifiers. A numerical model including altering mode profiles from thermal effects and waveguide perturbations predicts a TMI threshold of ~200W....

  2. Design of 2.1 GHz CMOS Low Noise Amplifier

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    This paper discusses the design of a fully differential 2.1 GHz CMOS low noise amplifier using the TSMC0.25 μm CMOS process. Intended for use in 3G, the low noise amplifier is fully integrated and without off-chip components. The design uses an LC tank to replace a large inductor to achieve a smaller die area, and uses shielded pad capacitances to improve the noise performance. This paper also presents evaluation results of the design.

  3. Calibration setup for ultralow-current transresistance amplifiers

    CERN Document Server

    Finardi, Ilaria

    2016-01-01

    We describe a calibration setup for the transresistance of low-current amplifiers, based on the capacitance-charging method. The calibration can be performed in the current range of typical interest for electron counting experiments. The setup implementation is simple and rugged, and is suitable to be embedded in larger experiments where the amplifier is employed. The calibration is traceable to units of capacitance and of time. The base relative accuracy of the implementation is in the 10^-5 range.

  4. Ferrite bead effect on Class-D amplifier audio quality

    OpenAIRE

    Haddad, Kevin El; Mrad, Roberto; Morel, Florent; Pillonnet, Gael; Vollaire, Christian; Nagari, Angelo

    2014-01-01

    International audience; This paper studies the effect of ferrite beads on the audio quality of Class-D audio amplifiers. This latter is a switch-ing circuit which creates high frequency harmonics. Generally, a filter is used at the amplifier output for the sake of electro-magnetic compatibility (EMC). So often, in integrated solutions, this filter contains ferrite beads which are magnetic components and present nonlinear behavior. Time domain measurements and their equivalence in frequency do...

  5. High Efficiency Microwave Power Amplifier: From the Lab to Industry

    Science.gov (United States)

    Sims, William Herbert, III; Bell, Joseph L. (Technical Monitor)

    2001-01-01

    Since the beginnings of space travel, various microwave power amplifier designs have been employed. These included Class-A, -B, and -C bias arrangements. However, shared limitation of these topologies is the inherent high total consumption of input power associated with the generation of radio frequency (RF)/microwave power. The power amplifier has always been the largest drain for the limited available power on the spacecraft. Typically, the conversion efficiency of a microwave power amplifier is 10 to 20%. For a typical microwave power amplifier of 20 watts, input DC power of at least 100 watts is required. Such a large demand for input power suggests that a better method of RF/microwave power generation is required. The price paid for using a linear amplifier where high linearity is unnecessary includes higher initial and operating costs, lower DC-to-RF conversion efficiency, high power consumption, higher power dissipation and the accompanying need for higher capacity heat removal means, and an amplifier that is more prone to parasitic oscillation. The first use of a higher efficiency mode of power generation was described by Baxandall in 1959. This higher efficiency mode, Class-D, is achieved through distinct switching techniques to reduce the power losses associated with switching, conduction, and gate drive losses of a given transistor.

  6. ANALYSIS OF INTERNALLY GENERATED NOISE OF BIOELECTRIC AMPLIFIERS

    Institute of Scientific and Technical Information of China (English)

    MashhourMustafaBaniAmer

    2003-01-01

    This papenr deals with internally generated noise of bioelectric amplifiers that are usually used for processing of bioelectric events.The main purpose of this paper is to present a procedure for analysis of the effects of internal noise generated by the active circuits and to evaluate the output noise of the author's new designed bioelectric amplifier that caused by internal effects to the amplifier circuit itself in order to compare it with the noise generated by conventional amplifiers.The obtained analysis results of internally generated noise showed that the total output noise of bioelectric active circuits does not increase when some of their resitors have a larger value.This behavior is caused by the different transfer functions for the signal and the respective noise sources associated with these resistors.Moreover,the new designed bioelectric amplifier haws an output noise less than that for conventional amplifiers.The obtained analysis results were also experimentally verified and the final conclusions were drawn.

  7. Photonic-Band-Gap Traveling-Wave Gyrotron Amplifier

    Science.gov (United States)

    Nanni, E. A.; Lewis, S. M.; Shapiro, M. A.; Griffin, R. G.; Temkin, R. J.

    2014-01-01

    We report the experimental demonstration of a gyrotron traveling-wave-tube amplifier at 250 GHz that uses a photonic band gap (PBG) interaction circuit. The gyrotron amplifier achieved a peak small signal gain of 38 dB and 45 W output power at 247.7 GHz with an instantaneous −3 dB bandwidth of 0.4 GHz. The amplifier can be tuned for operation from 245–256 GHz. The widest instantaneous −3 dB bandwidth of 4.5 GHz centered at 253.25 GHz was observed with a gain of 24 dB. The PBG circuit provides stability from oscillations by supporting the propagation of transverse electric (TE) modes in a narrow range of frequencies, allowing for the confinement of the operating TE03-like mode while rejecting the excitation of oscillations at nearby frequencies. This experiment achieved the highest frequency of operation for a gyrotron amplifier; at present, there are no other amplifiers in this frequency range that are capable of producing either high gain or high output power. This result represents the highest gain observed above 94 GHz and the highest output power achieved above 140 GHz by any conventional-voltage vacuum electron device based amplifier. PMID:24476286

  8. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  9. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  10. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  11. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  12. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  13. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  14. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  15. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  16. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  17. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  18. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  19. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  20. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  1. Rare Earth Doped Fiber Amplifiers for the First Telecommunication Window

    Science.gov (United States)

    Sridhar, Balakrishnan

    A complete experimental and theoretical study of rare earth doped fiber-optic amplifiers for the first tele-communication window has been made. The thulium doped fluoride fiber amplifier is shown to provide amplification in the 800nm-820nm signal region. A complete steady state theoretical model has been presented and the model has been experimentally verified. The model predicts the gain, noise figure and the amplified spontaneous emission in the 800nm, 1470nm, 1900nm and 2300nm bands. The effect of population trapping at the ^3F_4 energy level of thulium ion is also shown with the help of the model. It has been shown that about 5 -15%o of the population is trapped at the ^3F _4 energy level. We have also shown theoretically, the expected gain and noise performance of Thulium doped fluoride fiber amplifiers pumped in the 680nm absorption band. The maximum gain at 806nm is slightly lower than with comparable 780 nm pumping. The gain bandwidth is however found to increase with 680nm pumping. The higher ASE at shorter wavelengths (flouride fiber amplifier in the 850nm signal band for the first time. The amplification is through an up-conversion process. The erbium doped flouride fiber amplifier was pumped with an estimated pump power of 35mW at 792nm. We have also considered a theoretical model for a single mode erbium doped fluoride fiber amplifier. Efficient amplification occurs because of the strong excited state absorption at the pump wavelength from the ^4I_{13/2} energy level.

  2. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  3. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  4. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  5. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  6. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  7. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  8. Power neodymium-glass amplifier of a repetitively pulsed laser

    Energy Technology Data Exchange (ETDEWEB)

    Vinogradov, Aleksandr V; Gaganov, V E; Garanin, Sergey G; Zhidkov, N V; Krotov, V A; Martynenko, S P; Pozdnyakov, E V; Solomatin, I I [Russian Federal Nuclear Center ' All-Russian Research Institute of Experimental Physics' , Sarov, Nizhnii Novgorod region (Russian Federation)

    2011-11-30

    A neodymium-glass diode-pumped amplifier with a zigzag laser beam propagation through the active medium was elaborated; the amplifier is intended for operation in a repetitively pulsed laser. An amplifier unit with an aperture of 20 Multiplication-Sign 25 mm and a {approx}40-cm long active medium was put to a test. The energy of pump radiation amounts to 140 J at a wavelength of 806 nm for a pump duration of 550 {mu}s. The energy parameters of the amplifier were experimentally determined: the small-signal gain per pass {approx}3.2, the linear gain {approx}0.031 cm{sup -1} with a nonuniformity of its distribution over the aperture within 15%, the stored energy of 0.16 - 0.21 J cm{sup -3}. The wavefront distortions in the zigzag laser-beam propagation through the active element of the amplifier did not exceed 0.4{lambda} ({lambda} = 0.63 {mu}m is the probing radiation wavelength).

  9. Update on Waveguide-Embedded Differential MMIC Amplifiers

    Science.gov (United States)

    Kangaslahti, Pekka; Schleht, Erich

    2010-01-01

    There is an update on the subject matter of Differential InP HEMT MMIC Amplifiers Embedded in Waveguides (NPO-42857) NASA Tech Briefs, Vol. 33, No. 9 (September 2009), page 35. To recapitulate: Monolithic microwave integrated-circuit (MMIC) amplifiers of a type now being developed for operation at frequencies of hundreds of gigahertz contain InP high-electron-mobility transistors (HEMTs) in a differential configuration. The MMICs are designed integrally with, and embedded in, waveguide packages. The instant work does not mention InP HEMTs but otherwise reiterates part of the subject matter of the cited prior article, with emphasis on the following salient points: An MMIC is mounted in the electric-field plane ("E-plane") of a waveguide and includes a finline transition to each differential-amplifier stage. The differential configuration creates a virtual ground within each pair of transistor-gate fingers, eliminating the need for external radio-frequency grounding. This work concludes by describing a single-stage differential submillimeter-wave amplifier packaged in a rectangular waveguide and summarizing results of tests of this amplifier at frequencies of 220 and 305 GHz.

  10. Residual phase noise modeling of amplifiers using silicon bipolar transistors.

    Science.gov (United States)

    Theodoropoulos, Konstantinos; Everard, Jeremy

    2010-03-01

    In this paper, we describe the modeling of residual 1/f phase noise for Si bipolar amplifiers operating in the linear region. We propose that for Si bipolar amplifiers, the 1/f phase noise is largely caused by the base emitter recombination flicker noise. The up-conversion mechanism is described through linear approximation of the phase variation of the amplifier phase response by the variation of the device parameters (C(b)c, C(be), g(m), r(e)) caused by the recombination 1/f noise. The amplifier phase response describes the device over the whole frequency range of operation for which the influence of the poles and zeros is investigated. It is found that for a common emitter amplifier it is sufficient to only incorporate the effect of the device poles to describe the phase noise behavior over most of its operational frequency range. Simulations predict the measurements of others, including the flattening of the PM noise at frequencies beyond f(3dB), not predicted by previous models.

  11. Design and development of digital seismic amplifier recorder

    Energy Technology Data Exchange (ETDEWEB)

    Samsidar, Siti Alaa; Afuar, Waldy; Handayani, Gunawan, E-mail: gunawanhandayani@gmail.com [Department of Physics, ITB (Indonesia)

    2015-04-16

    A digital seismic recording is a recording technique of seismic data in digital systems. This method is more convenient because it is more accurate than other methods of seismic recorders. To improve the quality of the results of seismic measurements, the signal needs to be amplified to obtain better subsurface images. The purpose of this study is to improve the accuracy of measurement by amplifying the input signal. We use seismic sensors/geophones with a frequency of 4.5 Hz. The signal is amplified by means of 12 units of non-inverting amplifier. The non-inverting amplifier using IC 741 with the resistor values 1KΩ and 1MΩ. The amplification results were 1,000 times. The results of signal amplification converted into digital by using the Analog Digital Converter (ADC). Quantitative analysis in this study was performed using the software Lab VIEW 8.6. The Lab VIEW 8.6 program was used to control the ADC. The results of qualitative analysis showed that the seismic conditioning can produce a large output, so that the data obtained is better than conventional data. This application can be used for geophysical methods that have low input voltage such as microtremor application.

  12. Design and development of digital seismic amplifier recorder

    Science.gov (United States)

    Samsidar, Siti Alaa; Afuar, Waldy; Handayani, Gunawan

    2015-04-01

    A digital seismic recording is a recording technique of seismic data in digital systems. This method is more convenient because it is more accurate than other methods of seismic recorders. To improve the quality of the results of seismic measurements, the signal needs to be amplified to obtain better subsurface images. The purpose of this study is to improve the accuracy of measurement by amplifying the input signal. We use seismic sensors/geophones with a frequency of 4.5 Hz. The signal is amplified by means of 12 units of non-inverting amplifier. The non-inverting amplifier using IC 741 with the resistor values 1KΩ and 1MΩ. The amplification results were 1,000 times. The results of signal amplification converted into digital by using the Analog Digital Converter (ADC). Quantitative analysis in this study was performed using the software Lab VIEW 8.6. The Lab VIEW 8.6 program was used to control the ADC. The results of qualitative analysis showed that the seismic conditioning can produce a large output, so that the data obtained is better than conventional data. This application can be used for geophysical methods that have low input voltage such as microtremor application.

  13. Spectroscopic amplifier for pin diode; Amplificador espectroscopico para diodo Pin

    Energy Technology Data Exchange (ETDEWEB)

    Alonso M, M. S.; Hernandez D, V. M.; Vega C, H. R., E-mail: bebe.luna_s@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2014-10-15

    The photodiode remains the basic choice for the photo-detection and is widely used in optical communications, medical diagnostics and field of corpuscular radiation. In detecting radiation it has been used for monitoring radon and its progeny and inexpensive spectrometric systems. The development of a spectroscopic amplifier for Pin diode is presented which has the following characteristics: canceler Pole-Zero (P/Z) with a time constant of 8 μs; constant gain of 57, suitable for the acquisition system; 4th integrator Gaussian order to waveform change of exponential input to semi-Gaussian output and finally a stage of baseline restorer which prevents Dc signal contribution to the next stage. The operational amplifier used is the TLE2074 of BiFET technology of Texas Instruments with 10 MHz bandwidth, 25 V/μs of slew rate and a noise floor of 17 nv/(Hz)1/2. The integrated circuit has 4 operational amplifiers and in is contained the total of spectroscopic amplifier that is the goal of electronic design. The results show like the exponential input signal is converted to semi-Gaussian, modifying only the amplitude according to the specifications in the design. The total system is formed by the detector, which is the Pin diode, a sensitive preamplifier to the load, the spectroscopic amplifier that is what is presented and finally a pulse height analyzer (Mca) which is where the spectrum is shown. (Author)

  14. Design of A Microwave Amplifier for Wireless Application

    Directory of Open Access Journals (Sweden)

    M. H. Ullah

    2012-01-01

    Full Text Available Problem statement: Low-Noise Amplifiers (LNA are very indispensable components in the design of numerous types of communication receivers employed in microwave technology. This paper is presents the design and development of low bias(Vce = 8v, Ic =10 mA single stage low noise microwave amplifier operating in 1.5GHZ frequency range, Gain 13dB ± 0.5dB, input/output return loss Approach: The principal design target is to obtain a minimum noise figure while concomitantly achieving a maximum gain by presenting the optimum noise impedance (Zopt which is characteristically implemented by adding a matching circuit between the source and the input of the amplifier. Results: The proposed low-noise amplifier for microwave wireless application is designed, simulated and optimized using Serenade Harmonica (by Ansoft Corporation and Advance Design System (ADS software by Agilent. Conclusion: In this paper a low-noise amplifier operated at 1.5 GHz. is designed because of the significant roles played in the field of microwave communication technology, which includes the application in the output stage of a transmitter where the signals needs to be strengthen before transmission.

  15. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  16. Lazy AC-Pattern Matching for Rewriting

    OpenAIRE

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  17. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  18. Lazy AC-Pattern Matching for Rewriting

    Directory of Open Access Journals (Sweden)

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  19. The Hubble Legacy Archive ACS Grism Data

    CERN Document Server

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  20. AC susceptibilities of grain-textured superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  1. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  2. Modeling Distortion Effects in Class-D Amplifier Filter Inductors

    DEFF Research Database (Denmark)

    Knott, Arnold; Stegenborg-Andersen, Tore; Thomsen, Ole Cornelius

    2010-01-01

    Distortion is generally accepted as a quantifier to judge the quality of audio power amplifiers. In switchmode power amplifiers various mechanisms influence this performance measure. After giving an overview of those, this paper focuses on the particular effect of the nonlinearity of the output...... filter components on the audio performance. While the physical reasons for both, the capacitor and the inductor induced distortion are given, the practical in depth demonstration is done for the inductor only. This includes measuring the inductors performance, modeling through fitting and resulting...... into simulation models. The fitted models achieve distortion values between 0.03 % and 0.2 % as a basis to enable the design of a 200 W amplifier....

  3. Fiber optical parametric amplifiers in optical communication systems

    DEFF Research Database (Denmark)

    Marhic, Michel E.; Andrekson, Peter A.; Petropoulos, Periklis

    2015-01-01

    The prospects for using fiber optical parametric amplifiers (OPAs) in optical communication systems are reviewed. Phase-insensitive amplifiers (PIAs) and phase-sensitive amplifiers (PSAs) are considered. Low-penalty amplification at/or near 1 Tb/s has been achieved, for both wavelength- and time......-division multiplexed formats. High-quality mid-span spectral inversion has been demonstrated at 0.64 Tb/s, avoiding electronic dispersion compensation. All-optical amplitude regeneration of amplitude-modulated signals has been performed, while PSAs have been used to demonstrate phase regeneration of phase...... in excess of 14,000 Tb/s x km in realistic wavelength-division multiplexed long-haul networks. Technical challenges remaining to be addressed in order for fiber OPAs to become useful for long-haul communication networks are discussed....

  4. Spectrally tailored supercontinuum generation from single-mode-fiber amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Hao, Qiang; Guo, Zhengru; Zhang, Qingshan [Shanghai Key Laboratory of Modern Optical System, Engineering Research Center of Optical Instrument and System (Ministry of Education), School of Optical-Electrical and Computer Engineering, University of Shanghai for Science and Technology, 516 Jungong Road, Shanghai 200093 (China); Liu, Yang; Li, Wenxue [State Key Laboratory of Precision Spectroscopy, East China Normal University, 3663 Zhongshan North Road, Shanghai 200062 (China); Zeng, Heping, E-mail: hpzeng@phy.ecnu.edu.cn [Shanghai Key Laboratory of Modern Optical System, Engineering Research Center of Optical Instrument and System (Ministry of Education), School of Optical-Electrical and Computer Engineering, University of Shanghai for Science and Technology, 516 Jungong Road, Shanghai 200093 (China); State Key Laboratory of Precision Spectroscopy, East China Normal University, 3663 Zhongshan North Road, Shanghai 200062 (China)

    2014-05-19

    Spectral filtering of an all-normal-dispersion Yb-doped fiber laser was demonstrated effective for broadband supercontinuum generation in the picosecond time region. The picosecond pump pulses were tailored in spectrum with 1 nm band-pass filter installed between two single-mode fiber amplifiers. By tuning the spectral filter around 1028 nm, four-wave mixing was initiated in a photonic crystal fiber spliced with single-mode fiber, as manifested by the simultaneous generation of Stokes wave at 1076 nm and anti-Stokes wave at 984 nm. Four-wave mixing took place in cascade with the influence of stimulated Raman scattering and eventually extended the output spectrum more than 900 nm of 10 dB bandwidth. This technique allows smooth octave supercontinuum generation by using simple single-mode fiber amplifiers rather than complicated multistage large-mode-area fiber amplifiers.

  5. Using MEMS Capacitive Switches in Tunable RF Amplifiers

    Directory of Open Access Journals (Sweden)

    Danson John

    2006-01-01

    Full Text Available A MEMS capacitive switch suitable for use in tunable RF amplifiers is described. A MEMS switch is designed, fabricated, and characterized with physical and RF measurements for inclusion in simulations. Using the MEMS switch models, a dual-band low-noise amplifier (LNA operating at GHz and GHz, and a tunable power amplifier (PA at GHz are simulated in m CMOS. MEMS switches allow the LNA to operate with 11 dB of isolation between the two bands while maintaining dB of gain and sub- dB noise figure. MEMS switches are used to implement a variable matching network that allows the PA to realize up to 37% PAE improvement at low input powers.

  6. Theoretical Analysis of Rayleigh Backscattering Noise in Fiber Raman Amplifiers

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    In this paper, a new theoretical model for Rayleigh backscattering (RB) analysis of fiber Raman amplifiers is proposed. The model includes all the interactions among the pumps, signals, and all orders of RB. The results show that the higher order RB has a negligible influence on the performance of the amplifier. The co-propagating and counterpropagating RB power of the signal grow quadratically with the net-gain of the amplifier. The signal to double Rayleigh backscattering noise ratio (OSNRDRB ) of backward-pumped FRAs is better than that of the forward-pumped ones at high net-gain level (> 13 dB), while at low net-gain level the OSNRDrb of the forward-pumped FRAs is slightly better than that of the backward-pumped ones.

  7. How much quantum noise of amplifiers is detrimental to entanglement

    CERN Document Server

    Agarwal, G S

    2009-01-01

    We analyze the effect of the quantum noise of an amplifier on the entanglement properties of an input state. We consider both phase insensitive and phase sensitive amplification and specialize to Gaussian states for which entanglement measures are well developed. In the case of phase insensitive amplification in which both the modes are symmetrically amplified, we find that the entanglement in the output state vanishes if the intensity gain exceeds a limiting value $2/(1+\\exp[-E_N])$ where $E_N$ is the logarithmic negativity of the input state which quantifies the initial entanglement between the two modes. The entanglement between the two modes at the output is found to be more robust if only one mode is amplified.

  8. How much quantum noise of amplifiers is detrimental to entanglement

    Science.gov (United States)

    Agarwal, G. S.; Chaturvedi, S.

    2010-03-01

    We analyze the effect of the quantum noise of an amplifier on the entanglement properties of an input state. We consider both phase insensitive and phase sensitive amplification and specialize to Gaussian states for which entanglement measures are well developed. In the case of phase insensitive amplification in which both the modes are symmetrically amplified, we find that the entanglement in the output state vanishes if the intensity gain exceeds a limiting value 2/(1+exp[-EN]) where EN is the logarithmic negativity of the input state which quantifies the initial entanglement between the two modes. The entanglement between the two modes at the output is found to be more robust if only one mode is amplified.

  9. A novel broadband power amplifier in SiGe HBT technology

    Institute of Scientific and Technical Information of China (English)

    Li Wenyuan; Zhang Qian

    2013-01-01

    A novel broadband power amplifier fabricated in 0.13 μm SiGe HBT technology is realized.The pseudo-differential structure is proposed to avoid the influence of the bonding wire due to the AC virtual ground created at the common emitter node.A compensated matching technique is adopted in interstage matching to expand bandwidth.A multi-stage broadband matching technique is used in an input/output matching network to offer broadband impedance matching,which ensures maximum power transfer.An adaptive bias circuit could improve linearity and efficiency in wide output power level.With 2.5 V power supply,the measured results achieve 96% 3-dB bandwidth (517-1470 MHz),27.2 dB power gain,26.9 dBm maximum output power,19.7 dBm output 1 dB compression point,and 26.7% power added efficiency.

  10. GLASS: The Grism Lens-Amplified Survey From Space. HST Grism Spectroscopy of the Frontier Fields

    Science.gov (United States)

    Schmidt, Kasper B.; Schmidt

    The Grism Lens-Amplified Survey From Space (GLASS) is a 140 orbit spectroscopic survey of 10 massive galaxy clusters, including the six Hubble Frontier Fields. GLASS has observed the cluster cores with the HST-WFC3 G102 and G141 grisms providing a wide wavelength coverage in the near-infrared from roughly 0.8-1.7μm. The parallel fields were observed through the optical ACS G800L grism. Taking advantage of the lensing magnification of the clusters, GLASS reaches intrinsic spectroscopic 1σ flux limits of roughly 10-18erg/s/cm2 and improved spatial resolution for lensed sources behind the clusters. These features are particularly useful for the three main science drivers of GLASS which are, I) exploring the universe at the epoch of reionization, II) describe how metals cycle in and out of galaxies, and III) asses the environmental dependence of galaxy evolution. The former two benefit highly from the improved depth and increased resolution provided by the cluster lensing. Apart from the main science drivers, a slew of ancillary science has been enabled by the survey, including improving cluster lens modeling and searches for supernovae. Here we present the survey and the GLASS data releases, which are continuously being made available to the community through https://archive.stsci.edu/prepds/glass/. For further information we refer to Schmidt et al. (2014), Treu et al. (2015), and http://glass.physics.ucsb.edu.

  11. Optimum design of a hybrid erbium-doped fiber amplifier/fiber Raman amplifier using particle swarm optimization.

    Science.gov (United States)

    Mowla, Alireza; Granpayeh, Nosrat

    2009-02-10

    We propose and optimize a hybrid erbium-doped fiber amplifier/fiber Raman amplifier (EDFA/FRA). A large number of parameters of a wide-band hybrid amplifier consisting of an erbium-doped fiber amplifier (EDFA) and a fiber Raman amplifier (FRA) have been optimized using an effective and fast global optimization method called particle swarm optimization. Two types of hybrid EDFA/FRA with six- and 10-pumped FRAs have been optimized. A large number of variables affect the hybrid EDFA/FRA performance, thus we need a global optimization method to be able to deal with these variables. Particle swarm optimization helps us to find optimum parameters of a hybrid EDFA/FRA and reduce the gain spectrum variations to 2.91 and 2.03 dB for the six and 10 pumped FRAs, respectively. The optimum design supports the amplification of 60 signal channels in the wavelength range of 1529.2-1627.1 nm for a wavelength-division multiplexing system.

  12. A digitally assisted, signal folding neural recording amplifier.

    Science.gov (United States)

    Chen, Yi; Basu, Arindam; Liu, Lei; Zou, Xiaodan; Rajkumar, Ramamoorthy; Dawe, Gavin Stewart; Je, Minkyu

    2014-08-01

    A novel signal folding and reconstruction scheme for neural recording applications that exploits the 1/f(n) characteristics of neural signals is described in this paper. The amplified output is 'folded' into a predefined range of voltages by using comparison and reset circuits along with the core amplifier. After this output signal is digitized and transmitted, a reconstruction algorithm can be applied in the digital domain to recover the amplified signal from the folded waveform. This scheme enables the use of an analog-to-digital convertor with less number of bits for the same effective dynamic range. It also reduces the transmission data rate of the recording chip. Both of these features allow power and area savings at the system level. Other advantages of the proposed topology are increased reliability due to the removal of pseudo-resistors, lower harmonic distortion and low-voltage operation. An analysis of the reconstruction error introduced by this scheme is presented along with a behavioral model to provide a quick estimate of the post reconstruction dynamic range. Measurement results from two different core amplifier designs in 65 nm and 180 nm CMOS processes are presented to prove the generality of the proposed scheme in the neural recording applications. Operating from a 1 V power supply, the amplifier in 180 nm CMOS has a gain of 54.2 dB, bandwidth of 5.7 kHz, input referred noise of 3.8 μVrms and power dissipation of 2.52 μW leading to a NEF of 3.1 in spike band. It exhibits a dynamic range of 66 dB and maximum SNDR of 43 dB in LFP band. It also reduces system level power (by reducing the number of bits in the ADC by 2) as well as data rate to 80% of a conventional design. In vivo measurements validate the ability of this amplifier to simultaneously record spike and LFP signals.

  13. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  14. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  15. Multislice behavioral modeling based on envelope domain for power amplifiers

    Institute of Scientific and Technical Information of China (English)

    Wang Huadong; Bao Jingfu; Wu Zhengde

    2009-01-01

    An envelope domain multislice behavioral modeling is introduced. The tradition AM-AM and AM-PM characteristics of power amplifiers are extended to envelope domain and base-band filter is applied to distortion complex envelope signal for description of the envelope memory effect. Using traditional one and two-tone tests, the coefficients of nonlinear model and the FIR filter can be extracted. At last the model has been applied to a 10 W WCDMA power amplifier to predict its output signal. And simulation results show that the model output conforms very well to the traditional transistor level simulation results.

  16. Solid-state microwave high-power amplifiers

    CERN Document Server

    Sechi, Franco

    2009-01-01

    This practical resource offers expert guidance on the most critical aspects of microwave power amplifier design. This comprehensive book provides descriptions of all the major active devices, discusses large signal characterization, explains all the key circuit design procedures. Moreover you gain keen insight on the link between design parameters and technological implementation, helping you achieve optimal solutions with the most efficient utilization of available technologies. The book covers a broad range of essential topics, from requirements for high-power amplifiers, device models, phas

  17. Superconducting Low-Inductance Undulatory Galvanometer Microwave Amplifier

    OpenAIRE

    Hover, D.; Chen, Y.-F.; Ribeill, G. J.; Zhu, S; Sendelbach, S; McDermott, R.

    2011-01-01

    We describe a microwave amplifier based on the Superconducting Low-inductance Undulatory Galvanometer (SLUG). The SLUG is embedded in a microstrip resonator, and the signal current is injected directly into the device loop. Measurements at 30 mK show gains of 25 dB at 3 GHz and 15 dB at 9 GHz. Amplifier performance is well described by a simple numerical model based on the Josephson junction phase dynamics. We expect optimized devices based on high critical current junctions to achieve gain g...

  18. Genome profiling of ERBB2-amplified breast cancers

    Directory of Open Access Journals (Sweden)

    Ayed Farhat

    2010-10-01

    Full Text Available Abstract Background Around 20% of breast cancers (BC show ERBB2 gene amplification and overexpression of the ERBB2 tyrosine kinase receptor. They are associated with a poor prognosis but can benefit from targeted therapy. A better knowledge of these BCs, genomically and biologically heterogeneous, may help understand their behavior and design new therapeutic strategies. Methods We defined the high resolution genome and gene expression profiles of 54 ERBB2-amplified BCs using 244K oligonucleotide array-comparative genomic hybridization and whole-genome DNA microarrays. Expression of ERBB2, phosphorylated ERBB2, EGFR, IGF1R and FOXA1 proteins was assessed by immunohistochemistry to evaluate the functional ERBB2 status and identify co-expressions. Results First, we identified the ERBB2-C17orf37-GRB7 genomic segment as the minimal common 17q12-q21 amplicon, and CRKRS and IKZF3 as the most frequent centromeric and telomeric amplicon borders, respectively. Second, GISTIC analysis identified 17 other genome regions affected by copy number aberration (CNA (amplifications, gains, losses. The expression of 37 genes of these regions was deregulated. Third, two types of heterogeneity were observed in ERBB2-amplified BCs. The genomic profiles of estrogen receptor-postive (ER+ and negative (ER- ERBB2-amplified BCs were different. The WNT/β-catenin signaling pathway was involved in ER- ERBB2-amplified BCs, and PVT1 and TRPS1 were candidate oncogenes associated with ER+ ERBB2-amplified BCs. The size of the ERBB2 amplicon was different in inflammatory (IBC and non-inflammatory BCs. ERBB2-amplified IBCs were characterized by the downregulated and upregulated mRNA expression of ten and two genes in proportion to CNA, respectively. IHC results showed (i a linear relationship between ERBB2 gene amplification and its gene and protein expressions with a good correlation between ERBB2 expression and phosphorylation status; (ii a potential signaling cross-talk between

  19. Design of Low Noise Microwave Amplifiers Using Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Sadık Ulker

    2012-08-01

    Full Text Available This short paper presents a work on the design of low noise microwave amplifiers using particle swarmoptimization (PSO technique. Particle Swarm Optimization is used as a method that is applied to a singlestage amplifier circuit to meet two criteria: desired gain and desired low noise. The aim is to get the bestoptimized design using the predefined constraints for gain and low noise values. The code is written toapply the algorithm to meet the desired goals and the obtained results are verified using differentsimulators. The results obtained show that PSO can be applied very efficiently for this kind of designproblems with multiple constraints.

  20. A Method To ModifyCorrect The Performance Of Amplifiers

    Directory of Open Access Journals (Sweden)

    Rohith Krishnan R

    2015-01-01

    Full Text Available Abstract The actual response of the amplifier may vary with the replacement of some aged or damaged components and this method is to compensate that problem. Here we use op-amp Fixator as the design tool. The tool helps us to isolate the selected circuit component from rest of the circuit adjust its operating point to correct the performance deviations and to modify the circuit without changing other parts of the circuit. A method to modifycorrect the performance of amplifiers by properly redesign the circuit is presented in this paper.

  1. Design of Low Noise Microwave Amplifiers Using Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Sadık Ülker

    2012-07-01

    Full Text Available This short paper presents a work on the design of low noise microwave amplifiers using particle swarm optimization (PSO technique. Particle Swarm Optimization is used as a method that is applied to a single stage amplifier circuit to meet two criteria: desired gain and desired low noise. The aim is to get the best optimized design using the predefined constraints for gain and low noise values. The code is written to apply the algorithm to meet the desired goals and the obtained results are verified using different simulators. The results obtained show that PSO can be applied very efficiently for this kind of design problems with multiple constraints.

  2. Adaptation of a Digitally Predistorted RF Amplifier Using Selective Sampling

    Institute of Scientific and Technical Information of China (English)

    R. Neil Braithwaite

    2011-01-01

    In this paper, a reduced-cost method of measuring residual nonlinearities in an adaptive digitally predistorted amplifier is proposed. Measurements obtained by selective sampling of the amplifier output are integrated over the input envelope range to adapt a fourth-order polynomial predistorter with memory correction. Results for a WCDMA input with a 101 carrier configuration show that a transmitter using the proposed method can meet the adjacent channel leakage ratio (ACLR) specification. Inverse modeling of the nonlinearity is proposed as a future extension that will reduce the cost of the system further.

  3. High efficiency coherent beam combining of semiconductor optical amplifiers.

    Science.gov (United States)

    Creedon, Kevin J; Redmond, Shawn M; Smith, Gary M; Missaggia, Leo J; Connors, Michael K; Kansky, Jan E; Fan, Tso Yee; Turner, George W; Sanchez-Rubio, Antonio

    2012-12-01

    We demonstrate 40 W coherently combined output power in a single diffraction-limited beam from a one-dimensional 47-element array of angled-facet slab-coupled optical waveguide amplifiers at 1064 nm. The output from each emitter was collimated and overlapped onto a diffractive optical element combiner using a common transform lens. Phase locking was achieved via active feedback on each amplifier's drive current to maximize the power in the combined beam. The combining efficiency at all current levels was nearly constant at 87%.

  4. Traveling-Wave Tube Amplifier for THz Frequencies

    DEFF Research Database (Denmark)

    Kotiranta, Mikko; Krozer, Viktor; Zhurbenko, Vitaliy

    tubes and gas lasers, but the ones available are too expensive or large for many applications. This work is related to the European project OPTHER (Optically driven terahertz amplifiers) which aims to realise a compact, powerful and efficient vacuum tube amplifier for the frequency range of 0.3 – 2......The lack of a compact and powerful terahertz source has been hindering the application of terahertz radiation in many fields. Frequency multipliers can be used in conjunction with an electronic solid-state source to obtain power levels up to around 1 mW. A higher power may be generated with vacuum...

  5. Tapered amplifier laser with frequency-shifted feedback

    CERN Document Server

    Bayerle, A; Vlaar, P; Pasquiou, B; Schreck, F

    2016-01-01

    We present a frequency-shifted feedback (FSF) laser based on a tapered amplifier. The laser operates as a coherent broadband source with up to 370GHz spectral width and 2.3us coherence time. If the FSF laser is seeded by a continuous-wave laser a frequency comb spanning the output spectrum appears in addition to the broadband emission. The laser has an output power of 280mW and a center wavelength of 780nm. The ease and flexibility of use of tapered amplifiers makes our FSF laser attractive for a wide range of applications, especially in metrology.

  6. PHEMT Distributed Power Amplifier Adopting Broadband Impedance Transformer

    DEFF Research Database (Denmark)

    Narendra, K.; Limiti, E.; Paoloni, C.;

    2013-01-01

    A non-uniform drain line distributed power amplifier (DPA) employing a broadband impedance transformer is presented. The DPA is based on GaAs PHEMT technology. The impedance transformer employs asymmetric coupled lines and transforms a low output impedance of the amplifier to a standard 50 Ω tran...... transmission line. The output power of approximately 600 mW, with an associated gain of 9 dB and PAE greater than 30 percent, is demonstrated in the frequency range from 10 to 1800 MHz....

  7. Two-stage series array SQUID amplifier for space applications

    Science.gov (United States)

    Tuttle, J. G.; DiPirro, M. J.; Shirron, P. J.; Welty, R. P.; Radparvar, M.

    We present test results for a two-stage integrated SQUID amplifier which uses a series array of d.c. SQUIDS to amplify the signal from a single input SQUID. The device was developed by Welty and Martinis at NIST and recent versions have been manufactured by HYPRES, Inc. Shielding and filtering techniques were employed during the testing to minimize the external noise. Energy resolution of 300 h was demonstrated using a d.c. excitation at frequencies above 1 kHz, and better than 500 h resolution was typical down to 300 Hz.

  8. Dispersion-Engineered Traveling Wave Kinetic Inductance Parametric Amplifier

    Science.gov (United States)

    Zmuidzinas, Jonas (Inventor); Day, Peter K. (Inventor)

    2014-01-01

    A traveling wave kinetic inductance parametric amplifier comprises a superconducting transmission line and a dispersion control element. The transmission line can include periodic variations of its dimension along its length. The superconducting material can include a high normal state resistivity material. In some instances the high normal state resistivity material includes nitrogen and a metal selected from the group consisting of titanium, niobium and vanadium. The traveling wave kinetic inductance parametric amplifier is expected to exhibit a noise temperature below 100 mK/GHz.

  9. The Modulation Response of a Semiconductor Laser Amplifier

    DEFF Research Database (Denmark)

    Mørk, Jesper; Mecozzi, Antonio; Eisenstein, Gadi

    1999-01-01

    We present a theoretical analysis of the modulation response of a semiconductor laser amplifier. We find a resonance behavior similar to the well-known relaxation oscillation resonance found in semiconductor lasers, but of a different physical origin. The role of the waveguide (scattering) loss...... are analyzed. The nonlinear transparent waveguide, i.e. an amplifier saturated to the point where the stimulated emission balances the internal losses, is shown to be analytically solvable and is a convenient vehicle for gaining qualitative understanding of the dynamics of modulated semiconductor optical...

  10. High-power phase locking of a fiber amplifier array

    Science.gov (United States)

    Shay, T. M.; Baker, J. T.; Sanchez, A. D.; Robin, C. A.; Vergien, C. L.; Zeringue, C.; Gallant, D.; Lu, Chunte A.; Pulford, Benjamin; Bronder, T. J.; Lucero, Arthur

    2009-02-01

    We report high power phase locked fiber amplifier array using the Self-Synchronous Locking of Optical Coherence by Single-detector Electronic-frequency Tagging technique. We report the first experimental results for a five element amplifier array with a total locked power of more than 725-W. We will report on experimental measurements of the phase fluctuations versus time when the control loop is closed. The rms phase error was measured to be λ/60. Recent results will be reported. To the best of the authors' knowledge this is the highest fiber laser power to be coherently combined.

  11. Gain dynamics and saturation in semiconductor quantum dot amplifiers

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper; Hvam, Jørn Märcher

    2004-01-01

    Quantum dot (QD)-based semiconductor optical amplifiers offer unique properties compared with conventional devices based on bulk or quantum well material. Due to the bandfilling properties of QDs and the existence of a nearby reservoir of carriers in the form of a wetting layer, QD semiconductor...... carrier populations in terms of a simple rate equation model. Based on the steady-state and small-signal properties of the model, we analyse and discuss the optical modulation response and the four-wave mixing properties of QD semiconductor optical amplifiers, in particular emphasizing the role...

  12. Nonlinear carrier dynamics in a quantum dash optical amplifier

    DEFF Research Database (Denmark)

    Hansen, Per Lunnemann; Ek, Sara; Yvind, Kresten;

    2012-01-01

    Results of experimental pump-probe spectroscopy of a quantum dash optical amplifier biased at transparency are presented. Using strong pump pulses we observe a competition between free carrier absorption and two-photon induced stimulated emission that can have drastic effects on the transmission...... dynamics. Thus, both enhancement as well as suppression of the transmission can be observed even when the amplifier is biased at transparency. A simple theoretical model taking into account two-photon absorption and free carrier absorption is presented that shows good agreement with the measurements....

  13. Amplifier input impedance in dry electrode ECG recording.

    Science.gov (United States)

    Assambo, Cedric; Burke, Martin J

    2009-01-01

    This paper presents a novel approach for designing the front-end of instrumentation amplifiers for use in dry electrode recording of the human electrocardiogram (ECG). The method relies on information provided by the characterization of the skin-electrode interface and the analysis of low frequency ECG criteria defined by international standards. Marginal measurements of capacitive elements of the skin-electrode interface as small as 0.01 microF, suggest values of input impedance in the order of 1.3 GOmega. However, results in 99% of the data analyzed indicate that a recording amplifier providing an input impedance of 500 MOmega should ensure clear signal sensing without distortion.

  14. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  15. Accurate simulation of Raman amplified lightwave synthesized frequency sweeper

    DEFF Research Database (Denmark)

    Pedersen, Anders Tegtmeier; Olesen, Anders Sig; Rottwitt, Karsten

    2011-01-01

    A lightwave synthesized frequency sweeper using a Raman amplifier for loss compensation is presented together with a numerical model capable of predicting the shape of individual pulses as well as the overall envelope of more than 100 pulses. The generated pulse envelope consists of 116 pulses...

  16. Use of semiconductor optical amplifiers in signal processing applications

    OpenAIRE

    Manning, Robert J.; Webb, Rod P.; Dailey, James M.; Maxwell, Graeme D.; Poustie, Alistair J.; Lardenois, Sébastien; Cotter, David

    2010-01-01

    We describe a 42.6 Gbit/s all-optical pattern recognition system which uses semiconductor optical amplifiers (SOAs). A circuit with three SOA-based logic gates is used to identify the presence of specific port numbers in an optical packet header.

  17. Asymmetric gain-saturated spectrum in fiber optical parametric amplifiers

    DEFF Research Database (Denmark)

    Lali-Dastjerdi, Zohreh; Rottwitt, Karsten; Galili, Michael

    2012-01-01

    We demonstrate experimentally and numerically an unexpected spectral asymmetry in the saturated-gain spectrum of single-pump fiber optical parametric amplifiers. The interaction between higher-order four-wave mixing products and dispersive waves radiated as an effect of third-order dispersion...

  18. Optimum design of Nd-doped fiber optical amplifiers

    DEFF Research Database (Denmark)

    Rasmussen, Thomas; Bjarklev, Anders Overgaard; Lumholt, Ole

    1992-01-01

    The waveguide parameters for a Nd-doped fluoride (Nd:ZBLANP) fiber amplifier have been optimized for small-signal and booster operation using an accurate numerical model. The optimum cutoff wavelength is shown to be 800 nm and the numerical aperture should be made as large as possible. Around 80...

  19. Maximally Flat Waveforms Operation of Class-F Power Amplifiers

    Directory of Open Access Journals (Sweden)

    V. Krizhanovski

    2001-04-01

    Full Text Available The requirements to output network's impedance on higher harmoniccomponents and appropriate input driving for formation maximally flatwaveforms of drain current and voltage were presented. Using suchwaveforms allows obtaining maximal efficiency and output powercapability of class-F power amplifiers.

  20. A CMOS low-noise instrumentation amplifier using chopper modulation

    DEFF Research Database (Denmark)

    Nielsen, Jannik Hammel; Bruun, Erik

    2005-01-01

    This paper describes a low-power, low-noise chopper stabilized CMOS instrumentation amplifier for biomedical applications. Low thermal noise is achieved by employing MOSTs biased in the weak/moderate inversion region, whereas chopper stabilization is utilized to shift 1/f-noise out of the signal...

  1. Frequency resolved transverse mode instability in rod fiber amplifiers

    DEFF Research Database (Denmark)

    Johansen, Mette Marie; Laurila, Marko; Maack, Martin D.

    2013-01-01

    Frequency dynamics of transverse mode instabilities (TMIs) are investigated by testing three 285/100 rod fibers in a single-pass amplifier setup reaching up to ~200W of extracted output power without beam instabilities. The pump power is increased well above the TMI threshold to uncover output...

  2. Flash-lamp-pumped picosecond Nd:YAG regenerative amplifier

    Institute of Scientific and Technical Information of China (English)

    Bingyuan Zhang; Gang Li; Meng Chen; Guoju Wang; Yonggang Wang; Xiaoyu Ma

    2005-01-01

    @@ A flash-lamp-pumped Nd:YAG regenerative amplifier has been developed at 1.06 μm, seeded with 10-ps pulses from a diode-end-pumped and mode-locked Nd:YAG oscillator with homemade semiconductor saturable absorber mirror(SESAM).

  3. Low-Noise MMIC Amplifiers for 120 to 180 GHz

    Science.gov (United States)

    Pukala, David; Samoska, Lorene; Peralta, Alejandro; Bayuk, Brian; Grundbacher, Ron; Oliver, Patricia; Cavus, Abdullah; Liu, Po-Hsin

    2009-01-01

    Three-stage monolithic millimeter-wave integrated-circuit (MMIC) amplifiers capable of providing useful amounts of gain over the frequency range from 120 to 180 GHz have been developed as prototype low-noise amplifiers (LNAs) to be incorporated into instruments for sensing cosmic microwave background radiation. There are also potential uses for such LNAs in electronic test equipment, passive millimeter- wave imaging systems, radar receivers, communication receivers, and systems for detecting hidden weapons. The main advantage afforded by these MMIC LNAs, relative to prior MMIC LNAs, is that their coverage of the 120-to-180-GHz frequency band makes them suitable for reuse in a wider variety of applications without need to redesign them. Each of these MMIC amplifiers includes InP transistors and coplanar waveguide circuitry on a 50- mthick chip (see Figure 1). Coplanar waveguide transmission lines are used for both applying DC bias and matching of input and output impedances of each transistor stage. Via holes are incorporated between top and bottom ground planes to suppress propagation of electromagnetic modes in the substrate. On the basis of computational simulations, each of these amplifiers was expected to operate with a small-signal gain of 14 dB and a noise figure of 4.3 dB. At the time of writing this article, measurements of noise figures had not been reported, but on-chip measurements had shown gains approaching their simulated values (see Figure 2).

  4. Detailed design analysis of erbium-doped fiber amplifiers

    DEFF Research Database (Denmark)

    Pedersen, Bo; Bjarklev, Anders Overgaard; Lumholt, Ole

    1991-01-01

    When pumping the erbium-doped fiber amplifier at 0.98 and 1.48 mu m, the optimum cutoff wavelength for step profiles with arbitrary numerical aperture is shown to be 0.80 and 0.90 mu m, respectively. The use of a confined erbium profile can improve the gain coefficient up to 45%. The index raising...

  5. Differential cyclic voltammetry for selective and amplified detection

    NARCIS (Netherlands)

    Megen, M.J.J; Odijk, M.; Wiedemair, J.; Olthuis, W.; Berg, van den A.

    2012-01-01

    We propose to combine two existing electrochemical techniques, cyclic voltammetry (CV) and redox cycling (RC), in order to obtain amplified and selective detection of redox active species. This combination is achieved by applying CV waveforms to two electrodes spaced 1.20 mu m apart, with one of the

  6. Recent advances in semiconductor optical amplifiers and their applications

    DEFF Research Database (Denmark)

    Stubkjær, Kristian; Mikkelsen, Benny; Djurhuus, Torsten;

    1992-01-01

    The authors review recent advances in SOAs (semiconductor optical amplifiers) and some of their applications. SOAs are under rapid development to achieve polarization independent gain, low facet reflectivities, good coupling to optical fibers, and high saturation power. The package SOA can be made...

  7. Efficiency Optimization in Class-D Audio Amplifiers

    DEFF Research Database (Denmark)

    Yamauchi, Akira; Knott, Arnold; Jørgensen, Ivan Harald Holger;

    2015-01-01

    This paper presents a new power efficiency optimization routine for designing Class-D audio amplifiers. The proposed optimization procedure finds design parameters for the power stage and the output filter, and the optimum switching frequency such that the weighted power losses are minimized unde...

  8. Multi Carrier Modulator for Switch-Mode Audio Power Amplifiers

    DEFF Research Database (Denmark)

    Knott, Arnold; Pfaffinger, Gerhard; Andersen, Michael Andreas E.

    2008-01-01

    While switch-mode audio power amplifiers allow compact implementations and high output power levels due to their high power efficiency, they are very well known for creating electromagnetic interference (EMI) with other electronic equipment, in particular radio receivers. Lowering the EMI of swit...

  9. Minimizing Crosstalk in Self Oscillating Switch Mode Audio Power Amplifiers

    DEFF Research Database (Denmark)

    Knott, Arnold; Ploug, Rasmus Overgaard

    2012-01-01

    The varying switching frequencies of self oscillating switch mode audio amplifiers have been known to cause interchannel intermodulation disturbances in multi channel configurations. This crosstalk phenomenon has a negative impact on the audio performance. The goal of this paper is to present a m...

  10. Multilevel inverter based class D audio amplifier for capacitive transducers

    DEFF Research Database (Denmark)

    Nielsen, Dennis; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    The reduced semiconductor voltage stress makes the multilevel inverters especially interesting, when driving capacitive transducers for audio applications. A ± 300 V flying capacitor class D audio amplifier driving a 100 nF load in the midrange region of 0.1-3.5 kHz with Total Harmonic Distortion...

  11. Current-Driven Switch-Mode Audio Power Amplifiers

    DEFF Research Database (Denmark)

    Knott, Arnold; Buhl, Niels Christian; Andersen, Michael A. E.

    2012-01-01

    The conversion of electrical energy into sound waves by electromechanical transducers is proportional to the current through the coil of the transducer. However virtually all audio power amplifiers provide a controlled voltage through the interface to the transducer. This paper is presenting a sw...

  12. A wide-band Gunn-effect CW waveguide amplifier.

    Science.gov (United States)

    Sene, A.; Rosenbaum, F. J.

    1972-01-01

    Broad-band CW amplification with Gunn diodes in waveguide circuits has been obtained, with power gains typically between 10 and 15 dB and half-power bandwidths of more than 1 GHz. It is found that amplifier performance can be modeled with fair accuracy using a rough characterization for the diode parameters.

  13. Quantum dot amplifiers with high output power and low noise

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Mørk, Jesper

    2003-01-01

    Quantum dot semiconductor optical amplifiers have been theoretically investigated and are predicted to achieve high saturated output power, large gain, and low noise figure. We discuss the device dynamics and, in particular, show that the presence of highly inverted barrier states does not limit ...

  14. Giant Geometrically Amplified Piezoresistance in Metal-Semiconductor Hybrid Resistors

    DEFF Research Database (Denmark)

    Hansen, Ole; Reck, Kasper; Thomsen, Erik Vilain

    2008-01-01

    We show that very high geometrically amplified piezoresistance can indeed be obtained in microstructured metal-semiconductor hybrid devices, even significantly higher amplification factors than the factor of approximately 8 demonstrated recently by Rowe and co-workers may be achieved. However, we...

  15. Compact, Single-Stage MMIC InP HEMT Amplifier

    Science.gov (United States)

    Pukala, David; Samoska, Lorene; Fung, King Man; Gaier, Todd; Deal, W. R.; Mei, Gerry; Radisic, Vesna; Lai, Richard

    2008-01-01

    A monolithic micro - wave integrated-circuit (MMIC) singlestage amplifier containing an InP-based high-electron-mobility transistor (HEMT) plus coplanar-waveguide (CPW) transmission lines for impedance matching and input and output coupling, all in a highly miniaturized layout as needed for high performance at operating frequencies of hundreds of gigahertz is described.

  16. 2R Regeneration in Concatenated Semiconductor Optical Amplifiers and Electroabsorbers

    DEFF Research Database (Denmark)

    Christiansen, Lotte Jin; Xu, Lin; Yvind, Kresten;

    2004-01-01

    We present a novel 2R regenerator with a large level separation and steep step a sharp, adjustable threshold based on concatenated semiconductor optical amplifiers and electroabsorbers. We demonstrate demonstrate improvements in both extinction-ratio and BER sensitivity atfor a 10 Gb/s NRZ signal....

  17. An Artefact suppressing fast-recovery myoelectric amplifier

    NARCIS (Netherlands)

    Thorsen, R.

    1999-01-01

    An amplifier for recording myoelectric signals using surface electrodes has been developed. The special features are suppression of stimulation artefacts and motion artefacts from electrodes. It is designed for recording of myoelectric signals from a muscle that is being stimulated with short impuls

  18. HTS dc SQUID based rf amplifier: development concept

    DEFF Research Database (Denmark)

    Prokopenko, G.V.; Shitov, S.V.; Borisenko, I.V.;

    2002-01-01

    We present a concept of a rf amplifier based on a directly coupled dc SQUID with bicrystal junctions, which have high saturation power and can be used with SIS mixers or possibly for satellite and cellular phone communications. A novel input resonant circuit is proposed using single layer of HTS...

  19. Output impedance and stability of audio power amplifiers

    NARCIS (Netherlands)

    Schaink, T.

    2006-01-01

    This report is about the design of an audio amplifier which is stable for all passive loads. If stability analysis of an opamp is done, the ‘classical’ approach is to derive its transfer function. Investigation of the open loop gain and a phase/gain margin determine the stability of the opamp. Desig

  20. FDML swept source at 1060 nm using a tapered amplifier

    DEFF Research Database (Denmark)

    Marschall, Sebastian; Klein, Thomas; Wieser, Wolfgang;

    2010-01-01

    in this wavelength range. We demonstrate that a tapered amplifier can be integrated into a fiber-based swept source and allows for high-speed FDML operation. The developed light source operates at a sweep rate of 116kHz with an effective average output power in excess of 30mW. With a total sweep range of 70 nm...

  1. The spectacular human nose: an amplifier of individual quality?

    Directory of Open Access Journals (Sweden)

    Åse Kristine Rognmo Mikalsen

    2014-04-01

    Full Text Available Amplifiers are signals that improve the perception of underlying differences in quality. They are cost free and advantageous to high quality individuals, but disadvantageous to low quality individuals, as poor quality is easier perceived because of the amplifier. For an amplifier to evolve, the average fitness benefit to the high quality individuals should be higher than the average cost for the low quality individuals. The human nose is, compared to the nose of most other primates, extraordinary large, fragile and easily broken—especially in male–male interactions. May it have evolved as an amplifier among high quality individuals, allowing easy assessment of individual quality and influencing the perception of attractiveness? We tested the latter by manipulating the position of the nose tip or, as a control, the mouth in facial pictures and had the pictures rated for attractiveness. Our results show that facial attractiveness failed to be influenced by mouth manipulations. Yet, facial attractiveness increased when the nose tip was artificially centered according to other facial features. Conversely, attractiveness decreased when the nose tip was displaced away from its central position. Our results suggest that our evaluation of attractiveness is clearly sensitive to the centering of the nose tip, possibly because it affects our perception of the face’s symmetry and/or averageness. However, whether such centering is related to individual quality remains unclear.

  2. Estimating modal instability threshold for photonic crystal rod fiber amplifiers

    DEFF Research Database (Denmark)

    Johansen, Mette Marie; Hansen, Kristian Rymann; Laurila, Marko;

    2013-01-01

    We present a semi-analytic numerical model to estimate the transverse modal instability (TMI) threshold for photonic crystal rod amplifiers. The model includes thermally induced waveguide perturbations in the fiber cross section modeled with finite element simulations, and the relative intensity...

  3. Spatial and spectral imaging of LMA photonic crystal fiber amplifiers

    DEFF Research Database (Denmark)

    Laurila, Marko; Lægsgaard, Jesper; Alkeskjold, Thomas Tanggaard;

    2011-01-01

    We demonstrate modal characterization using spatial and spectral resolved (S2) imaging, on an Ytterbium-doped large-mode-area photonic crystal fiber (PCF) amplifier and compare results with conventional cut-off methods. We apply numerical simulations and step-index fiber experiments to calibrate ...

  4. Theory of the singly quasidegenerate Josephson junction parametric amplifier

    DEFF Research Database (Denmark)

    Sørensen, O.H.; Dueholm, B.; Mygind, Jesper;

    1980-01-01

    as incident thermal radiation is included in the discussion. It is shown that the noise temperature is virtually independent of noise injected from external sources and that minimum noise temperature is automatically achieved if the amplifier is tuned to maximize the gain-bandwidth product. The analytical...

  5. The Gain Dependence of the Power Transient in Raman Amplifier

    Institute of Scientific and Technical Information of China (English)

    Zheng Lei; Zhang Jiahong; Chen Zhangyuan; Wu Deming; Xu Anshi

    2003-01-01

    It is observed that the amplitude of the power transient overshoot depends on the gain of the amplifier when the input signal powers are the same. The other system parameters, such as the input pump power and fiber length, have no effects on it.

  6. Analysis of Power Amplifier Modeling Schemes for Crosscorrelation Predistorters

    NARCIS (Netherlands)

    Kokkeler, Andre B.J.

    2004-01-01

    Amplification of signals with fluctuating envelopes leads to distortion because of non-linear behavior of the Power Amplifier (PA). Digital Predistortion can counteract these non-linear effects. A crosscorrelation predistorter is a digital predistorter, based on the calculation of crosscorrelation f

  7. Dynamic deviation Volterra predistorter designed for linearizing power amplifiers

    OpenAIRE

    2011-01-01

    Polynomial models of predistorter combined by the "black box" principle have been considered. A Volterra model using one-dimensional dynamic deviation was proposed. An adaptive predistorter was synthesized for linearizing the Wiener–Hammerstein model of power amplifiers. Estimates of the linearization accuracy and a comparative analysis of predistorter models were also presented.

  8. Multi Carrier Modulation Audio Power Amplifier with Programmable Logic

    DEFF Research Database (Denmark)

    Christiansen, Theis; Andersen, Toke Meyer; Knott, Arnold

    2009-01-01

    While switch-mode audio power amplifiers allow compact implementations and high output power levels due to their high power efficiency, they are very well known for creating electromagnetic interference (EMI) with other electronic equipment. To lower the EMI of switch-mode (class D) audio power a...

  9. Prototype Small Footprint Amplifier for Piezoelectric Deformable Mirrors

    Science.gov (United States)

    Caputa, Kris; Herriot, Glen; Niebergal, Joel; Zielinski, Adam

    2011-09-01

    AO subsystems of the ELT observatories will incorporate deformable mirrors with an order of magnitude larger number of piezoelectric actuators than the AO systems currently deployed. Simply scaling up the drive electronics that are presently available commercially would substantially drive up the AO cost, pose unacceptably high demands for the supply power and heat dissipation, and occupy large physical volume. We have set out to prototype a high voltage amplifier that is compact enough to allow packaging 100 amplifier channels on a single 6U Eurocard with the goal to have a DM drive channel density of 1200 per 6U VME crate. Individual amplifier circuits should be driven by a multichannel A/D converter, consume no more than 0.5W from the +/-400V power supply, be slew rate limited in hardware, and be short-circuit protected. The component cost should be an order of magnitude less than the integrated circuit high voltage amplifiers currently on the market. We started out with modeling candidate circuits in SPICE, then built physical prototypes using inexpensive off the shelf components. In this paper we present experimental results of exposing several prototype circuits to both normal operating conditions and foreseeable fault conditions. The performance is evaluated against the AO requirements for the output range and bandwidth and the DM actuator safety requirements.

  10. Organic solid-state integrated amplifiers and lasers

    NARCIS (Netherlands)

    Grivas, Christos; Pollnau, Markus

    2012-01-01

    Solid-state organic amplifiers and lasers are attractive for hybrid integration due to their compatibility with different material platforms, straightforward processing, and possibility to optimize easily their optical and electronic properties by molecular engineering. Advances in the gain medium d

  11. K-Band Traveling-Wave Tube Amplifier

    Science.gov (United States)

    Force, Dale A.; Simons, Rainee N.; Peterson, Todd T.; Spitsen, Paul C.

    2010-01-01

    A new space-qualified, high-power, high-efficiency, K-band traveling-wave tube amplifier (TWTA) will provide high-rate, high-capacity, direct-to-Earth communications for science data and video gathered by the Lunar Reconnaissance Orbiter (LRO) during its mission. Several technological advances were responsible for the successful demonstration of the K-band TWTA.

  12. Single-mode operation of a coiled multimode fiber amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Jeffrey P. Koplow; Dahv A. V. Kliner; Lew Goldberg

    2000-01-19

    The authors report a new approach to obtain single-transverse-mode operation of a multimode fiber amplifier, in which the gain fiber is coiled to induce significant bend loss for all but the lowest-order mode. They have demonstrated this method by constructing a coiled amplifier using Yb-doped, double-clad fiber with a core diameter of 25 {micro}m and NA of {minus}0.1 (V {approx} 7.4). When operated as an ASE source, the output beam had an M{sup 2} value of 1.09 {+-} 0.09; when seeded at 1,064 nm, the slope efficiency was similar to that of an uncoiled amplifier. This technique does not require exotic fiber designs or increase system complexity and is inexpensive to implement. It will allow scaling of pulsed fiber lasers and amplifiers to significantly higher pulse energies and peak powers and cw fiber sources to higher average powers while maintaining excellent beam quality.

  13. Sexing birds using random amplified polymorphic DNA (RAPD) markers

    NARCIS (Netherlands)

    Lessells, C.M.; Mateman, A.C.

    1998-01-01

    We used random amplified polymorphic DNA (RAPD) markers to sex birds from small tissue (usually blood) samples. Arbitrarily chosen 10-mer PCR primers were screened with DNA from known-sex individuals for the production of a bright female-specific band. Suitable primers were found for seven bird spec

  14. The Pathological and Physiological Roles of IL-6 Amplifier Activation

    Directory of Open Access Journals (Sweden)

    Masaaki Murakami, Toshio Hirano

    2012-01-01

    Full Text Available The NFκB-triggered positive feedback loop for IL-6 signaling in type 1 collagen+ non-immune cells (IL-6 amplifier was first discovered to be a synergistic signal that is activated following IL-17A and IL-6 stimulation in type 1 collagen+ non-immune cells. Subsequent disease models have shown that it can also be stimulated by the simultaneous activation of NFκB and STAT3, functions as a local chemokine inducer, and acts as a mechanism for local inflammation, particularly chronic ones like rheumatoid arthritis and a multiple sclerosis. Moreover, we have recently shown that hyper activation of the IL-6 amplifier via regional neural activation establishes a gateway for immune cells including autoreactive T cells to pass the blood-brain barrier at dorsal vessels in 5th lumbar cord. Here we review how the IL-6 amplifier is activated by neural activation and the physiological relevance of the gateway to the central nervous system. Accumulating evidences continues to suggest that the IL-6 amplifier offers a potential molecular mechanism for the relationship between neural activation and the development of inflammatory diseases, which could establish a new interdisciplinary field that fuses neurology and immunology.

  15. Amplifiers dedicated for large area SiC photodiodes

    Science.gov (United States)

    Doroz, P.; Duk, M.; Korwin-Pawlowski, M. L.; Borecki, M.

    2016-09-01

    Large area SiC photodiodes find applications in optoelectronic sensors working at special conditions. These conditions include detection of UV radiation in harsh environment. Moreover, the mentioned sensors have to be selective and resistant to unwanted signals. For this purpose, the modulation of light at source unit and the rejection of constant current and low frequency component of signal at detector unit are used. The popular frequency used for modulation in such sensor is 1kHz. The large area photodiodes are characterized by a large capacitance and low shunt resistance that varies with polarization of the photodiode and can significantly modify the conditions of signal pre-amplification. In this paper two pre-amplifiers topology are analyzed: the transimpedance amplifier and the non-inverting voltage to voltage amplifier with negative feedback. The feedback loops of both pre-amplifiers are equipped with elements used for initial constant current and low frequency signals rejections. Both circuits are analyzed and compared using simulation and experimental approaches.

  16. Phase noise measurement of high-power fiber amplifiers

    Institute of Scientific and Technical Information of China (English)

    Hu Xiao; Xiaolin Wang; Yanxing Ma; Bing He; Pu Zhou; Jun Zhou; Xiaojun Xu

    2011-01-01

    We measure the phase fluctuation in a high-power fiber amplifier using a multi-dithering technique. Its fluctuation property is qualitatively analyzed by the power spectral density and integrated spectral density.Low frequency fluctuations caused by the environment are dominant in the phase fluctuations in an amplifier, whereas the high frequency components related to laser power affect the control bandwidth. The bandwidth requirement of the active phase-locking is calculated to be 300 Hz, 670 Hz, 1.6 kHz, and 3.9 kHz under the output power of 25,55, 125, and 180W, respectively. The approximately linear relationship between the control bandwidth and laser power needs to be further investigated.%@@ We measure the phase fluctuation in a high-power fiber amplifier using a multi-dithering technique.Its fluctuation property is qualitatively analyzed by the power spectral density and integrated spectral density.Low frequency fluctuations caused by the environment are dominant in the phase fluctuations in an am-plifier, whereas the high frequency components related to laser power affect the control bandwidth.The bandwidth requirement of the active phase-locking is calculated to be 300 Hz, 670 Hz, 1.6 kHz, and 3.9kHz under the output power of 25, 55, 125, and 180 W, respectively.The approximately linear relationship between the control bandwidth and laser power needs to be further investigated.

  17. Noise Shaping Filter Compensating PWM Distortion for Fully Digital Amplifier

    Science.gov (United States)

    Yoneya, Akihiko

    The full-digital audio amplifiers have several merits such as a high power enabling a small size of the amplifier and digital implementation of the signal processing which allows desired precision of the processing except for the final stage switching amplifiers. Unfortunately, the pulse width modulation (PWM) causes signal distortions because of the non-linearity of the modulation from the viewpoint of the transient response. This paper proposes a compensation method of the PWM distortion with feedback approach. In the noise-shaping filter of the delta-sigma modulator to calculate the pulse codes for the PWM, the distortion caused by the PWM is evaluated and fed it back to compensate the distortion. Eventually the filter is implemented as a state-variable filter with non-linear feedback from the quantizer. The calculation of the filter elements is also described. By using proposed filters, PWM signals with small distortions and small floor noise can be obtained to realize high-fidelity audio amplifiers.

  18. Semiconductor quantum dot amplifiers for optical signal processing

    DEFF Research Database (Denmark)

    Berg, Tommy Winther; Uskov, A. V.; Bischoff, Svend

    2001-01-01

    The dynamics of quantum dot semiconductor amplifiers are investigated theoretically with respect to the potential for ultrafast signal processing. The high-speed signal processing capacity of these devices is found to be limited by the wetting layer dynamics in case of electrical pumping, while...

  19. Accurate nine-decade temperature-compensated logarithmic amplifier

    Science.gov (United States)

    Bobis, J. P.; Mc Dowell, W. P.; Paul, V. M.

    1969-01-01

    Transistor-driven temperature-stable amplifier with logarithmic operating characteristics permits presentation of the entire range of the reactor without range switching. This circuit is capable of monitoring ion chamber currents over spans of 8 or 9 decades and is used in nuclear reactor instrumentation. Application is found in materials under ultrahigh vacuum.

  20. A European Project on Vacuum Tube Amplifiers for THz Amplification

    DEFF Research Database (Denmark)

    Paoloni, Claudio; Di Carlo, Aldo; Brunetti, Francesca

    2012-01-01

    The OPTHER (Optically Driven THz amplifier) project supported by the European Commission within the Seventh Framework Program (FP7) represents the first joint European attempt to realize vacuum electron devices in THz range. The target of the project was to design and realize the first 1 THz vacu...

  1. Amplifiers Module Prototype for the Johnson Noise Thermometry System

    Energy Technology Data Exchange (ETDEWEB)

    Britton Jr, Charles L [ORNL; Bull, Nora D [ORNL; Roberts, Michael [ORNL

    2013-06-01

    This document is intended to summarize the development and testing of the amplifier module portion of the Johnson Noise Thermometry (JNT) system developed at ORNL. The proposed system has been presented in an earlier report [1]. A more extensive project background including the project rationale is available in the initial project report [2].

  2. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  3. Ways to suppress click and pop for class D amplifiers

    Institute of Scientific and Technical Information of China (English)

    Wang Haishi; Zhang Bo; Sun Jiang

    2012-01-01

    Undesirable audio click and pop may be generated in a speaker or headphone.Compared to linear (class A/B/AB) amplifiers,class D amplifiers that comprise of an input stage and a modulation stage are more prone to producing click and pop.This article analyzes sources that generate click and pop in class D amplifiers,and corresponding ways to suppress them.For a class D amplifier with a single-ended input,click and pop is likely to be due to two factors.One is from a voltage difference (VDIF) between the voltage of an input capacitance (VCIN)and a reference voltage (VREF) of the input stage,and the other one is from the non-linear switching during the setting up of the bias and feedback voltages/currents (BFVC) of the modulation stage.In this article,a fast charging loop is introduced into the input stage to charge VCIN to roughly near VREF.Then a correction loop further charges or discharges VCIN,substantially equalizing it with VREF.Dummy switches are introduced into the modulation stage to provide switching signals for setting up BFVC,and the power switches are disabled until the BFVC are set up successfully.A two channel single-ended class D amplifier with the above features is fabricated with 0.5 μm Bi-CMOS process.Road test and fast Fourier transform analysis indicate that there is no noticeable click and pop.

  4. Nuclear magnetic resonance experiments with dc SQUID amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Heaney, M.B. (California Univ., Berkeley, CA (USA). Dept. of Physics Lawrence Berkeley Lab., CA (USA))

    1990-11-01

    The development and fabrication of dc SQUIDs (Superconducting QUantum Interference Devices) with Nb/Al{sub 2}O{sub 3}/Nb Josephson junctions is described. A theory of the dc SQUID as a radio-frequency amplifier is presented, with an optimization strategy that accounts for the loading and noise contributions of the postamplifier and maximizes the signal-to-noise ratio of the total system. The high sensitivity of the dc SQUID is extended to high field NMR. A dc SQUID is used as a tuned radio-frequency amplifier to detect pulsed nuclear magnetic resonance at 32 MHz from a metal film in a 3.5 Tesla static field. A total system noise temperature of 11 K has been achieved, at a bath temperature of 4.2 K. The minimum number of nuclear Bohr magnetons observable from a free precession signal after a single pulse is about 2 {times} 10{sup 17} in a bandwidth of 25 kHz. In a separate experiment, a dc SQUID is used as a rf amplifier in a NQR experiment to observe a new resonance response mechanism. The net electric polarization of a NaClO{sub 3} crystal due to the precessing electric quadrupole moments of the Cl nuclei is detected at 30 MHz. The sensitivity of NMR and NQR spectrometers using dc SQUID amplifiers is compared to the sensitivity of spectrometers using conventional rf amplifiers. A SQUID-based spectrometer has a voltage sensitivity which is comparable to the best achieved by a FET-based spectrometer, at these temperatures and operating frequencies.

  5. Nuclear magnetic resonance experiments with DC SQUID amplifiers

    Science.gov (United States)

    Heaney, M. B.

    1990-11-01

    The development and fabrication of dc SQUIDs (Superconducting Quantum Interference Devices) with Nb/Al2O3/Nb Josephson junctions is described. A theory of the dc SQUID as a radio-frequency amplifier is presented, with an optimization strategy that accounts for the loading and noise contributions of the postamplifier and maximizes the signal-to-noise ratio of the total system. The high sensitivity of the dc SQUID is extended to high field NMR. A dc SQUID is used as a tuned radio-frequency amplifier to detect pulsed nuclear magnetic resonance at 32 MHz from a metal film in a 3.5 Tesla static field. A total system noise temperature of 11 K has been achieved, at a bath temperature of 4.2 K. The minimum number of nuclear Bohr magnetons observable from a free precession signal after a single pulse is about 2 x 10(exp 17) in a bandwidth of 25 kHz. In a separate experiment, a dc SQUID is used as a rf amplifier in a NQR experiment to observe a new resonance response mechanism. The net electric polarization of a NaClO3 crystal due to the precessing electric quadrupole moments of the Cl nuclei is detected at 30 MHz. The sensitivity of NMR and NQR spectrometers using dc SQUID amplifiers is compared to the sensitivity of spectrometers using conventional rf amplifiers. A SQUID-based spectrometer has a voltage sensitivity which is comparable to the best achieved by a FET-based spectrometer, at these temperatures and operating frequencies.

  6. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  7. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  8. A Tool and Methodology for AC-Stability Analysis of Continuous-Time Closed-Loop Systems

    CERN Document Server

    Milev, Momchil

    2011-01-01

    Presented are a methodology and a DFII-based tool for AC-stability analysis of a wide variety of closed-loop continuous-time (operational amplifiers and other linear circuits). The methodology used allows for easy identification and diagnostics of ac-stability problems including not only main-loop effects but also local-instability loops in current mirrors, bias circuits and emitter or source followers without breaking the loop. The results of the analysis are easy to interpret. Estimated phase margin is readily available. Instability nodes and loops along with their respective oscillation frequencies are immediately identified and mapped to the existing circuit nodes thus offering significant advantages compared to traditional "black-box" methods of stability analysis (Transient Overshoot, Bode and Phase margin plots etc.). The tool for AC-Stability analysis is written in SKILL? and is fully integrated in DFII? environment. Its "push-button" graphical user interface (GUI) is easy to use and understand. The t...

  9. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  10. 100-J level amplifier concepts for HiLASE and ELI-Beamlines

    Science.gov (United States)

    Sikocinski, P.; Divoky, M.; Lucianetti, A.; Sawicka, M.; Novak, J.; Rus, B.; Mocek, T.

    2012-07-01

    We present comparison of two alternative layouts of a 100 J cryogenically cooled Yb:YAG multi-slab laser system operating at 10 Hz for HiLASE and ELI Beamlines projects. In the first approach, the 100 J slab amplifier consists of a preamplifier and power amplifier, while in the second approach it uses single power amplifier with two amplifier heads. These two concepts are compared, with respect to output power, B-integral, accumulated B-integral, and peak fluence. Results are obtained by simulating beam propagation in MIRÓ code and calculating stored energy in the amplifier by homemade ray-tracing MATLAB code for amplified spontaneous emission evaluation.

  11. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  12. Electrothermally driven flows in ac electrowetting.

    Science.gov (United States)

    García-Sánchez, Pablo; Ramos, Antonio; Mugele, Frieder

    2010-01-01

    Mixing within sessile drops can be enhanced by generating internal flow patterns using ac electrowetting. While for low ac frequencies, the flow patterns have been attributed to oscillations of the drop surface, we provide here the driving mechanism of the hitherto unexplained high-frequency flows. We show that: (1) the electric field in the liquid bulk becomes important, leading to energy dissipation due to Joule heating and a temperature increase of several degrees Celsius, and (2) the fluid flow at these frequencies is generated by electrothermal effect, i.e., gradients in temperature give rise to gradients in conductivity and permittivity, the electric field acting on these inhomogeneities induces an electrical body force that generates the flow. We solved numerically the equations for the electric, temperature and flow fields. The temperature is obtained from a convection-diffusion equation where Joule heating is introduced as a source term. From the solution of the electric field and the temperature, we compute the electrical force that acts as a body force in Stokes equations. Our numerical results agree with previous experimental observations.

  13. Cascading failures in ac electricity grids

    Science.gov (United States)

    Rohden, Martin; Jung, Daniel; Tamrakar, Samyak; Kettemann, Stefan

    2016-09-01

    Sudden failure of a single transmission element in a power grid can induce a domino effect of cascading failures, which can lead to the isolation of a large number of consumers or even to the failure of the entire grid. Here we present results of the simulation of cascading failures in power grids, using an alternating current (AC) model. We first apply this model to a regular square grid topology. For a random placement of consumers and generators on the grid, the probability to find more than a certain number of unsupplied consumers decays as a power law and obeys a scaling law with respect to system size. Varying the transmitted power threshold above which a transmission line fails does not seem to change the power-law exponent q ≈1.6 . Furthermore, we study the influence of the placement of generators and consumers on the number of affected consumers and demonstrate that large clusters of generators and consumers are especially vulnerable to cascading failures. As a real-world topology, we consider the German high-voltage transmission grid. Applying the dynamic AC model and considering a random placement of consumers, we find that the probability to disconnect more than a certain number of consumers depends strongly on the threshold. For large thresholds the decay is clearly exponential, while for small ones the decay is slow, indicating a power-law decay.

  14. Transport AC Losses in Striated YBCO Coated Conductors (Postprint)

    Science.gov (United States)

    2012-02-01

    AFRL-RZ-WP-TP-2012-0124 TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) G.A. Levin and P.N. Barnes Mechanical Energy...TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) 5a. CONTRACT NUMBER In-house 5b. GRANT NUMBER 5c. PROGRAM ELEMENT...2006. 14. ABSTRACT DC current-voltage characteristics and transport ac losses of striated and non-striated Y1Ba2Cu3O7-δ ( YBCO ) coated conductors

  15. Identification of druggable cancer driver genes amplified across TCGA datasets.

    Directory of Open Access Journals (Sweden)

    Ying Chen

    Full Text Available The Cancer Genome Atlas (TCGA projects have advanced our understanding of the driver mutations, genetic backgrounds, and key pathways activated across cancer types. Analysis of TCGA datasets have mostly focused on somatic mutations and translocations, with less emphasis placed on gene amplifications. Here we describe a bioinformatics screening strategy to identify putative cancer driver genes amplified across TCGA datasets. We carried out GISTIC2 analysis of TCGA datasets spanning 16 cancer subtypes and identified 486 genes that were amplified in two or more datasets. The list was narrowed to 75 cancer-associated genes with potential "druggable" properties. The majority of the genes were localized to 14 amplicons spread across the genome. To identify potential cancer driver genes, we analyzed gene copy number and mRNA expression data from individual patient samples and identified 42 putative cancer driver genes linked to diverse oncogenic processes. Oncogenic activity was further validated by siRNA/shRNA knockdown and by referencing the Project Achilles datasets. The amplified genes represented a number of gene families, including epigenetic regulators, cell cycle-associated genes, DNA damage response/repair genes, metabolic regulators, and genes linked to the Wnt, Notch, Hedgehog, JAK/STAT, NF-KB and MAPK signaling pathways. Among the 42 putative driver genes were known driver genes, such as EGFR, ERBB2 and PIK3CA. Wild-type KRAS was amplified in several cancer types, and KRAS-amplified cancer cell lines were most sensitive to KRAS shRNA, suggesting that KRAS amplification was an independent oncogenic event. A number of MAP kinase adapters were co-amplified with their receptor tyrosine kinases, such as the FGFR adapter FRS2 and the EGFR family adapters GRB2 and GRB7. The ubiquitin-like ligase DCUN1D1 and the histone methyltransferase NSD3 were also identified as novel putative cancer driver genes. We discuss the patient tailoring implications

  16. Amplifier Module for 260-GHz Band Using Quartz Waveguide Transitions

    Science.gov (United States)

    Padmanabhan, Sharmila; Fung, King Man; Kangaslahti, Pekka P.; Peralta, Alejandro; Soria, Mary M.; Pukala, David M.; Sin, Seth; Samoska, Lorene A.; Sarkozy, Stephen; Lai, Richard

    2012-01-01

    Packaging of MMIC LNA (monolithic microwave integrated circuit low-noise amplifier) chips at frequencies over 200 GHz has always been problematic due to the high loss in the transition between the MMIC chip and the waveguide medium in which the chip will typically be used. In addition, above 200 GHz, wire-bond inductance between the LNA and the waveguide can severely limit the RF matching and bandwidth of the final waveguide amplifier module. This work resulted in the development of a low-loss quartz waveguide transition that includes a capacitive transmission line between the MMIC and the waveguide probe element. This capacitive transmission line tunes out the wirebond inductance (where the wire-bond is required to bond between the MMIC and the probe element). This inductance can severely limit the RF matching and bandwidth of the final waveguide amplifier module. The amplifier module consists of a quartz E-plane waveguide probe transition, a short capacitive tuning element, a short wire-bond to the MMIC, and the MMIC LNA. The output structure is similar, with a short wire-bond at the output of the MMIC, a quartz E-plane waveguide probe transition, and the output waveguide. The quartz probe element is made of 3-mil quartz, which is the thinnest commercially available material. The waveguide band used is WR4, from 170 to 260 GHz. This new transition and block design is an improvement over prior art because it provides for better RF matching, and will likely yield lower loss and better noise figure. The development of high-performance, low-noise amplifiers in the 180-to- 700-GHz range has applications for future earth science and planetary instruments with low power and volume, and astrophysics array instruments for molecular spectroscopy. This frequency band, while suitable for homeland security and commercial applications (such as millimeter-wave imaging, hidden weapons detection, crowd scanning, airport security, and communications), also has applications to

  17. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  18. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  19. Improvement and test of high power amplifier high voltage interlock circuit%高功放高压联锁电路改进与测试

    Institute of Scientific and Technical Information of China (English)

    金华松; 邱冬冬; 刘斯亮

    2012-01-01

    Whether the device can work regularly was determined by the performance of high voltage interlock directly. Through the operating principle analysis of high voltage interlock circuit and AC time delayer of high power amplifier based on CPI mechanical cabinet, an improved high voltage interlock circuit solution and a test method applied in AC time delayer are studied. The improved interlock circuit overcomes the drawbacks of original high voltage interlock solution. The designed test circuit can carry out quantitative test of AC time delayer parameters.%高压联锁性能的好坏直接影响设备能否正常工作.通过分析CPI高功放(HPA)的延时加高压程序、高压联锁电路和交流延时器工作原理,研究出一种新改选的高压联锁电路方案和用于交流延时器的测试方法.分析阐述表明,该方案和测试方法克服了CPI高功放的高压联锁方案的弊端.另外,根据分析结果设计了延时测试电路,它可对交流延时器性能参数进行定量测试.

  20. Physics of vertically integrated waveguide photodetectors and amplifiers. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Wright, E.M. [Univ. of Arizona, Tucson, AZ (United States). Optical Sciences Center

    1993-11-01

    This report describes the efforts supported by LLNL under the Subcontract No. B239593 at the University of Arizona during the Fiscal Year 1992. A solid physical foundation has been developed for understanding the operation of vertically integrated photodetectors and amplifiers. This has been achieved through a combination of numerical simulation and development of simple coupled-mode theories. Coupled-mode theory has been used to elucidate the physics underlying the operation of vertically integrated photodetectors. In particular, the relation between the spatial transients observed in experiments and numerical simulations, and the non-power orthogonality of the underlying modes has been clarified. The coupled-mode theory has been extended to the case of coupled waveguide-amplifiers.

  1. Low-voltage CMOS operational amplifiers theory, design and implementation

    CERN Document Server

    Sakurai, Satoshi

    1995-01-01

    Low-Voltage CMOS Operational Amplifiers: Theory, Design and Implementation discusses both single and two-stage architectures. Opamps with constant-gm input stage are designed and their excellent performance over the rail-to-rail input common mode range is demonstrated. The first set of CMOS constant-gm input stages was introduced by a group from Technische Universiteit, Delft and Universiteit Twente, the Netherlands. These earlier versions of circuits are discussed, along with new circuits developed at the Ohio State University. The design, fabrication (MOSIS Tiny Chips), and characterization of the new circuits are now complete. Basic analog integrated circuit design concepts should be understood in order to fully appreciate the work presented. However, the topics are presented in a logical order and the circuits are explained in great detail, so that Low-Voltage CMOS Operational Amplifiers can be read and enjoyed by those without much experience in analog circuit design. It is an invaluable reference boo...

  2. GaN Monolithic Power Amplifiers for Microwave Backhaul Applications

    Directory of Open Access Journals (Sweden)

    Roberto Quaglia

    2016-06-01

    Full Text Available Gallium nitride integrated technology is very promising not only for wireless applications at mobile frequencies (below 6 GHz but also for network backhaul radiolink deployment, now under deep revision for the incoming 5G generation of mobile communications. This contribution presents three linear power amplifiers realized on 0.25 μ m Gallium Nitride on Silicon Carbide monolithic integrated circuits for microwave backhaul applications: two combined power amplifiers working in the backhaul band around 7 GHz, and a more challenging third one working in the higher 15 GHz band. Architectures and main design steps are described, highlighting the pros and cons of Gallium Nitride with respect to the reference technology which, for these applications, is represented by gallium arsenide.

  3. Compact cladding-pumped planar waveguide amplifier and fabrication method

    Science.gov (United States)

    Bayramian, Andy J.; Beach, Raymond J.; Honea, Eric; Murray, James E.; Payne, Stephen A.

    2003-10-28

    A low-cost, high performance cladding-pumped planar waveguide amplifier and fabrication method, for deployment in metro and access networks. The waveguide amplifier has a compact monolithic slab architecture preferably formed by first sandwich bonding an erbium-doped core glass slab between two cladding glass slabs to form a multi-layer planar construction, and then slicing the construction into multiple unit constructions. Using lithographic techniques, a silver stripe is deposited and formed at a top or bottom surface of each unit construction and over a cross section of the bonds. By heating the unit construction in an oven and applying an electric field, the silver stripe is then ion diffused to increase the refractive indices of the core and cladding regions, with the diffusion region of the core forming a single mode waveguide, and the silver diffusion cladding region forming a second larger waveguide amenable to cladding pumping with broad area diodes.

  4. 5 Watt GaN HEMT Power Amplifier for LTE

    Directory of Open Access Journals (Sweden)

    K. Niotaki

    2014-04-01

    Full Text Available This work presents the design and implementation of a stand-alone linear power amplifier at 2.4 GHz with high output power. A GaN HEMT transistor is selected for the design and implementation of the power amplifier. The device exhibits a gain of 11.7 dB and a drain efficiency of 39% for an output power of 36.7 dBm at 2.4 GHz for an input power of 25dBm. The carrier to intermodulation ratio is better than 25 dB for a two tone input signal of 25 dBm of total power and a spacing of 5 MHz. The fabricated device is also tested with LTE input signals of different bandwidths (5MHz to 20MHz.

  5. Planar waveguide amplifiers and laser in erbium doped silica

    DEFF Research Database (Denmark)

    Guldberg-Kjær, Søren Andreas; Kristensen, Martin

    1999-01-01

    lightwave circuits, as well as provide the gain medium for integrated planar waveguide lasers. The work and the obtained results are presented in this thesis: The manufacturing of silica thin films is described and it is shown that the refractive index o fthe films can be controlled by germanium co...... fluorescence level. In addition the first measurement of the diffusion coefficient of erbim in silica is presented and it is shown that erbium rich precipitates are formed in areas of high erbium concentration. The manufacturing of planar waveguide structures using RIE (Reactive Ion Etching) is described...... concentration and the relative erbium/aluminium contenct. Waveguides with a gain factor of 0.3 dB/cm are presented and used to fabricate a loss less lightwave circuit consisting of an amplifier-and a splitter section. It is shown that the refractive index of the fabricated amplifying waveguides can be changed...

  6. Atomic Dipole Traps with Amplified Spontaneous Emission: A Proposal

    CERN Document Server

    Clément, Jean-François; Garreau, Jean Claude; Szriftgiser, Pascal

    2010-01-01

    We propose what we believe to be a novel type of optical source for ultra-cold atomic Far Off-Resonance optical-dipole Traps (FORTs). The source is based on an Erbium Amplified Spontaneous Emission (ASE) source that seeds a high power Erbium Doped Fiber Amplifier (EDFA). The main interest of this source is its very low coherence length, thus allowing an incoherent superposition of several trapping beams without any optical interference. The behavior of the superimposed beams is then a scalar sum greatly simplifying complex configurations. As an illustration, we report an estimation of the intensity noise of this source and an estimation of the atomic excess heating rate for an evaporative cooling experiment application. They are both found to be suitable for cold atoms experiments.

  7. Graphene-based side-polished optical fiber amplifier.

    Science.gov (United States)

    Karimi, Mohammad; Ahmadi, Vahid; Ghezelsefloo, Masoud

    2016-12-20

    We demonstrate a novel design for optical fiber amplifiers, utilizing side-polished fibers with a single-layer graphene overlay as the active medium and carrier injection in the graphene layer to provide the required inversion. We study the effects of an electrically induced graphene p-i-n heterojunction in the forward bias regime on optical modes of side-polished fibers and show that gain values of 0.51, 1.81, and 1.79 dB/cm for wavelengths 1064, 1330, and 1550 nm can be obtained for single-mode side-polished fibers. Our results show that in multi-mode side-polished fibers, higher order modes experience higher values of gain, and gain can be increased by increasing polished depth. The proposed system is a tunable wideband optical amplifier that can operate for wavelengths larger than 1000 nm.

  8. Optical steganography based on amplified spontaneous emission noise.

    Science.gov (United States)

    Wu, Ben; Wang, Zhenxing; Tian, Yue; Fok, Mable P; Shastri, Bhavin J; Kanoff, Daniel R; Prucnal, Paul R

    2013-01-28

    We propose and experimentally demonstrate an optical steganography method in which a data signal is transmitted using amplified spontaneous emission (ASE) noise as a carrier. The ASE serving as a carrier for the private signal has an identical frequency spectrum to the existing noise generated by the Erbium doped fiber amplifiers (EDFAs) in the transmission system. The system also carries a conventional data channel that is not private. The so-called "stealth" or private channel is well-hidden within the noise of the system. Phase modulation is used for both the stealth channel and the public channel. Using homodyne detection, the short coherence length of the ASE ensures that the stealth signal can only be recovered if the receiver closely matches the delay-length difference, which is deliberately changed in a dynamic fashion that is only known to the transmitter and its intended receiver.

  9. A Novel Frequency Compensation Technique for Three-Stage Amplifier

    Institute of Scientific and Technical Information of China (English)

    LI Qiang; YI Jun; LI Zhao-ji; ZHANG Bo; FANG Jian; LUO Ping

    2005-01-01

    A novel frequency compensation technique for three-stage amplifier with dual complex pole-zero (DCP) cancellation is proposed. It uses one pair of complex zeros to cancel one pair of complex poles, resulting in feature that frequency response of the three-stage amplifier exhibits that of a single-pole system. Thus the gain-bandwidth (GBW) is expected to be increased several times compared to the conventional nested miller compensation (NMC) approach. Moreover, this technique requires only one very small compensation capacitor even when driving a big load capacitor. A GBW 4.63 MHz, DC gain 100 dB, PM 90o and power dissipation 0.87 mW can be achieved for a load capacitor 100 pF with a single Miller compensation capacitor 2 pF at a ±1V supply in a standard 0.6-μm CMOS technology.

  10. Design of an operational transconductance amplifier applying multiobjective optimization techniques

    Directory of Open Access Journals (Sweden)

    Roberto Pereira-Arroyo

    2014-02-01

    Full Text Available In this paper, the problem at hand consists in the sizing of an Operational Transconductance Amplifier (OTA. The Pareto front is introduced as a useful analysis concept in order to explore the design space of such analog circuit. A genetic algorithm (GA is employed to automatically detect this front in a process that efficiently finds optimal parameteriza­tions and their corresponding values in an aggregate fitness space. Since the problem is treated as a multi-objective optimization task, different measures of the amplifier like the transconductance, the slew rate, the linear range and the input capacitance are used as fitness functions. Finally, simulation results are pre­sented, using a standard 0,5μm CMOS technology.

  11. Novel Photonic Bandgap Structure and Its Application in Amplifier

    Institute of Scientific and Technical Information of China (English)

    PANGYunbo; GAOBaoxin

    2003-01-01

    A novel compact photonic bandgap (PBG)structural element, which is etched in the ground plane of the microstrip line, is proposed in this paper. A forbid-den gap, which is about 200MHz wide, is measured at the center frequency of 8.6GHz. The measured results agree with finite difference time domain (FDTD) simulations. A harmonic-suppression amplifier is fabricated by utilizing this novel structural element. The suppression of the sec-ond order harmonic has been enhanced about 17dB when compared with a reference amplifier. Since no filters are needed and the structural element is etched in the ground plane, the whole circuit is compact.

  12. Self-consistent description of graphene quantum amplifier

    Science.gov (United States)

    Lozovik, Yu. E.; Nechepurenko, I. A.; Andrianov, E. S.; Dorofeenko, A. V.; Pukhov, A. A.; Chtchelkatchev, N. M.

    2016-07-01

    The development of active and passive plasmonic devices is challenging due to the high level of dissipation in normal metals. One possible solution to this problem is using alternative materials. Graphene is a good candidate for plasmonics in the near-infrared region. In this paper, we develop a quantum theory of a graphene plasmon generator. We account for quantum correlations and dissipation effects, thus we are able to describe such regimes of a quantum plasmonic amplifier as a surface plasmon emitting diode and a surface plasmon amplifier using stimulated radiation emission. Switching between these generation types is possible in situ with a variance of the graphene Fermi level. We provide explicit expressions for dissipation and interaction constants through material parameters, and we identify the generation spectrum and the second-order correlation function, which predicts the laser statistics.

  13. Precision Instrumentation Amplifiers and Read-Out Integrated Circuits

    CERN Document Server

    Wu, Rong; Makinwa, Kofi A A

    2013-01-01

    This book presents innovative solutions in the design of precision instrumentation amplifier and read-out ICs, which can be used to boost millivolt-level signals transmitted by modern sensors, to levels compatible with the input ranges of typical Analog-to-Digital Converters (ADCs).  The discussion includes the theory, design and realization of interface electronics for bridge transducers and thermocouples. It describes the use of power efficient techniques to mitigate low frequency errors, resulting in interface electronics with high accuracy, low noise and low drift. Since this book is mainly about techniques for eliminating low frequency errors, it describes the nature of these errors and the associated dynamic offset cancellation techniques used to mitigate them.  Surveys comprehensively offset cancellation and accuracy improvement techniques applied in precision amplifier designs; Presents techniques in precision circuit design to mitigate low frequency errors in millivolt-level signals transmitted by ...

  14. Rare-Earth Doped Photonic Crystal Fibre Lasers and Amplifiers

    DEFF Research Database (Denmark)

    Hougaard, Kristian G.

    2005-01-01

    In this thesis, a theoretical and numerical study of the use of rare-earthdoped photonic crystal fibres as optical amplifiers and lasers, has been performed. Photonic crystal fibres or microstructured optical fibres is a new kind of optical fibre in which the cladding region typically consist...... of a periodic microstructure, resulting in a fibre with very different properties compared to conventional optical fibres. The properties of photonic crystals fibres are described, with focus on the advantages this technology provides compared to conventional fibres, within the area of optical amplification....... The thesis also presents the basic properties of optical amplification, and describes the numerical model developed to model the behaviour of lasers and amplifiers based on photonic crystal fibres. The developed numerical tools are then used to investigate specific applications of photonic crystal fibres...

  15. DESIGN OF LOW NOISE AMPLIFIER FOR UWB RADIO RECEIVER.

    Directory of Open Access Journals (Sweden)

    Alpana Adsul

    2011-10-01

    Full Text Available An Ultra Wide Band CMOS Low Noise Amplifier (LNA design is presented in this paper. Due to low power consumption and extremely high data rates the UWB system is bound to be popular in the end user market. The LNA is the first stage after antenna in an UWB transceiver. The LNA is accountable for providing enough gain to the signal with the bare minimum distortion. In this work we have designed and evaluated the performance of a complementary metal oxide semiconductor (CMOS low noise amplifier (LNA for 3.1-10.6 GHZ frequency band. Agilent's ADS tool has been used to simulate the designed LNA and is proved to have better noise figure as well as input matching. The designed LNA provides the low S11, S22, and noise figure. The gain achieved is 6dB and the response over the band of interest is almost flat.

  16. Multilayer-graphene-based amplifier of surface acoustic waves

    Energy Technology Data Exchange (ETDEWEB)

    Yurchenko, Stanislav O., E-mail: st.yurchenko@mail.ru; Komarov, Kirill A. [Bauman Moscow State Technical University, 2-nd Baumanskaya str. 5, Moscow 105005 (Russian Federation); Pustovoit, Vladislav I. [Scientific and Technological Center of Unique Instrumentation, Russian Academy of Sciences, Moscow (Russian Federation)

    2015-05-15

    The amplification of surface acoustic waves (SAWs) by a multilayer graphene (MLG)-based amplifier is studied. The conductivity of massless carriers (electrons or holes) in graphene in an external drift electric field is calculated using Boltzmann’s equation. At some carrier drift velocities, the real part of the variable conductivity becomes negative and MLG can be employed in SAW amplifiers. Amplification of Blustein’s and Rayleigh’s SAWs in CdS, a piezoelectric hexagonal crystal of the symmetry group C{sub 6v}, is considered. The corresponding equations for SAW propagation in the device are derived and can be applied to other substrate crystals of the same symmetry. The results of the paper indicate that MLG can be considered as a perspective material for SAW amplification and related applications.

  17. An improved logarithmic amplifier circuit for PDS microdensitometers

    Science.gov (United States)

    Anderson, C. M.; Slovak, M. H.; Michalski, D. E.

    1984-01-01

    A high speed logarithmic amplifier circuit for the Perkin-Elmer PDS microdensitometer is discussed. The circuit is designed around an Analog Devices 757p log-amp module. The amplifier produces undistorted profiles of rapidly changing, dense ( 4) images over the available range of scanning speeds. The circuit board was designed to replace directly the manufacturer supplied unit; neither electrical nor mechanical modifications of the basic PDS are required. The performance of the circuit is illustrated through its effects on the overall modulation transfer function of the instrument and by scans of a well exposed stellar image. Circuit diagrams and parts lists a mechanism for obtaining either circuit board layout art work or finished circuit boards are presented.

  18. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  19. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  20. Tirasemtiv amplifies skeletal muscle response to nerve activation in humans

    OpenAIRE

    Hansen,Richard; Saikali, Khalil G; Chou, Willis; Alan J Russell; Chen, Michael M.; Vijayakumar, Vipin; Stoltz, Randall R.; Baudry, Stephane; Enoka, Roger M.; Morgans, David J; Wolff, Andrew A.; Malik, Fady I

    2014-01-01

    Introduction: In this study we tested the hypothesis that tirasemtiv, a selective fast skeletal muscle troponin activator that sensitizes the sarcomere to calcium, could amplify the response of muscle to neuromuscular input in humans. Methods: Healthy men received tirasemtiv and placebo in a randomized, double-blind, 4-period, crossover design. The deep fibular nerve was stimulated transcutaneously to activate the tibialis anterior muscle and produce dorsiflexion of the foot. The force–freque...