TEST OF SPEED OF ADJUSTMENT TOWARDS THE CAPITAL STRUCTURE IN INDONESIA TELECOMMUNICATION INDUSTRY

Directory of Open Access Journals (Sweden)

Riko Hendrawan

2017-03-01

Full Text Available The purpose of this research was to test whether or not the pecking order theory occurred in telecommunicationindustry in Indonesia and also in its speed of adjustment. Using the purposive sampling method and taking 7years period of data collection from 2006 up to 2012, the data were gathered from the companies’ financialstatement. The data were analyzed using the random effect model of Hausman test with interest bearing debt asits dependent variable and deficit as its independent variable. Finding from this research showed that peckingorder theory was not applied in the telecommunication industry in Indonesia and it was quite different from thefinding of Huang & Ritter (2009 that publicly traded firms in US adjusted to their target leverage at amoderate speed with a period of 3.9 years. It also discovered that the fastest growth of the speed of adjustmentwas shown by XL Axiata with -493.96% per year, and then Bakrie Telecom with -65.62%. Indosat and TelkomIndonesia showed a different behavior with a slower speed of adjustment Indosat with 13.22%, and TelkomIndonesia with 274.14% slower.

Empirical Evidence of Target Leverage, Adjustment Costs and Adjustment Speed of Non-Financial Firms in Selected African Countries

OpenAIRE

Oyebola Fatima Etudaiye-Muhtar; Oyebola Fatima Etudaiye-Muhtar; Rubi Ahmad

2015-01-01

The issue of target leverage for corporate firms in developing countries has received little attention in extant literature, especially countries in Africa. Given the imperfection that exists in African financial markets that may limit firms access to external capital, this study investigates dynamic adjustment towards a target debt ratio. In addition, the study used a dynamic panel data estimation technique to determine adjustment costs and speed of adjustment in non-financial firms in selec...

The Effects of Leg Kick on Swimming Speed and Arm-Stroke Efficiency in the Front Crawl.

Science.gov (United States)

Silveira, Ricardo Peterson; de Souza Castro, Flávio Antônio; Figueiredo, Pedro; Vilas-Boas, João Paulo; Zamparo, Paola

2017-07-01

To analyze the effects of swimming pace on the relative contribution of leg kick to swimming speed and to compare arm-stroke efficiency (ηF) assessed when swimming with the arms only (SAO) and while swimming front crawl (FCS) using individual and fixed adjustments to arm-stroke and leg-kick contribution to forward speed. Twenty-nine master swimmers (21 men, 8 women) performed SAO and FCS at 6 self-selected speeds from very slow to maximal. The average swimming speed (v), stroke frequency (SF), and stroke length (SL) were assessed in the central 10 m of the swimming pool. Then, a 2nd-order polynomial regression was used to obtain values of v at paired SF. The percentage difference in v between FCS and SAO, for each paired SF, was used to calculate the relative contributions of the arm stroke (AC) and leg kick (LC) to FCS. Then ηF was calculated using the indirect "paddle-wheel" approach in 3 different ways: using general, individual, and no adjustments to AC. The LC increased with SF (and speed) from -1% ± 4% to 11% ± 1% (P < .05). At the lower FCS speeds, ηF calculated using general adjustments was lower than ηF calculated using individual adjustments (P < .05), but differences disappear at the fastest speeds. Finally, ηF calculated using individual adjustments to LC in the FCS condition did not differ with ηF assessed in the SAO condition at all the investigated speeds. The relative contributions of the arm stroke and leg kick should be individually estimated to reduce errors when calculating arm-stroke efficiency at different speeds and in different swimmers.

Farm Target Capital Structure: Dynamics, Determinants and Speed of Adjustment

NARCIS (Netherlands)

Tamirat, A.S.; Trujillo Barrera, A.A.; Pennings, J.M.E.

2017-01-01

The corporate finance literature has focused on explaining the determinants of firms target capital structure and speed of adjustment using the well-established theories such as pecking order, signaling and trade-off theories. However, less attention has been paid to understanding the financing

Wavelet-Fuzzy Speed Indirect Field Oriented Controller for Three-Phase AC Motor Drive

DEFF Research Database (Denmark)

Sanjeevikumar, Padmanaban; Daya, Febin; Blaabjerg, Frede

2016-01-01

Three-phase voltage source inverter driven induction motor are used in many medium- and high-power applications. Precision in speed of the motor play vital role, i.e. popular methods of direct/indirect field-oriented control (FOC) are applied. FOC is employed with proportional-integral (P...... wavelet transform and the fuzzy logic controller, to generate the scaled gains for the indirect FOC induction motor. Complete model of the proposed ac motor drive is developed with numerical simulation Matlab/Simulink software and tested under different working conditions. For experimental verification...

Effects of passive components on the input current interharmonics of adjustable-speed drives

DEFF Research Database (Denmark)

Soltani, Hamid; Blaabjerg, Frede; Zare, Firuz

2016-01-01

Current and voltage source Adjustable Speed Drives (ASDs) exert distortion current into the grid, which may produce some interharmonic components other than the characteristic harmonic components. This paper studies the effects of passive components on the input current interharmonics of adjustable...

A New Generalized Two-Stage Direct Power Conversion Topology to Independently Supply Multiple AC Loads from Multiple Power Grids with Adjustable Power Loading

DEFF Research Database (Denmark)

Klumpner, Christian; Blaabjerg, Frede

2004-01-01

) and continuously adjust these power fractions will become a desired feature. This paper presents a generalized Direct Power Converter topology, which is able to connect to multiple AC supplies proving complete decoupling and no circulating power between the input ports and to independently control multiple AC...

LC-filter Resonance Cancellation with DPWM Inverters in Adjustable Speed Drives

DEFF Research Database (Denmark)

Vadstrup, Casper; Wang, Xiongfei; Blaabjerg, Frede

2015-01-01

Discontinuous PWM methods cannot easily be used in LC-filtered inverters for adjustable speed drives, as it causes resonances in the filter. This paper present a new method to cancel the resonance and compares this method to previously proposed methods. Wide band gap devices are entering the market...

High-Speed Visualization of Evaporation Phenomena from Tungsten Based Electrode in Multi-Phase AC Arc

Science.gov (United States)

Tanaka, Manabu; Hashizume, Taro; Imatsuji, Tomoyuki; Nawata, Yushi; Watanabe, Takayuki

2015-09-01

A multi-phase AC arc has been developed for applications in various fields of engineering because it possesses unique advantages such as high energy efficiency. However, understanding of fundamental phenomena in the multi-phase AC arc is still insufficient for practical use. Purpose of this study is to investigate electrode erosion mechanism by high-speed visualization of the electrode metal vapor in the arc. Results indicated that the electrode mainly evaporated at anodic period, leading to the arc constriction. Moreover, evaporation of W electrode with 2wt% La2O3 at the anodic period was much higher than that with 2wt% ThO2. This can be explained by different properties of these oxide additives. Evaporation of the oxide additive resulted in the arc constriction, which accelerated the evaporation of W electrode. Therefore, addition of La2O3 with lower melting and boiling point than ThO2 lead to stronger arc constriction, resulting in severer evaporation of W electrode.

Input current interharmonics in adjustable speed drives caused by fixed-frequency modulation techniques

DEFF Research Database (Denmark)

Soltani, Hamid; Davari, Pooya; Loh, Poh Chiang

2016-01-01

Adjustable Speed Drives (ASDs) based on double-stage conversion systems may inject interharmonics distortion into the grid, other than the well-known characteristic harmonic components. The problems created by interharmonics make it necessary to find their precise sources, and, to adopt an approp......Adjustable Speed Drives (ASDs) based on double-stage conversion systems may inject interharmonics distortion into the grid, other than the well-known characteristic harmonic components. The problems created by interharmonics make it necessary to find their precise sources, and, to adopt...... an appropriate strategy for minimizing their effects. This paper investigates the ASD's input current interharmonic sources caused by applying symmetrical regularly sampled fixed-frequency modulation techniques on the inverter. The interharmonics generation process is precisely formulated and comparative results...

Interharmonic mitigation of adjustable speed drives using an active DC-link capacitor

DEFF Research Database (Denmark)

Soltani, Hamid; Loh, Poh Chiang; Blaabjerg, Frede

2015-01-01

Current and voltage source Adjustable - Speed Drives (ASDs) exert distortion currents in the grid which may lead to some interharmonic components other than the characteristic harmonic components. The frequencies of the line current interharmonics, generated by these ASDs, depend on the motor...

Adjustable speed drives improve circulating water system

International Nuclear Information System (INIS)

Dent, R.A.; Dicic, Z.

1994-01-01

This paper illustrates the integration of electrical and mechanical engineering requirements to produce a solution to past problems and future operating demands. The application of adjustable speed drives in the modifications of the circulating water system at Indian Point No. 3 Nuclear Power Plant provided increased operating flexibility, efficiency and avoided otherwise costly renovations to the plant electrical systems. Rectification of the original inadequate design of the circulating water system, in addition to maximizing plant efficiency consistent with environmental considerations, formed the basis for this modification. This entailed replacement of all six circulating water pumps and motors and physical modifications to the intake system. This paper details the methodology used in this engineering task. The new system was installed successfully and has been operating reliably and economically for the past eight years

Review of the system compatibility and ride-through options for AC and DC drives including multilevel inverters

Energy Technology Data Exchange (ETDEWEB)

Jouanne, A. von [Power Electronics Lab. - Elect. and Compt. Engineering Dept. - Oregon State Univ., Corvallis, OR (United States); Ben Banerjee, B. [Electric Power Research Inst. - Power Electronics, Energy Delivery, Palo Alto, CA (United States)

2000-07-01

Adjustable speed drive (ASD) compatibility and ride-through issues have caused increased concerns due to the susceptibility of AC and DC drives to power disturbances, and the costly results of process disruptions. These losses can be avoided for critical production processes by using ASDs with ride-through capabilities. This paper assesses industrial ride-through requirements and application issues for AC and DC drives, including medium voltage (2300/4160 V) multi-level inverter topologies. Ride-through alternatives are evaluated based on design, implementation and cost considerations in order to determine the most suitable solutions for various kVA ratings and time duration requirements. (orig.)

Advanced calibration, adjustment, and operation of a density and sound speed analyzer

International Nuclear Information System (INIS)

Fortin, Tara J.; Laesecke, Arno; Freund, Malte; Outcalt, Stephanie

2013-01-01

Highlights: ► Detail important considerations for reference quality measurements of thermophysical property data with benchtop instruments. ► Density and speed of sound of isooctane and speed of sound of toluene at (278 K to 343 K) and atmospheric pressure. ► Experimental data compared to available literature data and equations of state. - Abstract: Benchtop measurement systems have emerged as powerful tools in the ongoing quest for thermophysical property data. We demonstrate that these instruments can yield results of high quality if operated in an informed manner. The importance of sample purity, reproducibility over repeatability, expanded calibration and adjustment protocols, and rigorous uncertainty estimates are emphasized. We report measurement results at ambient atmospheric pressure and temperatures from 343 K to 278 K, including expanded uncertainty estimates, for the density and speed of sound of isooctane and for the speed of sound of toluene. These data are useful for validating the performance of such instruments.

Adjustable speed drive study, June 1985 to September 1988. Part 2: Appendices

Science.gov (United States)

Wallace, Alan

1989-08-01

Advances in speed control for motors in recent years, notably those in power electronics, have widened the range of application for several adjustable speed drive (ASD) types to include the smaller horsepower sizes. The dc motor drive, formerly in almost universal use for speed control, is being challenged by the high efficiency induction motor/pulse width modulation (PWM) drive; and for special small horsepower size applications, by the permanent magnet motor/PWM inverter drive or by the switched reluctance motor drive. The main characteristics of the several ASD types suitable for small horsepower size applications are discussed, as well as their unwanted side effects: poor power factor, harmonic distortion of the supply, acoustic noise, and electromagnetic interference. A procedure is recommended for determining which, if any, ASD to use.

On-Chip AC self-test controller

Science.gov (United States)

Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

2009-09-29

A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

Lifetime Benchmarking of Two DC-link Passive Filtering Configurations in Adjustable Speed Drives

DEFF Research Database (Denmark)

Wang, Haoran; Davari, Pooya; Wang, Huai

2018-01-01

Electrolytic capacitors with a DC-side inductor, and the slim DC-link capacitor are two typical filtering configurations in Adjustable Speed Drives (ASDs). The reliability performance of these capacitive DC-link solutions is an essential aspect to be considered, which depends on both component in...

Model reference adaptive vector control for induction motor without speed sensor

Directory of Open Access Journals (Sweden)

Bo Fan

2017-01-01

Full Text Available The wide applications of vector control improve the high-accuracy performance of alternating current (AC adjustable speed system. In order to obverse the full-order flux and calculate the real-time speed, this article introduces the motor T equivalent circuit to build a full-order flux observer model, where the current and flux variables of stator and rotor are adopted. Model reference adaptive control is introduced to build the AC motor flux observer. The current output is used as feedback to build the feedback matrix. The calculation method of motor speed, which is part of the inputs of flux observation, is applied to realize the adaptive control. The concept of characteristic function is introduced to calculate the flux, of which the foundation is the variables of composite form of voltage and current models. The characteristic function is deduced as a relative-state variable function. The feedback matrix is improved and designed to ensure the motor flux observer is a smooth switch between current and voltage model in low and high speeds, respectively. Experimental results show that the feedback and characteristic model are feasible, and the vector control with speed sensorless based on the full-order flux observer has better performance and anti-disturbance.

Dynamic model tracking design for low inertia, high speed permanent magnet ac motors.

Science.gov (United States)

Stewart, P; Kadirkamanathan, V

2004-01-01

Permanent magnet ac (PMAC) motors have existed in various configurations for many years. The advent of rare-earth magnets and their associated highly elevated levels of magnetic flux makes the permanent magnet motor attractive for many high performance applications from computer disk drives to all electric racing cars. The use of batteries as a prime storage element carries a cost penalty in terms of the unladen weight of the vehicle. Minimizing this cost function requires the minimum electric motor size and weight to be specified, while still retaining acceptable levels of output torque. This tradeoff can be achieved by applying a technique known as flux weakening which will be investigated in this paper. The technique allows the speed range of a PMAC motor to be greatly increased, giving a constant power range of more than 4:1. A dynamic model reference controller is presented which has advantages in ease of implementation, and is particularly suited to dynamic low inertia applications such as clutchless gear changing in high performance electric vehicles. The benefits of this approach are to maximize the torque speed envelope of the motor, particularly advantageous when considering low inertia operation. The controller is examined experimentally, confirming the predicted performance.

Characterization of Input Current Interharmonics in Adjustable Speed Drives

DEFF Research Database (Denmark)

Soltani, Hamid; Davari, Pooya; Zare, Firuz

2017-01-01

This paper investigates the interharmonic generation process in the input current of double-stage Adjustable Speed Drives (ASDs) based on voltage source inverters and front-end diode rectifiers. The effects of the inverter output-side low order harmonics, caused by implementing the double......-edge symmetrical regularly sampled Space Vector Modulation (SVM) technique, on the input current interharmonic components are presented and discussed. Particular attention is also given to the influence of the asymmetrical regularly sampled modulation technique on the drive input current interharmonics....... The developed theoretical analysis predicts the drive interharmonic frequency locations with respect to the selected sampling strategies. Simulation and experimental results on a 2.5 kW ASD system verify the effectiveness of the theoretical analysis....

Wavelet-fuzzy speed indirect field oriented controller for three-phase AC motor drive – Investigation and implementation

Directory of Open Access Journals (Sweden)

Sanjeevikumar Padmanaban

2016-09-01

Full Text Available Three-phase voltage source inverter driven induction motor is used in many medium- and high-power applications. Precision in speed of the motor play vital role, i.e. popular methods of direct/indirect field-oriented control (FOC are applied. FOC is employed with proportional–integral (P-I or proportional–integral–derivative (P-I-D controllers and they are not adaptive, since gains are fixed at all operating conditions. Therefore, it needs a robust speed controlling in precision for induction motor drive application. This research paper articulates a novel speed control for FOC induction motor drive based on wavelet-fuzzy logic interface system. In specific, the P-I-D controller of IFOC which is actually replaced by the wavelet-fuzzy controller. The speed feedback (error signal is composed of multiple low and high frequency components. Further, these components are decomposed by the discrete wavelet transform and the fuzzy logic controller to generate the scaled gains for the indirect FOC induction motor. Complete model of the proposed ac motor drive is developed with numerical simulation Matlab/Simulink software and tested under different working conditions. For experimental verification, a hardware prototype was implemented and the control algorithm is framed using TMS320F2812 digital signal processor (dsp. Both simulation and hardware results presented in this paper are shown in close agreement and conformity about the suitability for industrial applications.

Motor models and transient analysis for high-temperature, superconductor switch-based adjustable speed drive applications. Final report

International Nuclear Information System (INIS)

Bailey, J.M.

1996-06-01

New high-temperature superconductor (HTSC) technology may allow development of an energy-efficient power electronics switch for adjustable speed drive (ASD) applications involving variable-speed motors, superconducting magnetic energy storage systems, and other power conversion equipment. This project developed a motor simulation module for determining optimal applications of HTSC-based power switches in ASD systems

Improved transistorized AC motor controller for battery powered urban electric passenger vehicles

Science.gov (United States)

Peak, S. C.

1982-01-01

An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.

Impact of left ventricular assist device speed adjustment on exercise tolerance and markers of wall stress.

Science.gov (United States)

Hayward, Christopher S; Salamonsen, Robert; Keogh, Anne M; Woodard, John; Ayre, Peter; Prichard, Roslyn; Kotlyar, Eugene; Macdonald, Peter S; Jansz, Paul; Spratt, Phillip

2015-09-01

Left ventricular assist devices are crucial in rehabilitation of patients with end-stage heart failure. Whether cardiopulmonary function is enhanced with higher pump output is unknown. 10 patients (aged 39±16 years, mean±SD) underwent monitored adjustment of pump speed to determine minimum safe low speed and maximum safe high speed at rest. Patients were then randomized to these speed settings and underwent three 6-minute walk tests (6MWT) and symptom-limited cardiopulmonary stress tests (CPX) on separate days. Pump speed settings (low, normal and high) resulted in significantly different resting pump flows of 4.43±0.6, 5.03±0.94, and 5.72±1.2 l/min (Pexercise (Pexercise time (p=.27). Maximum workload achieved and peak oxygen consumption were significantly different comparing low to high pump speed settings only (Prelease was significantly reduced at higher pump speed with exercise (Prelease consistent with lower myocardial wall stress. This did not, however, improve exercise tolerance.

A Review of Electronic Inductor Technique for Power Factor Correction in Three-Phase Adjustable Speed Drives

DEFF Research Database (Denmark)

Davari, Pooya; Yang, Yongheng; Zare, Firuz

2016-01-01

(SiC) power devices. Moreover, the influence of partial loading on component sizing in Adjustable Speed Drives (ASDs) is studied. Finally the analytical loss modelling of power switches is utilized for efficiency measurement. The theoretical analyses are verified by experimental benchmarking in an ASD...

AC electric motors control advanced design techniques and applications

CERN Document Server

Giri, Fouad

2013-01-01

The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

Development of a hardware-based AC microgrid for AC stability assessment

Science.gov (United States)

Swanson, Robert R.

As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

Evaluation of an Advanced Harmonic Filter for Adjustable Speed Drives using a Toolbox Approach

DEFF Research Database (Denmark)

Asiminoaei, Lucian; Hansen, Steffan; Blaabjerg, Frede

2004-01-01

A large diversity of solutions exists to reduce the harmonic emission of the 6-pulse Adjustable Speed Drive in order to fulfill the requirements of the international harmonic standards. Among them, new types of advanced harmonic filters recently gained an increased attention due to their good...... a combination of a pre-stored database and new interpolation techniques the toolbox can provide the harmonic data on real applications allowing comparisons between different mitigation solutions....

Insect-computer hybrid legged robot with user-adjustable speed, step length and walking gait.

Science.gov (United States)

Cao, Feng; Zhang, Chao; Choo, Hao Yu; Sato, Hirotaka

2016-03-01

We have constructed an insect-computer hybrid legged robot using a living beetle (Mecynorrhina torquata; Coleoptera). The protraction/retraction and levation/depression motions in both forelegs of the beetle were elicited by electrically stimulating eight corresponding leg muscles via eight pairs of implanted electrodes. To perform a defined walking gait (e.g., gallop), different muscles were individually stimulated in a predefined sequence using a microcontroller. Different walking gaits were performed by reordering the applied stimulation signals (i.e., applying different sequences). By varying the duration of the stimulation sequences, we successfully controlled the step frequency and hence the beetle's walking speed. To the best of our knowledge, this paper presents the first demonstration of living insect locomotion control with a user-adjustable walking gait, step length and walking speed. © 2016 The Author(s).

Development of AC-DC power system simulator

International Nuclear Information System (INIS)

Ichikawa, Tatsumi; Ueda, Kiyotaka; Inoue, Toshio

1984-01-01

A modeling and realization technique is described for realtime plant dynamics simulation of nuclear power generating unit in AC-DC power system simulator. Dynamic behavior of reactor system and steam system is important for investigation a further adequate unit control and protection system to system faults in AC and DC power system. Each unit of two nuclear power generating unit in the power system simulator consists of micro generator, DC motors, flywheels and process computer. The DC motor and flywheel simulates dynamic characteristics of steam turbine, and process computer simulates plant dynamics by digital simulation. We have realized real-time plant dynamics simulation by utilizing a high speed process I/O and a high speed digital differential analyzing processor (DDA) in which we builted a newly developed simple plant model. (author)

Effects of DC-link Filter on Harmonic and Interharmonic Generation in Three-phase Adjustable Speed Drive Systems

DEFF Research Database (Denmark)

Soltani, Hamid; Davari, Pooya; Kumar, Dinesh

2017-01-01

Harmonic and interharmonic distortions are considered as the main power quality issues especially in the distribution networks. The double-stage Adjustable Speed Drives (ASDs) in which the front-end diode rectifier is connected to a rear-end inverter through an intermediate DC-link filter may inj...

Modeling and reliability analysis of three phase z-source AC-AC converter

Directory of Open Access Journals (Sweden)

Prasad Hanuman

2017-12-01

Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

Implementation of Genetic Algorithm in Control Structure of Induction Motor A.C. Drive

Directory of Open Access Journals (Sweden)

BRANDSTETTER, P.

2014-11-01

Full Text Available Modern concepts of control systems with digital signal processors allow the implementation of time-consuming control algorithms in real-time, for example soft computing methods. The paper deals with the design and technical implementation of a genetic algorithm for setting proportional and integral gain of the speed controller of the A.C. drive with the vector-controlled induction motor. Important simulations and experimental measurements have been realized that confirm the correctness of the proposed speed controller tuned by the genetic algorithm and the quality speed response of the A.C. drive with changing parameters and disturbance variables, such as changes in load torque.

Power-Quality-Oriented Optimization in Multiple Three-Phase Adjustable Speed Drives

DEFF Research Database (Denmark)

Yang, Yongheng; Davari, Pooya; Blaabjerg, Frede

2016-01-01

As an almost standardized configuration, Diode Rectifiers (DRs) and Silicon-Controlled Rectifiers (SCRs) are commonly employed as the front-end topology in three-phase Adjustable Speed Drive (ASD) systems. Features of this ASD configuration include: structural and control simplicity, small volume......, low cost, and high reliability during operation. Yet, DRs and SCRs bring harmonic distortions in the mains and thus lowering the overall efficiency. Power quality standards/rules are thus released. For multiple ASD systems, certain harmonics of the total grid current can be mitigated by phase......-shifting the currents drawn by SCR-fed drives, and thus it is much flexible to reduce the Total Harmonic Distortion (THD) level in such applications. However, the effectiveness of this harmonic mitigation scheme for multiple ASD systems depends on: a) the number of parallel drives, b) the power levels, and c...

Neural network based PWM AC chopper fed induction motor drive

Directory of Open Access Journals (Sweden)

Venkatesan Jamuna

2009-01-01

Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer

Directory of Open Access Journals (Sweden)

Phuc Thinh Doan

2013-06-01

Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43

Application of AC servo motor on the in-core neutron flux instrumentation system

International Nuclear Information System (INIS)

Du Xiaoguang; Wang Mingtao

2010-01-01

The application of ac servo motor in the In-Core Neutron Flux Instrumentation System is described. The hardware component of ac servo motor control system is different from the dc motor control system. The effect of two control system on the instrumentation system is compared. The ac servo motor control system can improve the accuracy of the motion control, optimize the speed control and increase the reliability. (authors)

Torque And Speed in the Actuating of Mechatronic Systems, a Case Study

Directory of Open Access Journals (Sweden)

Constantin Paul Roman

2015-12-01

Full Text Available The paper presents a mechatronic system programmed and controlled by a PLC and inverter for driving an AC motor. Torque and speed for part of mechatronic systems depends of actuating source for cinematic structure. In our research, mechanical structure consists of an AC motor. A technique for setting and control of speed and torque is presented.

FLC based adjustable speed drives for power quality enhancement

Directory of Open Access Journals (Sweden)

Sukumar Darly

2010-01-01

Full Text Available This study describes a new approach based on fuzzy algorithm to suppress the current harmonic contents in the output of an inverter. Inverter system using fuzzy controllers provide ride-through capability during voltage sags, reduces harmonics, improves power factor and high reliability, less electromagnetic interference noise, low common mode noise and extends output voltage range. A feasible test is implemented by building a model of three-phase impedance source inverter, which is designed and controlled on the basis of proposed considerations. It is verified from the practical point of view that these new approaches are more effective and acceptable to minimize the harmonic distortion and improves the quality of power. Due to the complex algorithm, their realization often calls for a compromise between cost and performance. The proposed optimizing strategies may be applied in variable-frequency dc-ac inverters, UPSs, and ac drives.

ac propulsion system for an electric vehicle

Science.gov (United States)

Geppert, S.

1980-01-01

It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

Arm-trunk coordination in wheelchair initiation displacement: A study of anticipatory and compensatory postural adjustments during different speeds and directions of propulsion.

Science.gov (United States)

Chikh, Soufien; Garnier, Cyril; Faupin, Arnaud; Pinti, Antonio; Boudet, Samuel; Azaiez, Fairouz; Watelain, Eric

2018-03-13

Arm-trunk coordination during the initiation of displacement in manual wheelchair is a complex task. The objective of this work is to study the arm-trunk coordination by measuring anticipatory and compensatory postural adjustments. Nine healthy subjects participated in the study after being trained in manual wheelchair. They were asked to initiate a displacement in manual wheelchair in three directions (forward vs. left vs. right), with two speeds (spontaneous vs. maximum) and with two initial hand's positions (hands on thighs vs. hands on handrails). Muscular activities in the trunk (postural component) and the arms (focal component) were recorded bilaterally. The results show two strategies for trunk control: An anticipatory adjustment strategy and a compensatory adjustment strategy with a dominance of compensation. These two strategies are influenced by the finalities of displacement in terms of speed and direction depending on the hands positions. Arm-trunk coordination is characterized by an adaptability of anticipatory and compensatory postural adjustments. The study of this type of coordination for subjects with different levels of spinal cord injury could be used to predict the forthcoming displacement and thus assist the user in a complex task. Copyright © 2018 Elsevier Ltd. All rights reserved.

Application of Boost Converter for Ride-through Capability of Adjustable Speed Drives during Sag and Swell Conditions

OpenAIRE

S. S. Deswal; Ratna Dahiya; D. K. Jain

2008-01-01

Process control and energy conservation are the two primary reasons for using an adjustable speed drive. However, voltage sags are the most important power quality problems facing many commercial and industrial customers. The development of boost converters has raised much excitement and speculation throughout the electric industry. Now utilities are looking to these devices for performance improvement and reliability in a variety of areas. Examples of these include sags,...

Speed controller for an alternating - current motor

International Nuclear Information System (INIS)

Bolie, V.W.

1984-01-01

A controller for a multi-phase ac motor that is subject to a large inertial load, e.g. an induction motor driving a heavy spinning rotor of a neutron chopper that must be rotated in phase-locked synchronism with a reference pulse train that is representative of an ac power supply signal Esub(L) having a meandering line frequency, includes a sensor which provides a feedback pulse train representative of the actual speed of the motor which is compared (by counting clock pulses between feedback pulses) with a reference clock signal in a computing unit to provide a motor control signal Esub(c). The motor control signal is a weighted linear sum of a speed error signal, a phase error signal, and a drift error signal, the magnitudes of which are recalculated and updated with each revolution of the motor shaft. The speed error signal is constant for large speed errors but highly sensitive to small speed errors. The stator windings of the motor are driven by variable-frequency power amplifiers which are controlled by the motor control signal Esub(c) via PROMs which store digital representations of sine and cosine waveforms in quadrature. (author)

AC/DC current ratio in a current superimposition variable flux reluctance machine

Science.gov (United States)

Kohara, Akira; Hirata, Katsuhiro; Niguchi, Noboru; Takahara, Kazuaki

2018-05-01

We have proposed a current superimposition variable flux reluctance machine for traction motors. The torque-speed characteristics of this machine can be controlled by increasing or decreasing the DC current. In this paper, we discuss an AC/DC current ratio in the current superimposition variable flux reluctance machine. The structure and control method are described, and the characteristics are computed using FEA in several AC/DC ratios.

Effects of balanced and unbalanced voltage sags on DC adjustable-speed drives

Energy Technology Data Exchange (ETDEWEB)

Pedra, Joaquin; Sainz, Luis; Corcoles, Felipe; Bergas, Joan [Department of Electrical Engineering, ETSEIB-UPC, Av. Diagonal, 647, 08028 Barcelona (Spain); de Blas, Alfredo [Department of Electrical Engineering, EUETIB-UPC, C. d' Urgell, 187, 08036 Barcelona (Spain)

2008-06-15

This paper analyzes the sensitivity of DC adjustable-speed drives to balanced and unbalanced voltage sags. The influence of sag type, depth, duration and phase-angle jump on DC drives is studied. The control of the DC drive has been taken into account to understand drive behavior in the presence of voltage sags. Two working modes of the DC motor are considered in the study: as a consumer load and as a regenerative load. When the DC motor works as a consumer load, the study shows that sag type and depth have a significant influence on drive behavior. However, the voltage sag can be ridden through if the rectifier firing angle is set correctly by the control. When the DC motor works as a regenerative load, the study shows the consequences of the three-phase rectifier commutation failure due to the voltage sag. (author)

Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers

Directory of Open Access Journals (Sweden)

Abdul Sattar Larik

2011-01-01

Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.

Development of magneto-rheologial fluid (MRF) based clutch for output torque control of AC motors

Science.gov (United States)

Nguyen, Q. Hung; Do, H. M. Hieu; Nguyen, V. Quoc; Nguyen, N. Diep; Le, D. Thang

2018-03-01

In industry, the AC motor is widely used because of low price, power availability, low cost maintenance. The main disadvantages of AC motors compared to DC motors are difficulty in speed and torque control, requiring expensive controllers with complex control algorithms. This is the basic limitations in the widespread adoption of AC motor systems for industrial automation. One feasible solution for AC motor control is using MRF (magneto-rheological fluid) based clutches (shortly called MR clutches) Although there have been many studies on MR clutches, most of these clutches used traditional configuration with coils wound on the middle cylindrical part and a compotator is used to supply power to the coils. Therefore, this type of MR clutches possesses many disadvantages such as high friction and unstable applied current due to commutator, complex structure which causes difficulty in manufacture, assembly, and maintenance. In addition, the bottleneck problem of magnetic field is also a challenging issue. In this research, we will develop a new type of MR clutches that overcomes the abovementioned disadvantages of traditional MR clutches and more suitable for application in controlling of AC motor. Besides, in this study, speed and torque control system for AC motors using developed MR clutches is designed and experimental validated.

Model for the dynamic study of AC contactors

Energy Technology Data Exchange (ETDEWEB)

Corcoles, F.; Pedra, J.; Garrido, J.P.; Baza, R. [Dep. d' Eng. Electrica ETSEIB. UPC, Barcelona (Spain)

2000-08-01

This paper proposes a model for the dynamic analysis of AC contactors. The calculation algorithm and implementation are discussed. The proposed model can be used to study the influence of the design parameters and the supply in their dynamic behaviour. The high calculation speed of the implemented algorithm allows extensive ranges of parameter variations to be analysed. (orig.)

Passive wide spectrum harmonic filter for adjustable speed drives in oil and gas industry

Science.gov (United States)

Al Jaafari, Khaled Ali

Non-linear loads such as variable speed drives constitute the bulky load of oil and gas industry power systems. They are widely used in driving induction and permanent magnet motors for variable speed applications. That is because variable speed drives provide high static and dynamic performance. Moreover, they are known of their high energy efficiency and high motion quality, and high starting torque. However, these non-linear loads are main sources of current and voltage harmonics and lower the quality of electric power system. In fact, it is the six-pulse and twelve-pulse diode and thyristor rectifiers that spoil the AC power line with the dominant harmonics (5th, 7th, 11th). They provide DC voltage to the inverter of the variable speed drives. Typical problems that arise from these harmonics are Harmonic resonances', harmonic losses, interference with electronic equipment, and line voltage distortion at the Point of Common Coupling (PCC). Thus, it is necessary to find efficient, reliable, and economical harmonic filters. The passive filters have definite advantage over active filters in terms of components count, cost and reliability. Reliability and maintenance is a serious issue in drilling rigs which are located in offshore and onshore with extreme operating conditions. Passive filters are tuned to eliminate a certain frequency and therefore there is a need to equip the system with more than one passive filter to eliminate all unwanted frequencies. An alternative solution is Wide Spectrum Harmonic passive filter. The wide spectrum harmonic filters are becoming increasingly popular in these applications and found to overcome some of the limitations of conventional tuned passive filter. The most important feature of wide spectrum harmonic passive filters is that only one capacitor is required to filter a wide range of harmonics. Wide spectrum filter is essentially a low-pass filter for the harmonic at fundamental frequency. It can also be considered as a

Improved SCR ac Motor Controller for Battery Powered Urban Electric Vehicles

Science.gov (United States)

Latos, T. S.

1982-01-01

An improved ac motor controller, which when coupled to a standard ac induction motor and a dc propulsion battery would provide a complete electric vehicle power train with the exception of the mechanical transmission and drive wheels was designed. In such a system, the motor controller converts the dc electrical power available at the battery terminals to ac electrical power for the induction motor in response to the drivers commands. The performance requirements of a hypothetical electric vehicle with an upper weight bound of 1590 kg (3500 lb) were used to determine the power rating of the controller. Vehicle acceleration capability, top speed, and gradeability requisites were contained in the Society of Automotive Engineers (SAE) Schedule 227a(d) driving cycle. The important capabilities contained in this driving cycle are a vehicle acceleration requirement of 0 to 72.4 kmph (0 to 45 mph) in 28 seconds a top speed of 88.5 kmph (55 mph), and the ability to negotiate a 10% grade at 48 kmph (30 mph). A 10% grade is defined as one foot of vertical rise per 10 feet of horizontal distance.

Incorporating YBCO Coated Conductors in High-speed Superconducting Generators

Science.gov (United States)

2008-07-01

4.0 kW/lb (8.82 kW/kg). The machine configuration chosen by GE for design was a homopolar inductor alternator (HIA) which locates the...extremely severe ac loss environment. Even if this is ultimately impossible for high speed generators, it may not preclude lower speed motors and

Precision electronic speed controller for an alternating-current motor

Science.gov (United States)

Bolie, V.W.

A high precision controller for an alternating-current multi-phase electrical motor that is subject to a large inertial load. The controller was developed for controlling, in a neutron chopper system, a heavy spinning rotor that must be rotated in phase-locked synchronism with a reference pulse train that is representative of an ac power supply signal having a meandering line frequency. The controller includes a shaft revolution sensor which provides a feedback pulse train representative of the actual speed of the motor. An internal digital timing signal generator provides a reference signal which is compared with the feedback signal in a computing unit to provide a motor control signal. The motor control signal is a weighted linear sum of a speed error voltage, a phase error voltage, and a drift error voltage, each of which is computed anew with each revolution of the motor shaft. The speed error signal is generated by a novel vernier-logic circuit which is drift-free and highly sensitive to small speed changes. The phase error is also computed by digital logic, with adjustable sensitivity around a 0 mid-scale value. The drift error signal, generated by long-term counting of the phase error, is used to compensate for any slow changes in the average friction drag on the motor. An auxillary drift-byte status sensor prevents any disruptive overflow or underflow of the drift-error counter. An adjustable clocked-delay unit is inserted between the controller and the source of the reference pulse train to permit phase alignment of the rotor to any desired offset angle. The stator windings of the motor are driven by two amplifiers which are provided with input signals having the proper quadrature relationship by an exciter unit consisting of a voltage controlled oscillator, a binary counter, a pair of read-only memories, and a pair of digital-to-analog converters.

AC application of second generation HTS wire

Science.gov (United States)

Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.

2008-02-01

For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.

On the Application of TLS Techniques to AC Electrical Drives

Directory of Open Access Journals (Sweden)

M. Cirrincione

2005-03-01

Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

Should fee-for-service be for all guideline-advocated acute coronary syndrome (ACS) care? Observations from the Snapshot ACS study.

Science.gov (United States)

Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P

2015-09-01

The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.

AC, DC or EC motor? What type of engine for what purpose?; AC-, DC- oder EC-Motor? Welche Motorausfuehrung fuer welchen Zweck

Energy Technology Data Exchange (ETDEWEB)

Zeiff, Andreas; Homburg, Dietrich

2009-01-15

Electronics is the key technology in control engineering, but even the best control system requires reliable modules to transmit signals. Modern electric motors have become indispensable here. There are nearly as many motor types as there are applications. Electromagnetic conversion of electric into mechanical power is directly related to motor design. There are AC and DC motors, one-speed motors and variable-speed motors. Rotary momentum and synchronisation can be optimized by selecting the appropriate motor type, as can dynamics and detent torque. Correct selection of the electric motor therefore is essential for an optimal drive concept. (orig.)

Diode-rectified multiphase AC arc for the improvement of electrode erosion characteristics

Science.gov (United States)

Tanaka, Manabu; Hashizume, Taro; Saga, Koki; Matsuura, Tsugio; Watanabe, Takayuki

2017-11-01

An innovative multiphase AC arc (MPA) system was developed on the basis of a diode-rectification technique to improve electrode erosion characteristics. Conventionally, electrode erosion in AC arc is severer than that in DC arc. This originated from the fact that the required properties for the cathode and anode are different, although an AC electrode works as the cathode and the anode periodically. To solve this problem, a separation of AC electrodes into pairs of thoriated tungsten cathode and copper anode by diode-rectification was attempted. A diode-rectified multiphase AC arc (DRMPA) system was then successfully established, resulting in a drastic improvement of the erosion characteristics. The electrode erosion rate in the DRMPA was less than one-third of that in the conventional MPA without the diode rectification. In order to clarify its erosion mechanism, electrode phenomena during discharge were visualized by a high-speed camera system with appropriate band-pass filters. Fluctuation characteristics of the electrode temperature in the DRMPA were revealed.

76 FR 74720 - Inflation Adjustment of Civil Monetary Penalties; Correction

Science.gov (United States)

2011-12-01

... FEDERAL MARITIME COMMISSION 46 CFR Part 506 [Docket No. 09-04] RIN 3072-AC36 Inflation Adjustment... published in the Federal Register of Friday, July 31, 2009 (74 FR 38114). The rule adjusts for inflation the... accordance with the requirements of the Federal Civil Penalties Inflation Adjustment Act of 1990, as amended...

Dynamic modelling and analysis of a wind turbine with variable speed

NARCIS (Netherlands)

Steinbuch, M.

1986-01-01

On behalf of the operation of the Dutch National Wind Farm, which is under construction now, a study is being performed on the control system design of variable speed wind turbines. To realize this a non-linear dynamic model of a wind turbine with synchronous generator and AC/ DC/AC conversion has

Feedforward Synchronised PWM for Adjustable Speed AC Drives with Different Control Modes

DEFF Research Database (Denmark)

Oleschuk, Valentin; Blaabjerg, Frede; Jensen, Flemming Buus

2002-01-01

This paper presents a novel method of direct synchronised pulswidth modulation (PWM) for three-phase voltage source inverters, feeding induction motors with different control regimes. It is based on the universal algorithm with either simplified algebraic or accurate trigonometric control functions......, with vector approached for determination of the pulse patterns, with vector approach for determination of the pulse patterns. Different control modes of the drive system with synchronised PWM, including standard scalar V/F control, and also V2/F = constant and V/F2 = constant control regimes, have been...... analysed in the paper. Simulations give the behaviour of the PWM techniques proposed. Both continuous and discontinuous schemes of synchronised PWM, applied for the corresponding control regime, have been analysed and compared....

Power Electronic Transformer based Three-Phase PWM AC Drives

Science.gov (United States)

Basu, Kaushik

A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

Circuit Regulates Speed Of dc Motor

Science.gov (United States)

Weaver, Charles; Padden, Robin; Brown, Floyd A., Jr.

1990-01-01

Driving circuit regulates speed of small dc permanent-magnet motor in tape recorder. Two nested feedback loops maintain speed within 1 percent of constant value. Inner loop provides coarse regulation, while outer loop removes most of variation in speed that remains in the presence of regulation by the inner loop. Compares speed of motor with commanded speed and adjusts current supplied to motor accordingly.

Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

International Nuclear Information System (INIS)

Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

1997-01-01

The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

Adjustable-Speed Single-Phase IM Drive with Reduced Number of Switches

Czech Academy of Sciences Publication Activity Database

Chomát, Miroslav; Lipo, T. A.

2003-01-01

Roč. 39, č. 3 (2003), s. 819-825 ISSN 0093-9994 R&D Projects: GA ČR GA102/02/0554 Grant - others:National Science Foundation(US) GA9820434 Institutional research plan: CEZ:AV0Z2057903 Keywords : AC motor drives * converters * induction motor drives Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.783, year: 2003

Performance Evaluation of Electronic Inductor-Based Adjustable Speed Drives with Respect to Line Current Interharmonics

DEFF Research Database (Denmark)

Soltani, Hamid; Davari, Pooya; Blaabjerg, Frede

2017-01-01

Electronic Inductor (EI)-based front-end rectifiers have a large potential to become the prominent next generation of Active Front End (AFE) topology used in many applications including Adjustable Speed Drives (ASDs) for systems having unidirectional power flow. The EI-based ASD is mostly...... attractive due to its improved harmonic performance compared to a conventional ASD. In this digest, the input currents of the EI-based ASD are investigated and compared with the conventional ASDs with respect to interharmonics, which is an emerging power quality topic. First, the main causes...... of the interharmonic distortions in the ASD applications are analyzed under balanced and unbalanced load conditions. Thereafter, the key role of the EI at the DC stage is investigated in terms of high impedance and current harmonics transfer. Obtained experiments and simulations for both EI-based and conventional ASD...

Critical Speed Control for a Fixed Blade Variable Speed Wind Turbine

Directory of Open Access Journals (Sweden)

Morgan Rossander

2017-10-01

Full Text Available A critical speed controller for avoiding a certain rotational speed is presented. The controller is useful for variable speed wind turbines with a natural frequency in the operating range. The controller has been simulated, implemented and tested on an open site 12 kW vertical axis wind turbine prototype. The controller is based on an adaptation of the optimum torque control. Two lookup tables and a simple state machine provide the control logic of the controller. The controller requires low computational resources, and no wind speed measurement is needed. The results suggest that the controller is a feasible method for critical speed control. The skipping behavior can be adjusted using only two parameters. While tested on a vertical axis wind turbine, it may be used on any variable speed turbine with the control of generator power.

Load-Independent Harmonic Mitigation in SCR-Fed Three-Phase Multiple Adjustable Speed Drive Systems with Deliberately Dispatched Firing Angles

DEFF Research Database (Denmark)

Yang, Yongheng; Davari, Pooya; Blaabjerg, Frede

2018-01-01

Adjustable speed drives (ASD) are widely used in industry for energy savings, where low-cost diode rectifiers are still employed as the front-ends, also for simplicity in control and reliability in operation. However, significant harmonics appear at the grid, which should be tackled according...... a harmonic mitigation strategy for multiple ASD systems, where silicon-controlled rectifiers (SCR) with boost converters in the dc-link have been adopted to increase the harmonic-current controllability. More specific, the SCR firing angles are deliberately dispatched among the drive units, which results...

AC Initiation System.

Science.gov (United States)

An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

Variable-speed, portable routing skate

Science.gov (United States)

Pesch, W. A.

1967-01-01

Lightweight, portable, variable-speed routing skate is used on heavy metal subassemblies which are impractical to move to a stationary machine. The assembly, consisting of the housing with rollers, router, and driving mechanism with transmission, weighs about forty pounds. Both speed and depth of cut are adjustable.

Speed control at low wind speeds for a variable speed fixed pitch wind turbine

Energy Technology Data Exchange (ETDEWEB)

Rosmin, N.; Watson, S.J.; Tompson, M. [Loughborough Univ., Loughborough, Leicestershire (United Kingdom)

2010-03-09

The maximum power regulation below rated wind speed is regulated by changing the rotor/generator speed at large frequency range in a fixed pitch, variable speed, stall-regulated wind turbine. In order to capture the power at a maximum value the power coefficient is kept at maximum peak point by maintaining the tip speed ratio at its optimum value. The wind industry is moving from stall regulated fixed speed wind turbines to newer improved innovative versions with better reliability. While a stall regulated fixed pitch wind turbine is among the most cost-effective wind turbine on the market, its problems include noise, severe vibrations, high thrust loads and low power efficiency. Therefore, in order to improve such drawbacks, the rotation of the generator speed is made flexible where the rotation can be controlled in variable speed. This paper discussed the development of a simulation model which represented the behaviour of a stall regulated variable speed wind turbine at low wind speed control region by using the closed loop scalar control with adjustable speed drive. The paper provided a description of each sub-model in the wind turbine system and described the scalar control of the induction machine. It was concluded that by using a constant voltage/frequency ratio of the generator's stator side control, the generator speed could be regulated and the generator torque could be controlled to ensure the power coefficient could be maintained close to its maximum value. 38 refs., 1 tab., 10 figs.

Internal Heating of an IGBT module in a System With a Regenerative AC Drive

OpenAIRE

Mabano, Michel

2016-01-01

The purpose of this thesis was to understand the internal heating of an IGBT module inside an AC drive in a system with a regenerative unit to it. During the implementation of the lab, various approaches were taken in an effort to collect measurements appropriate to the topic of investigation. The IGBT junction temperature was recorded over a sustained period of time at various speed of the induction motor. The braking torque applied through a second AC drive was varied in order to study...

Near-optimal order-reduced control for A/C (air-conditioning) system of EVs (electric vehicles)

International Nuclear Information System (INIS)

Chiu, Chien-Chin; Tsai, Nan-Chyuan; Lin, Chun-Chi

2014-01-01

This work is aimed to investigate the regulation problem for thermal comfortableness and propose control strategies for cabin environment of EVs (electric vehicles) by constructing a reduced-scale A/C (air-conditioning) system which mainly consists of two modules: ECB (environmental control box) and AHU (air-handling unit). Temperature and humidity in the ECB can be regulated by AHU via cooling, heating, mixing air streams and adjusting speed of fans. To synthesize the near-optimal controllers, the mathematical model for the system thermodynamics is developed by employing the equivalent lumped heat capacity approach, energy/mass conservation principle and the heat transfer theories. In addition, from the clustering pattern of system eigenvalues, the thermodynamics of the interested system can evidently be characterized by two-time-scale property. That is, the studied system can be decoupled into two subsystems, slow mode and fast mode, by singular perturbation technique. As to the optimal control strategies for EVs, by taking thermal comfortableness, humidity and energy consumption all into account, a series of optimal controllers is synthesized on the base of the order-reduced thermodynamic model. The feedback control loop for the experimental test rig is examined and realized by the aid of the control system development kit dSPACE DS1104 and the commercial software MATLAB/Simulink. To sum up, the intensive computer simulations and experimental results verify that the performance of the near-optimal order-reduced control law is almost as superior as that of standard LQR (Linear-Quadratic Regulator). - Highlights: • A reduced-scale test rig for A/C (air-conditioning) system to imitate the temperature/humidity of cabin in EV (electric vehicle) is constructed. • The non-linear thermodynamic model of A/C system can be decoupled by singular perturbation technique. • The temperature/humidity in cabin is regulated to the desired values by proposed optimal

Study on ac losses of HTS coil carrying ac transport current

International Nuclear Information System (INIS)

Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

2005-01-01

Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

Multi-phase AC/AC step-down converter for distribution systems

Science.gov (United States)

Aeloiza, Eddy C.; Burgos, Rolando P.

2017-10-25

A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

Study on emergency power control strategy for AC/DC hybrid power system containing VSC-HVDC

Science.gov (United States)

Liu, Lin; Hu, Zhenda; Ye, Rong; Lin, Zhangsui; Yang, Xiaodong; Yi, Yang

2018-04-01

This paper presents a comprehensive emergency power control strategy for AC/DC hybrid power systems containing VSC-HVDC. Firstly, the paper analyzes the power support of the VSC-HVDC to the AC lines using the Power Transferring Relativity Factor (PTRF). Then the power adjustment of the VSC-HVDC in several different circumstances are calculated. Finally, the online power control strategies of VSC-HVDC are designed, which could rapidly control the power of the VSC-HVDC, keeping the power flow of AC lines below the upper limit. Furthermore, the strategy is proven to be effective by the simulations with EMTDC/PSCAD.

A New Coordinated Voltage Control Scheme for Offshore AC Grid of HVDC Connected Offshore Wind Power Plants

DEFF Research Database (Denmark)

Sakamuri, Jayachandra N.; Cutululis, Nicolaos Antonio; Rather, Zakir Hussain

2015-01-01

This paper proposes a coordinated voltage control scheme (CVCS) which enhances the voltage ride through (VRT) capability of an offshore AC grid comprised of a cluster of offshore wind power plants (WPP) connected through AC cables to the offshore voltage source converter based high voltage DC (VSC......-HVDC) converter station. Due to limited short circuit power contribution from power electronic interfaced variable speed wind generators and with the onshore main grid decoupled by the HVDC link, the offshore AC grid becomes more vulnerable to dynamic voltage events. Therefore, a short circuit fault...... in the offshore AC Grid is likely to have significant implications on the voltage of the offshore AC grid, hence on the power flow to the onshore mainland grid. The proposed CVCS integrates individual local reactive power control of wind turbines and of the HVDC converter with the secondary voltage controller...

Dynamic Modeling of Adjustable-Speed Pumped Storage Hydropower Plant: Preprint

Energy Technology Data Exchange (ETDEWEB)

Muljadi, E.; Singh, M.; Gevorgian, V.; Mohanpurkar, M.; Havsapian, R.; Koritarov, V.

2015-04-06

Hydropower is the largest producer of renewable energy in the U.S. More than 60% of the total renewable generation comes from hydropower. There is also approximately 22 GW of pumped storage hydropower (PSH). Conventional PSH uses a synchronous generator, and thus the rotational speed is constant at synchronous speed. This work details a hydrodynamic model and generator/power converter dynamic model. The optimization of the hydrodynamic model is executed by the hydro-turbine controller, and the electrical output real/reactive power is controlled by the power converter. All essential controllers to perform grid-interface functions and provide ancillary services are included in the model.

PV Array Driven Adjustable Speed Drive for a Lunar Base Heat Pump

Science.gov (United States)

Domijan, Alexander, Jr.; Buchh, Tariq Aslam

1995-01-01

A study of various aspects of Adjustable Speed Drives (ASD) is presented. A summary of the relative merits of different ASD systems presently in vogue is discussed. The advantages of using microcomputer based ASDs is now widely understood and accepted. Of the three most popular drive systems, namely the Induction Motor Drive, Switched Reluctance Motor Drive and Brushless DC Motor Drive, any one may be chosen. The choice would depend on the nature of the application and its requirements. The suitability of the above mentioned drive systems for a photovoltaic array driven ASD for an aerospace application are discussed. The discussion is based on the experience of the authors, various researchers and industry. In chapter 2 a PV array power supply scheme has been proposed, this scheme will have an enhanced reliability in addition to the other known advantages of the case where a stand alone PV array is feeding the heat pump. In chapter 3 the results of computer simulation of PV array driven induction motor drive system have been included. A discussion on these preliminary simulation results have also been included in this chapter. Chapter 4 includes a brief discussion on various control techniques for three phase induction motors. A discussion on different power devices and their various performance characteristics is given in Chapter 5.

Enhanced Phase-Shifted Current Control for Harmonic Cancellation in Three-Phase Multiple Adjustable Speed Drive Systems

DEFF Research Database (Denmark)

Yang, Yongheng; Davari, Pooya; Zare, Firuz

2017-01-01

A phase-shifted current control can be employed to mitigate certain harmonics induced by the Diode Rectifiers (DR) and Silicon-Controlled Rectifiers (SCR) as the front-ends of multiple parallel Adjustable Speed Drive (ASD) systems. However, the effectiveness of the phase-shifted control relies...... on the loading condition of each drive unit as well as the number of drives in parallel. In order to enhance the harmonic cancellation by means of the phase-shifted current control, the currents drawn by the rectifiers should be maintained almost at the same level. Thus, this paper firstly analyzes the impact...... of unequal loading among the parallel drives, and a scheme to enhance the performance is introduced to improve the quality of the total grid current, where partial loading operation should be enabled. Simulation and experimental case studies on multidrive systems have demonstrated that the enhanced phase...

Variable speed drives boost air handler benefits

Energy Technology Data Exchange (ETDEWEB)

Twenty-four separate roof-top air handlers, controlled by variable speed ac motor drives, provide comfort and ventilation for employees at a 500,000 sq. ft. sportswear distribution center in southern Virginia. They were chosen over optional packaged HVAC units because of their flexibility, efficiency, and short payback advantages. The operation of the units is described.

AC – AC Converters for UPS

Directory of Open Access Journals (Sweden)

Rusalin Lucian R. Păun

2008-05-01

Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

Performance of AC/graphite capacitors at high weight ratios of AC/graphite

Energy Technology Data Exchange (ETDEWEB)

Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

2008-03-01

The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

Equity Mispricing and Leverage Adjustment Costs

NARCIS (Netherlands)

Warr, R.S.; Elliott, W.B.; Koeter-Kant, J.; Oztekin, O.

2012-01-01

We find that equity mispricing impacts the speed at which firms adjust to their target leverage (TL) and does so in predictable ways depending on whether the firm is over- or underlevered. For example, firms that are above their TL and should therefore issue equity (or retire debt) adjust more

Adjusted State Teacher Salaries and the Decision to Teach

OpenAIRE

Rickman, Dan S.; Wang, Hongbo; Winters, John V.

2015-01-01

Using the 3-year sample of the American Community Survey (ACS) for 2009 to 2011, we compute public school teacher salaries for comparison across U.S. states. Teacher salaries are adjusted for state differences in teacher characteristics, cost of living, household amenity attractiveness and federal tax rates. Salaries of non-teaching college graduates, defined as those with occupations outside of education, are used to adjust for state household amenity attractiveness. We then find that state ...

Dynamic Speed Adaptation for Path Tracking Based on Curvature Information and Speed Limits.

Science.gov (United States)

Gámez Serna, Citlalli; Ruichek, Yassine

2017-06-14

A critical concern of autonomous vehicles is safety. Different approaches have tried to enhance driving safety to reduce the number of fatal crashes and severe injuries. As an example, Intelligent Speed Adaptation (ISA) systems warn the driver when the vehicle exceeds the recommended speed limit. However, these systems only take into account fixed speed limits without considering factors like road geometry. In this paper, we consider road curvature with speed limits to automatically adjust vehicle's speed with the ideal one through our proposed Dynamic Speed Adaptation (DSA) method. Furthermore, 'curve analysis extraction' and 'speed limits database creation' are also part of our contribution. An algorithm that analyzes GPS information off-line identifies high curvature segments and estimates the speed for each curve. The speed limit database contains information about the different speed limit zones for each traveled path. Our DSA senses speed limits and curves of the road using GPS information and ensures smooth speed transitions between current and ideal speeds. Through experimental simulations with different control algorithms on real and simulated datasets, we prove that our method is able to significantly reduce lateral errors on sharp curves, to respect speed limits and consequently increase safety and comfort for the passenger.

Offshore windfarm connection with low frequency AC transmission technology

DEFF Research Database (Denmark)

Qin, Nan; Xu, Zhao; You, Shi

2009-01-01

This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...... developed, which consists of three parts, the fixed-speed wind turbine representing a wind farm, the transmission line and the frequency converter. Although the transmission capability is greatly improved by the LFAC system, simulation shows it gives negative influences on the wind turbine operation due...

Power Quality Control and Design of Power Converter for Variable-Speed Wind Energy Conversion System with Permanent-Magnet Synchronous Generator

Directory of Open Access Journals (Sweden)

Yüksel Oğuz

2013-01-01

Full Text Available The control strategy and design of an AC/DC/AC IGBT-PMW power converter for PMSG-based variable-speed wind energy conversion systems (VSWECS operation in grid/load-connected mode are presented. VSWECS consists of a PMSG connected to a AC-DC IGBT-based PWM rectifier and a DC/AC IGBT-based PWM inverter with LCL filter. In VSWECS, AC/DC/AC power converter is employed to convert the variable frequency variable speed generator output to the fixed frequency fixed voltage grid. The DC/AC power conversion has been managed out using adaptive neurofuzzy controlled inverter located at the output of controlled AC/DC IGBT-based PWM rectifier. In this study, the dynamic performance and power quality of the proposed power converter connected to the grid/load by output LCL filter is focused on. Dynamic modeling and control of the VSWECS with the proposed power converter is performed by using MATLAB/Simulink. Simulation results show that the output voltage, power, and frequency of VSWECS reach to desirable operation values in a very short time. In addition, when PMSG based VSWECS works continuously with the 4.5 kHz switching frequency, the THD rate of voltage in the load terminal is 0.00672%.

Power quality control and design of power converter for variable-speed wind energy conversion system with permanent-magnet synchronous generator.

Science.gov (United States)

Oğuz, Yüksel; Güney, İrfan; Çalık, Hüseyin

2013-01-01

The control strategy and design of an AC/DC/AC IGBT-PMW power converter for PMSG-based variable-speed wind energy conversion systems (VSWECS) operation in grid/load-connected mode are presented. VSWECS consists of a PMSG connected to a AC-DC IGBT-based PWM rectifier and a DC/AC IGBT-based PWM inverter with LCL filter. In VSWECS, AC/DC/AC power converter is employed to convert the variable frequency variable speed generator output to the fixed frequency fixed voltage grid. The DC/AC power conversion has been managed out using adaptive neurofuzzy controlled inverter located at the output of controlled AC/DC IGBT-based PWM rectifier. In this study, the dynamic performance and power quality of the proposed power converter connected to the grid/load by output LCL filter is focused on. Dynamic modeling and control of the VSWECS with the proposed power converter is performed by using MATLAB/Simulink. Simulation results show that the output voltage, power, and frequency of VSWECS reach to desirable operation values in a very short time. In addition, when PMSG based VSWECS works continuously with the 4.5 kHz switching frequency, the THD rate of voltage in the load terminal is 0.00672%.

The FL/AC ratio for prediction of shoulder dystocia in women with gestational diabetes.

Science.gov (United States)

Duryea, Elaine L; Casey, Brian M; McIntire, Donald D; Twickler, Diane M

2017-10-01

To determine if sonographic variables, including fetal femur length to abdominal circumference (FL/AC) ratio, are associated with shoulder dystocia in women with gestational diabetes. This was a retrospective cohort study of women with gestational diabetes who delivered singleton infants at Parkland Hospital from 1997 to 2015. Diagnosis and treatment of gestational diabetes were uniform including sonography at 32-36 weeks. Biometric calculations were evaluated for correlation with shoulder dystocia. During the study period, 6952 women with gestational diabetes underwent a sonogram at a mean gestation of 34.8 ± 1.8 weeks. Of 4183 vaginal deliveries, 66 experienced shoulder dystocia (16/1000). The FL/AC was associated with shoulder dystocia (p dystocia in women with gestational diabetes. Additionally, it is a simple ratio that is independent of the reference used and remains stable, unlike age-adjusted AC and HC/AC ratio.

Variable Speed Wind Turbine Based on Multiple Generators Drive-Train Configuration

DEFF Research Database (Denmark)

Deng, Fujin; Chen, Zhe

2010-01-01

A variable speed wind turbine is presented in this paper, where multiple permanent magnet synchronous generators (MPMSGs) drive-train configuration is employed in the wind turbine. A cascaded multilevel converter interface based on the MPMSGs is developed to synthesize a desired high ac sinusoidal...... output voltage, which could be directly connected to the grids. What is more, such arrangement has been made so that the output ac voltage having a selected phase angle difference among the stator windings of multiple generators. A phase angle shift strategy is proposed in this paper, which effectively...... reduce the fluctuation of the electromagnetic torque sum and results in a good performance for the MPMSGs structure. The simulation study is conducted using PSCAD/EMTDC, and the results verify the feasibility of this variable speed wind turbine based on multiple generators drive-train configuration....

The correction of linear lattice gradient errors using an AC dipole

Energy Technology Data Exchange (ETDEWEB)

Wang,G.; Bai, M.; Litvinenko, V.N.; Satogata, T.

2009-05-04

Precise measurement of optics from coherent betatron oscillations driven by ac dipoles have been demonstrated at RHIC and the Tevatron. For RHIC, the observed rms beta-beat is about 10%. Reduction of beta-beating is an essential component of performance optimization at high energy colliders. A scheme of optics correction was developed and tested in the RHIC 2008 run, using ac dipole optics for measurement and a few adjustable trim quadruples for correction. In this scheme, we first calculate the phase response matrix from the. measured phase advance, and then apply singular value decomposition (SVD) algorithm to the phase response matrix to find correction quadruple strengths. We present both simulation and some preliminary experimental results of this correction.

A Simple Measure of Price Adjustment Coefficients.

OpenAIRE

Damodaran, Aswath

1993-01-01

One measure of market efficiency is the speed with which prices adjust to new information. The author develops a simple approach to estimating these price adjustment coefficients by using the information in return processes. This approach is used to estimate t he price adjustment coefficients for firms listed on the NYSE and the A MEX as well as for over-the-counter stocks. The author finds evidence of a lagged adjustment to new information in shorter return intervals for firms in all market ...

Fifteen Years of Operation at NASA's National Transonic Facility with the World's Largest Adjustable Speed Drive

Science.gov (United States)

Sydnor, George H.; Bhatia, Ram; Krattiger, Hansueli; Mylius, Justus; Schafer, D.

2012-01-01

In September 1995, a project was initiated to replace the existing drive line at NASA's most unique transonic wind tunnel, the National Transonic Facility (NTF), with a single 101 MW synchronous motor driven by a Load Commutated Inverter (LCI). This Adjustable Speed Drive (ASD) system also included a custom four-winding transformer, harmonic filter, exciter, switch gear, control system, and feeder cable. The complete system requirements and design details have previously been presented and published [1], as well as the commissioning and acceptance test results [2]. The NTF was returned to service in December 1997 with the new drive system powering the fan. Today, this installation still represents the world s largest horizontal single motor/drive combination. This paper describes some significant events that occurred with the drive system during the first 15 years of service. These noteworthy issues are analyzed and root causes presented. Improvements that have substantially increased the long term viability of the system are given.

Generating an AC amplitude magnetic flux density value up to 150 μT at a frequency up to 100 kHz

Science.gov (United States)

Ulvr, Michal; Polonský, Jakub

2017-05-01

AC magnetic field analyzers with a triaxial coil probe are widely used by health and safety professionals, in manufacturing, and in service industries. For traceable calibration of these analyzers, it is important to be able to generate a stable, homogeneous reference AC magnetic flux density (MFD). In this paper, the generating of AC amplitude MFD value of 150 μT by single-layer Helmholtz type solenoid, described in previous work, was expanded up to a frequency of 100 kHz using the effect of serial resonance. A programmable capacitor array has been developed with a range of adjustable values from 50 pF to 51225 pF. In addition, the multi-layer search coil with a nominal area turns value of 1.3m2, used for adjusting AC MFD in the solenoid, has been modified by a transimpedance amplifier for use in a wider frequency range than up to 3 kHz. The possibility of using the programmable capacitor array up to 150 kHz has also been tested. An AC amplitude MFD value of 150 μT can be generated with expanded uncertainty better than 0.6% up to 100 kHz.

Extended cage adjustable speed electric motors and drive packages

Science.gov (United States)

Hsu, John S.

1999-01-01

The rotor cage of a motor is extended, a second stator is coupled to this extended rotor cage, and the windings have the same number of poles. The motor torque and speed can be controlled by either injecting energy into or extracting energy out from the rotor cage. The motor produces less harmonics than existing doubly-fed motors. Consequently, a new type of low cost, high efficiency drive is produced.

Fixed-speed active-stall wind turbines in offshore applications

DEFF Research Database (Denmark)

Akhmatov, Vladislav; Nielsen, Arne Hejde

2005-01-01

A large offshore wind farm in the East Danish power system was commissioned in 2003 at Rodsand. The power capacity of the wind farm is 165 MW divided between 72 wind turbines. For this large offshore application, robust and well-known wind technology has been chosen in the form of fixed-speed, ac...

Time evolution of propagating nonpremixed flames in a counterflow, annular slot burner under AC electric fields

KAUST Repository

Tran, Vu Manh

2016-06-19

The mechanism behind improved flame propagation speeds under electric fields is not yet fully understood. Although evidence supports that ion movements cause ionic wind, how this wind affects flame propagation has not been addressed. Here, we apply alternating current electric fields to a gap between the upper and lower parts of a counterflow, annular slot burner and present the characteristics of the propagating nonpremixed edge-flames produced. Contrary to many other previous studies, flame displacement speed decreased with applied AC voltage, and, depending on the applied AC frequency, the trailing flame body took on an oscillatory wavy motion. When flame displacement speeds were corrected using measured unburned flow velocities, we found no significant difference in flame propagation speeds, indicating no thermal or chemical effects by electric fields on the burning velocity. Thus, we conclude that the generation of bidirectional ionic wind is responsible for the impact of electric fields on flames and that an interaction between this bidirectional ionic wind and the flame parameters creates visible and/or measurable phenomenological effects. We also explain that the presence of trailing flame bodies is a dynamic response to an electric body force on a reaction zone, an area that can be considered to have a net positively charged volume. In addition, we characterize the wavy motion of the transient flame as a relaxation time independent of mixture strength, strain rate, and Lewis number.

Design amp Validation Of E-Rpm Adjustment Assembly For Mechanical Governor System

Directory of Open Access Journals (Sweden)

Shashi kumar manhotra

2017-11-01

Full Text Available This paper detailing the problem of speed fluctuation of IDI engine Rpm i.e. hunting and dipping. It is due to E-RPM adjustment assembly for mechanical centrifugal flyweight governor system. E-RPM adjustment assembly works mainly for high speed adjustment ampidle speed adjustment. In mechanical centrifugal flyweight governor system of IDI engine issue at idle rpm hunting and dipping issue was reported in field.New designs of plunger type stopper cover with compressed coil spring are proposed for E-RPM adjustment assembly for mechanical centrifugal fly-weight governor system. 3D-Modeling of new design is done on Seimens NX. Kinematic simulation was done with the help of Altairs Motion-View amp Motion-Solver. Based on the results from MBD the prototype is made and tested in engine. As per the test results from engine testing with new design there is no hunting and dipping problem is reported at idle rpm.

Peltier ac calorimeter

OpenAIRE

Jung, D. H.; Moon, I. K.; Jeong, Y. H.

2001-01-01

A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

Digital model for harmonic interactions in AC/DC/AC systems

Energy Technology Data Exchange (ETDEWEB)

Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

1994-12-31

The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

A New Structure Based on Cascaded Multilevel Converter for Variable Speed Wind Turbine

DEFF Research Database (Denmark)

Deng, Fujin; Chen, Zhe

2010-01-01

An alternative structure for variable speed wind turbine, using multiple permanent magnet synchronous generators (PMSGs) drive-train configuration and cascaded multilevel converter is proposed in this paper. This study presents a power electronic solution for the wind turbine. A transformer......-less cascaded multilevel converter interface based on PMSGs is developed to synthesize a desired high ac sinusoidal output voltage. The benefits of high power and high ac voltage make this structure possible to be applied in the wind power generation. In addition, the bulky transformer could be omitted....... A simulation model of 10 MW variable speed wind turbine based on PMSGs developed in PSCAD/EMTDC is presented. The dynamic performance of grid-connected wind turbine is analyzed. Simulation results shows that the proposed structure may be attractive in wind power generation....

Fast visual prediction and slow optimization of preferred walking speed.

Science.gov (United States)

O'Connor, Shawn M; Donelan, J Maxwell

2012-05-01

People prefer walking speeds that minimize energetic cost. This may be accomplished by directly sensing metabolic rate and adapting gait to minimize it, but only slowly due to the compounded effects of sensing delays and iterative convergence. Visual and other sensory information is available more rapidly and could help predict which gait changes reduce energetic cost, but only approximately because it relies on prior experience and an indirect means to achieve economy. We used virtual reality to manipulate visually presented speed while 10 healthy subjects freely walked on a self-paced treadmill to test whether the nervous system beneficially combines these two mechanisms. Rather than manipulating the speed of visual flow directly, we coupled it to the walking speed selected by the subject and then manipulated the ratio between these two speeds. We then quantified the dynamics of walking speed adjustments in response to perturbations of the visual speed. For step changes in visual speed, subjects responded with rapid speed adjustments (lasting 300 s). The timing and direction of these responses strongly indicate that a rapid predictive process informed by visual feedback helps select preferred speed, perhaps to complement a slower optimization process that seeks to minimize energetic cost.

Performance Analysis of Three-Phase Induction Motor with AC Direct and VFD

Science.gov (United States)

Kumar, Dinesh

2018-03-01

The electrical machine analysis and performance calculation is a very important aspect of efficient drive system design. The development of power electronics devices and power converters provide smooth speed control of Induction Motors by changing the frequency of input supply. These converters, on one hand are providing a more flexible speed control that also leads to problems of harmonics and their associated ailments like pulsating torque, distorted current and voltage waveforms, increasing losses etc. This paper includes the performance analysis of three phase induction motor with three-phase AC direct and variable frequency drives (VFD). The comparison has been concluded with respect to various parameters. MATLAB-SIMULINKTM is used for the analysis.

DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

Directory of Open Access Journals (Sweden)

S. YU. Buryak

2014-05-01

Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

Analysis and control of induction generator supplying stand-alone AC loads employing a Matrix Converter

Directory of Open Access Journals (Sweden)

Sumedha Mahajan

2017-04-01

Full Text Available This paper proposes a Capacitor Excited Induction Generator (CEIG-Matrix Converter (MC system for feeding stand-alone AC loads. The variable output voltage magnitude and frequency from CEIG is converted into a constant voltage magnitude and frequency at the load terminals by controlling MC using Space Vector Modulation (SVM technique. This single-stage MC is turned up as a good alternative for the proposed system against commonly used AC/DC/AC two stage power converters. The configuration and implementation of the closed-loop control scheme employing dSPACE 1103 real time controller have been fully described in the paper. The proposed closed-loop controller regulates the AC load voltage irrespective of changes in the prime mover speed and load. A method for predetermining the steady-state performance of the proposed system has been developed and described with relevant analytical expressions. The effectiveness of the proposed system is exemplified through simulation results for various operating conditions. The proposed control technique is further validated using an experimental setup developed in the laboratory.

Stability control for high speed tracked unmanned vehicles

Science.gov (United States)

Pape, Olivier; Morillon, Joel G.; Houbloup, Philippe; Leveque, Stephane; Fialaire, Cecile; Gauthier, Thierry; Ropars, Patrice

2005-05-01

The French Military Robotic Study Program (introduced in Aerosense 2003), sponsored by the French Defense Procurement Agency and managed by Thales as the prime contractor, focuses on about 15 robotic themes which can provide an immediate "operational add-on value". The paper details the "automatic speed adjustment" behavior (named SYR4), developed by Giat Industries Company, which main goal is to secure the teleoperated mobility of high speed tracked vehicles on rough grounds; more precisely, the validated low level behavior continuously adjusts the vehicle speed taking into account the teleperator wish AND the maximum speed that the vehicle can manage safely according to the commanded radius of curvature. The algorithm is based on a realistic physical model of the ground-tracks relation, taking into account many vehicle and ground parameters (such as ground adherence and dynamic specificities of tracked vehicles). It also deals with the teleoperator-machine interface, providing a balanced strategy between both extreme behaviors: a) maximum speed reduction before initiating the commanded curve; b) executing the minimum possible radius without decreasing the commanded speed. The paper presents the results got from the military acceptance tests performed on tracked SYRANO vehicle (French Operational Demonstrator).

Jump Testing and the Speed of Market Adjustment

DEFF Research Database (Denmark)

Rasmussen, Torben B.

Asymptotic properties of jump tests rely on the property that any jump occurs within a single time interval no matter what the observation frequency is. Market microstructure effects in relation to news-induced revaluation of the underlying variable is likely to make this an unrealistic assumption...... for high-frequency transaction data. To capture these microstructure effects, this paper suggests a model in which market prices adjust gradually to jumps in the underlying effcient price. A case study illustrates the empirical relevance of the model, and the performance of different jump tests...

ACS Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2005-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

基于牵引仿真的列车运行图软冲突疏解方法研究%Research on Train Scheduling for High-speed Railway Lines Based on Soft Conflict Adjustment

Institute of Scientific and Technical Information of China (English)

唐金金; 周磊山; 冉锋; 陈来成

2012-01-01

The soft conflict occurring between running lines in the high-speed train diagram to make trains unable to run at the appropriate power was defined, which was found hard to solve the soft conflict problems with the existing methods of formulating the train diagram. The mechanism and influence of forming soft conflicts between high-speed train running lines were analyzed. It was demonstrated that the method of integrated simulation of traction power supply and train group operation could better solve the soft conflict problems?namely, traction power supply calculations were used to detect soft conflicts of the train diagram and on this basis train operation simulation adjustment was made to get rid of the soft conflicts . The proposed method proves effective in rejecting soft conflicts of the train diagram, provides the control strategy of the train operation process , and solves some difficult problems in simulation calculation of AC traction power supply. Finally a train diagram was formulated and based on adjustment of soft conflicts for a real high-speed railway line in China.%定义存在于高速铁路列车运行图运行线间的使列车无法在适当功率下运行的软冲突问题,该问题使用既有列车运行图规划方法难以有效解决.分析软冲突形成的机理及其影响,论证牵引供电与列车群一体化仿真计算方法能较好解决软冲突问题,即利用牵引供电计算实现列车运行图软冲突的检测,基于该检测结果进行列车仿真运行调整,从而实现对软冲突的剔除.一体化仿真方法不仅能实现高速列车运行图软冲突的疏解,同时也能得出列车运行过程的操纵策略,并解决了交流牵引供电仿真计算中的某些难点问题.选用我国某一高速铁路线路为例,验证基于牵引仿真的列车运行图软冲突疏解方法.

Evaluation of the Ride-Through Capability of an Active-Front-End Adjustable Speed Drive under Real Grid Conditions

DEFF Research Database (Denmark)

Liserre, Marco; Klumpner, Christian; Blaabjerg, Frede

2004-01-01

Better quality of the input currents, unity power factor and regenerative capability are not the only benefits of equipping an Adjustable Speed Drive (ASD) with an active front-end-stage. Controlling the power inflow may enable also the reduction of the dc-link energy storage, which will then lead...... to the replacement of the electrolytic capacitors with film capacitors, which have lower energy density meaning that the volume is similar, but will increase the ASD lifetime. In these circumstances, operation under unbalanced and distorted supply voltage as well as high dynamic operation of the ASD makes...... the control task more challenging. The aim of this paper is to investigate the ride-through capability of an ASD with active front-end under real grid conditions and in view of the minimum dc-link storage. Experiments validate the theoretical analysis....

Advanced AC permanent magnet axial flux disc motor for electric passenger vehicle

Science.gov (United States)

Kliman, G. B.

1982-01-01

An ac permanent magnet axial flux disc motor was developed to operate with a thyristor load commutated inverter as part of an electric vehicle drive system. The motor was required to deliver 29.8 kW (40 hp) peak and 10.4 kW (14 hp) average with a maximum speed of 11,000 rpm. It was also required to run at leading power factor to commutate the inverter. Three motors were built.

Progress on advanced dc and ac induction drives for electric vehicles

Science.gov (United States)

Schwartz, H. J.

1982-01-01

Progress is reported in the development of complete electric vehicle propulsion systems, and the results of tests on the Road Load Simulator of two such systems representative of advanced dc and ac drive technology are presented. One is the system used in the DOE's ETV-1 integrated test vehicle which consists of a shunt wound dc traction motor under microprocessor control using a transistorized controller. The motor drives the vehicle through a fixed ratio transmission. The second system uses an ac induction motor controlled by transistorized pulse width modulated inverter which drives through a two speed automatically shifted transmission. The inverter and transmission both operate under the control of a microprocessor. The characteristics of these systems are also compared with the propulsion system technology available in vehicles being manufactured at the inception of the DOE program and with an advanced, highly integrated propulsion system upon which technology development was recently initiated.

Sensorless AC electric motor control robust advanced design techniques and applications

CERN Document Server

Glumineau, Alain

2015-01-01

This monograph shows the reader how to avoid the burdens of sensor cost, reduced internal physical space, and system complexity in the control of AC motors. Many applications fields—electric vehicles, wind- and wave-energy converters and robotics, among them—will benefit. Sensorless AC Electric Motor Control describes the elimination of physical sensors and their replacement with observers, i.e., software sensors. Robustness is introduced to overcome problems associated with the unavoidable imperfection of knowledge of machine parameters—resistance, inertia, and so on—encountered in real systems. The details of a large number of speed- and/or position-sensorless ideas for different types of permanent-magnet synchronous motors and induction motors are presented along with several novel observer designs for electrical machines. Control strategies are developed using high-order, sliding-mode and quasi-continuous-sliding-mode techniques and two types of observer–controller schemes based on backstepping ...

Low Offset AC Correlator.

Science.gov (United States)

This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

Advanced reliability improvement of AC-modules (ARIA)

International Nuclear Information System (INIS)

Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

2001-09-01

The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

AC power supply systems

International Nuclear Information System (INIS)

Law, H.

1987-01-01

An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

An Analysis of Variable-Speed Wind Turbine Power-Control Methods with Fluctuating Wind Speed

Directory of Open Access Journals (Sweden)

Seung-Il Moon

2013-07-01

Full Text Available Variable-speed wind turbines (VSWTs typically use a maximum power-point tracking (MPPT method to optimize wind-energy acquisition. MPPT can be implemented by regulating the rotor speed or by adjusting the active power. The former, termed speed-control mode (SCM, employs a speed controller to regulate the rotor, while the latter, termed power-control mode (PCM, uses an active power controller to optimize the power. They are fundamentally equivalent; however, since they use a different controller at the outer control loop of the machine-side converter (MSC controller, the time dependence of the control system differs depending on whether SCM or PCM is used. We have compared and analyzed the power quality and the power coefficient when these two different control modes were used in fluctuating wind speeds through computer simulations. The contrast between the two methods was larger when the wind-speed fluctuations were greater. Furthermore, we found that SCM was preferable to PCM in terms of the power coefficient, but PCM was superior in terms of power quality and system stability.

Hardware detection and parameter tuning method for speed control system of PMSM

Science.gov (United States)

Song, Zhengqiang; Yang, Huiling

2018-03-01

In this paper, the development of permanent magnet synchronous motor AC speed control system is taken as an example, aiming to expound the principle and parameter setting method of the system hardware, and puts forward the method of using software or hardware to eliminate the problem.

ACS Photometric Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

Resonant frequency detection and adjustment method for a capacitive transducer with differential transformer bridge

Energy Technology Data Exchange (ETDEWEB)

Hu, M.; Bai, Y. Z., E-mail: abai@mail.hust.edu.cn; Zhou, Z. B., E-mail: zhouzb@mail.hust.edu.cn; Li, Z. X.; Luo, J. [MOE Key Laboratory of Fundamental Physical Quantities Measurement, School of Physics, Huazhong University of Science and Technology, Wuhan 430074 (China)

2014-05-15

The capacitive transducer with differential transformer bridge is widely used in ultra-sensitive space accelerometers due to their simple structure and high resolution. In this paper, the front-end electronics of an inductive-capacitive resonant bridge transducer is analyzed. The analysis result shows that the performance of this transducer depends upon the case that the AC pumping frequency operates at the resonance point of the inductive-capacitive bridge. The effect of possible mismatch between the AC pumping frequency and the actual resonant frequency is discussed, and the theoretical analysis indicates that the output voltage noise of the front-end electronics will deteriorate by a factor of about 3 due to either a 5% variation of the AC pumping frequency or a 10% variation of the tuning capacitance. A pre-scanning method to determine the actual resonant frequency is proposed followed by the adjustment of the operating frequency or the change of the tuning capacitance in order to maintain expected high resolution level. An experiment to verify the mismatching effect and the adjustment method is provided.

Resonant frequency detection and adjustment method for a capacitive transducer with differential transformer bridge

International Nuclear Information System (INIS)

Hu, M.; Bai, Y. Z.; Zhou, Z. B.; Li, Z. X.; Luo, J.

2014-01-01

The capacitive transducer with differential transformer bridge is widely used in ultra-sensitive space accelerometers due to their simple structure and high resolution. In this paper, the front-end electronics of an inductive-capacitive resonant bridge transducer is analyzed. The analysis result shows that the performance of this transducer depends upon the case that the AC pumping frequency operates at the resonance point of the inductive-capacitive bridge. The effect of possible mismatch between the AC pumping frequency and the actual resonant frequency is discussed, and the theoretical analysis indicates that the output voltage noise of the front-end electronics will deteriorate by a factor of about 3 due to either a 5% variation of the AC pumping frequency or a 10% variation of the tuning capacitance. A pre-scanning method to determine the actual resonant frequency is proposed followed by the adjustment of the operating frequency or the change of the tuning capacitance in order to maintain expected high resolution level. An experiment to verify the mismatching effect and the adjustment method is provided

Motion-induced eddy current thermography for high-speed inspection

Directory of Open Access Journals (Sweden)

Jianbo Wu

2017-08-01

Full Text Available This letter proposes a novel motion-induced eddy current based thermography (MIECT for high-speed inspection. In contrast to conventional eddy current thermography (ECT based on a time-varying magnetic field created by an AC coil, the motion-induced eddy current is induced by the relative motion between magnetic field and inspected objects. A rotating magnetic field created by three-phase windings is used to investigate the heating principle and feasibility of the proposed method. Firstly, based on Faraday’s law the distribution of MIEC is investigated, which is then validated by numerical simulation. Further, experimental studies are conducted to validate the proposed method by creating rotating magnetic fields at different speeds from 600 rpm to 6000 rpm, and it is verified that rotating speed will increase MIEC intensity and thereafter improve the heating efficiency. The conclusion can be preliminarily drawn that the proposed MIECT is a platform suitable for high-speed inspection.

Water striders adjust leg movement speed to optimize takeoff velocity for their morphology

Science.gov (United States)

Yang, Eunjin; Son, Jae Hak; Lee, Sang-Im; Jablonski, Piotr G.; Kim, Ho-Young

2016-12-01

Water striders are water-walking insects that can jump upwards from the water surface. Quick jumps allow striders to avoid sudden dangers such as predators' attacks, and therefore their jumping is expected to be shaped by natural selection for optimal performance. Related species with different morphological constraints could require different jumping mechanics to successfully avoid predation. Here we show that jumping striders tune their leg rotation speed to reach the maximum jumping speed that water surface allows. We find that the leg stroke speeds of water strider species with different leg morphologies correspond to mathematically calculated morphology-specific optima that maximize vertical takeoff velocity by fully exploiting the capillary force of water. These results improve the understanding of correlated evolution between morphology and leg movements in small jumping insects, and provide a theoretical basis to develop biomimetic technology in semi-aquatic environments.

FLUIDIC AC AMPLIFIERS.

Science.gov (United States)

Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

Science.gov (United States)

2013-08-13

...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

International Nuclear Information System (INIS)

Fang Minggang; Nie, Yingchao; Theilmann, David A.

2009-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

Homogenization of Tianjin monthly near-surface wind speed using RHtestsV4 for 1951-2014

Science.gov (United States)

Si, Peng; Luo, Chuanjun; Liang, Dongpo

2018-05-01

Historical Chinese surface meteorological records provided by the special fund for basic meteorological data from the National Meteorological Information Center (NMIC) were processed to produce accurate wind speed data. Monthly 2-min near-surface wind speeds from 13 observation stations in Tianjin covering 1951-2014 were homogenized using RHtestV4 combined with their metadata. Results indicate that 10 stations had significant breakpoints—77% of the Tianjin stations—suggesting that inhomogeneity was common in the Tianjin wind speed series. Instrument change accounted for most changes, based on the metadata, including changes in type and height, especially for the instrument type. Average positive quantile matching (QM) adjustments were more than negative adjustments at 10 stations; positive biases with a probability density of 0.2 or more were mainly concentrates in the range 0.2 m s-1 to 1.2 m s-1, while the corresponding negative biases were mainly in the range -0.1 to -1.2 m s-1. Here, changes in variances and trends in the monthly mean surface wind speed series at 10 stations before and after adjustment were compared. Climate characteristics of wind speed in Tianjin were more reasonably reflected by the adjusted data; inhomogeneity in wind speed series was largely corrected. Moreover, error analysis reveals that there was a high consistency between the two datasets here and that from the NMIC, with the latter as the reference. The adjusted monthly near-surface wind speed series shows a certain reliability for the period 1951-2014 in Tianjin.

AC losses in multilayer power transmission cables comprised of YBCO tapes

International Nuclear Information System (INIS)

Noji, H.

2011-01-01

I calculate AC properties in YBCO cable by an electric circuit model. The optimal helical pitches are determined by the calculation. The layer's current distribution is uniform on the optimal helical pitches. The calculation is useful as a first approximation of AC losses. AC losses in multilayer power transmission cables can be reduced by adjusting the helical winding pitch of each layer to make the layer's current distribution uniform. The optimum helical pitch can be estimated using an electric circuit (EC) model based on the expression that calculates the losses in the superconducting tapes composing the cable. It is known that the losses in a monolayer cable depend on the cable parameters (i.e., the gap between neighboring tapes, number of tapes N, diameter of the cable former and width of the tape). However, regarding Amemiya et al.'s measurement on the losses in monolayer cables, the numerical results of the losses calculated using the Norris formula for an isolated thin strip N times are close to the experimental results. Then, to determine the losses in a three-layer cable that Mukoyama et al. have reported, the losses are calculated by the EC model based on the Norris formula. The helical pitch of each layer is adjusted to make the layer's current distribution uniform in the cable reported by Mukoyama et al. The optimum helical pitches are calculated using the condition where the standard deviation of the layer currents is minimum, and the losses of the cable at the optimum helical pitches are calculated at 1 kA rms . By comparing the results of these calculations with the previously measured results, it was found that the mean error of the calculated values relative to the measured values is 23.7%, which indicates that the calculation using the EC model is useful as a first approximation.

Kinematic synthesis of adjustable robotic mechanisms

Science.gov (United States)

Chuenchom, Thatchai

1993-01-01

Conventional hard automation, such as a linkage-based or a cam-driven system, provides high speed capability and repeatability but not the flexibility required in many industrial applications. The conventional mechanisms, that are typically single-degree-of-freedom systems, are being increasingly replaced by multi-degree-of-freedom multi-actuators driven by logic controllers. Although this new trend in sophistication provides greatly enhanced flexibility, there are many instances where the flexibility needs are exaggerated and the associated complexity is unnecessary. Traditional mechanism-based hard automation, on the other hand, neither can fulfill multi-task requirements nor are cost-effective mainly due to lack of methods and tools to design-in flexibility. This dissertation attempts to bridge this technological gap by developing Adjustable Robotic Mechanisms (ARM's) or 'programmable mechanisms' as a middle ground between high speed hard automation and expensive serial jointed-arm robots. This research introduces the concept of adjustable robotic mechanisms towards cost-effective manufacturing automation. A generalized analytical synthesis technique has been developed to support the computational design of ARM's that lays the theoretical foundation for synthesis of adjustable mechanisms. The synthesis method developed in this dissertation, called generalized adjustable dyad and triad synthesis, advances the well-known Burmester theory in kinematics to a new level. While this method provides planar solutions, a novel patented scheme is utilized for converting prescribed three-dimensional motion specifications into sets of planar projections. This provides an analytical and a computational tool for designing adjustable mechanisms that satisfy multiple sets of three-dimensional motion specifications. Several design issues were addressed, including adjustable parameter identification, branching defect, and mechanical errors. An efficient mathematical scheme for

Research on fuzzy PID control to electronic speed regulator

Science.gov (United States)

Xu, Xiao-gang; Chen, Xue-hui; Zheng, Sheng-guo

2007-12-01

As an important part of diesel engine, the speed regulator plays an important role in stabilizing speed and improving engine's performance. Because there are so many model parameters of diesel-engine considered in traditional PID control and these parameters present non-linear characteristic.The method to adjust engine speed using traditional PID is not considered as a best way. Especially for the diesel-engine generator set. In this paper, the Fuzzy PID control strategy is proposed. Some problems about its utilization in electronic speed regulator are discussed. A mathematical model of electric control system for diesel-engine generator set is established and the way of the PID parameters in the model to affect the function of system is analyzed. And then it is proposed the differential coefficient must be applied in control design for reducing dynamic deviation of system and adjusting time. Based on the control theory, a study combined control with PID calculation together for turning fuzzy PID parameter is implemented. And also a simulation experiment about electronic speed regulator system was conducted using Matlab/Simulink and the Fuzzy-Toolbox. Compared with the traditional PID Algorithm, the simulated results presented obvious improvements in the instantaneous speed governing rate and steady state speed governing rate of diesel-engine generator set when the fuzzy logic control strategy used.

SPEED COMPLIANCE IN FREEWAY VARIABLE SPEED LIMIT SYSTEM – CASE STUDY OF THE PRAGUE CITY RING

Directory of Open Access Journals (Sweden)

Michał MATOWICKI

2016-03-01

Full Text Available Many previous studies have confirmed the strong relationship between speed compliance and the frequency and severity of traffic accidents. Variable speed limit (VSL system as a measure to improve traffic safety enables the freeway system to change its posted speed limit based on various traffic and environmental conditions. Such system helps drivers to recognize the upcoming events, to adjust their driving style and in such way to address speed variation of the traffic flow. This is called speed harmonization. Although many studies researching the effect of VSL system on the traffic stream can be found, there are only few addressing its influence on the drivers behavior, particularly focusing on their tolerance limit and compliance, which has crucial meaning for future design of controlling algorithms. This study was prepared to inspect this grey area by studying the data from the VSL system at Prague city ring, describing the influence of the highway management system and its influence on drivers.

Tickover speed controller for car engines

Energy Technology Data Exchange (ETDEWEB)

Hawk, R L

1980-05-22

In general, the tickover speed of a car engine is made sufficiently high, in order to permit an assumed maximum load to be taken from the engine at tickover. This setting of the tickover speed is usually done by stops in the fuel supply. Matching the actual load would lead to lower fuel consumption, without any danger of the engine stalling. The purpose of the invention is to provide a tickover speed controller, so that the tickover speed is adjusted by electronic control equipment, independently of the machine load. The fuel consumption on tickover is reduced and the emission of noxious substances is decreased. The electro-magnetic control of the throttle valve tickover setting is explained by extensive section drawings of the system. This process dispenses with the special tickover cams for a cold start.

Twenty years of high-speed lines in Spain; Zwanzig Jahre Hochgeschwindigkeitsstrecken in Spanien

Energy Technology Data Exchange (ETDEWEB)

Vega Vega, Tomas [ADIF, Madrid (Spain); Gil Ortiz, Jose Miguel [Balfour Beatty Rail Iberica, Alcobendas (Spain)

2012-07-15

In April 1992, i.e. 20 years ago, fast train services started in Spain when high-speed trains were put into operation on the almost 500 km long Madrid-Cordoba-Sevilla railway line. Both the 1,435 mm UIC standard gauge and the 1 AC 25 kV 50 Hz overhead line voltage level meant a big step in the development. Today the Spanish high-speed network covers some 2,200 km of railway line, and more lines are planned or already under construction. (orig.)

Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

Science.gov (United States)

Luczak, Susan E; Rosen, I Gary

2014-08-01

Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

Engine control system having speed-based timing

Science.gov (United States)

Willi, Martin L [Dunlap, IL; Fiveland, Scott B [Metamora, IL; Montgomery, David T [Edelstein, IL; Gong, Weidong [Dunlap, IL

2012-02-14

A control system for an engine having a cylinder is disclosed having an engine valve movable to regulate a fluid flow of the cylinder and an actuator associated with the engine valve. The control system also has a controller in communication with the actuator. The controller is configured to receive a signal indicative of engine speed and compare the engine speed signal with a desired engine speed. The controller is also configured to selectively regulate the actuator to adjust a timing of the engine valve to control an amount of air/fuel mixture delivered to the cylinder based on the comparison.

Associations among Obesity, Eating Speed, and Oral Health.

Science.gov (United States)

Sonoda, Chikanobu; Fukuda, Hideki; Kitamura, Masayasu; Hayashida, Hideaki; Kawashita, Yumiko; Furugen, Reiko; Koyama, Zenya; Saito, Toshiyuki

2018-04-18

This study was conducted to understand how eating speed and oral health condition are associated with obesity in Japanese working men. We studied a total of 863 men attending an annual medical checkup of the Japanese Maritime Self Defense Force in Sasebo City, Japan. Participants answered a questionnaire about their eating speed, and we examined their anthropometric status in terms of BMI, waist circumference, and oral health condition, especially periodontal disease and number of functional teeth. Multivariate logistic regression analyses adjusting for potential confounding variables were performed. The multivariate-adjusted odds ratio for waist circumference greater than 90 cm of the 'very fast' group compared to the 'slow, very slow' group was 5.22 (95% confidence interval 1.81-15.06) after adjusting for potential confounding factors. Individuals were more likely to have waist circumference greater than 90 cm if they had a larger 'number of missing functional teeth' (odds ratio 1.14; 95% confidence interval 1.01-1.28) and severe periodontal disease (odds ratio 2.74; 95% confidence interval, 1.46-5.13). Eating speed, the number of missing functional teeth, and severe periodontal disease are associated independently with larger waist circumference. © 2018 The Author(s) Published by S. Karger GmbH, Freiburg.

Investigation of Parametric Instability of the Planetary Gear under Speed Fluctuations

Directory of Open Access Journals (Sweden)

Xinghui Qiu

2017-01-01

Full Text Available Planetary gear is widely used in engineering and usually has symmetrical structure. As the number of teeth in contact changes during rotation, the time-varying mesh stiffness parametrically excites the planetary gear and may cause severe vibrations and instabilities. Taking speed fluctuations into account, the time-varying mesh stiffness is frequency modulated, and therefore sideband instabilities may arise and original instabilities are significantly affected. Considering two different speed fluctuations, original and sideband instabilities are numerically and analytically investigated. A rotational lumped-parameter model of the planetary gear is developed, in which the time-varying mesh stiffness, input speed fluctuations, and damping are considered. Closed-form approximations of instability boundaries for primary and combination instabilities are obtained by perturbation analysis and verified by numerical analysis. The effects of speed fluctuations and damping on parametric instability are systematically examined. Because of the frequency modulation, whether a parametric instability occurs cannot be simply predicted by the planet meshing phase which is applicable to constant speed. Besides adjusting the planet meshing phase, speed fluctuation supplies a new thought to minimize certain instability by adjusting the amplitude or frequency of the speed fluctuation. Both original and sideband instabilities are shrunken by damping, and speed fluctuation further shrinks the original instability.

Operation analysis of AC traction motors in terms of electromagnetic torque capability on sustainable railway vehicles

Directory of Open Access Journals (Sweden)

Bulucea Cornelia A.

2016-01-01

Full Text Available Sustainable operation of electric railway systems represents a significant purpose nowadays in the development of high power and high speed locomotives and trains. At present, high speed electric vehicles mostly work with three-phase induction motors or three-phase synchronous motors as traction motors. The two electric machine types have different efficiencies at different operation points, and experience differences with respect to safety, speed and power, energy use and exergy efficiency. An important issue that correlates these aspects is the electromagnetic torque developed by an electric traction motor. In order to provide an overview of the technical performance of the operation of sustainable railway systems, a detailed analysis is carried out of the electromagnetic torque capability of AC electric motors utilized as traction motors in modern locomotives of high power and/or high speed. The results of this work may help in enhancing the main criteria for optimising the safe and sustainable operation of electric railway traction systems.

Reduce consumption, improve production. Electronic adjustable speed drives and high performance motors; Consommez moins, produisez mieux. Variateurs electroniques de vitesse et moteurs performants

Energy Technology Data Exchange (ETDEWEB)

David, A.; Pratmarty, D.; Dessoude, M. [Electricite de France (EDF), 92 - Clamart (France). Direction des Etudes et Recherches

1995-10-01

The electric power consumption from electric motors accounts for up to two third of industry`s electric power consumption. When equipped with electronic adjustable speed drives (ASD), energy savings of 10 to 50 percent, with an estimated average of 25 percent, may be achieved for pumps, fans and compressors, which account for 63 percent of motor applications. The advantages of electronic ASD, the installation recommendations which should be applied, the sensibility of ASDs to power cuts and harmonics, the characteristics of high efficiency motors, the energy aspects of motors with or without electronic ASD, and the EDF-ADEME (French energy conservation agency) approach for electricity demand side management, are described

Imitative modeling automatic system Control of steam pressure in the main steam collector with the influence on the main Servomotor steam turbine

Science.gov (United States)

Andriushin, A. V.; Zverkov, V. P.; Kuzishchin, V. F.; Ryzhkov, O. S.; Sabanin, V. R.

2017-11-01

The research and setting results of steam pressure in the main steam collector “Do itself” automatic control system (ACS) with high-speed feedback on steam pressure in the turbine regulating stage are presented. The ACS setup is performed on the simulation model of the controlled object developed for this purpose with load-dependent static and dynamic characteristics and a non-linear control algorithm with pulse control of the turbine main servomotor. A method for tuning nonlinear ACS with a numerical algorithm for multiparametric optimization and a procedure for separate dynamic adjustment of control devices in a two-loop ACS are proposed and implemented. It is shown that the nonlinear ACS adjusted with the proposed method with the regulators constant parameters ensures reliable and high-quality operation without the occurrence of oscillations in the transient processes the operating range of the turbine loads.

Negative hydrogen ion beam extraction from an AC heated cathode driven Bernas-type ion source

Energy Technology Data Exchange (ETDEWEB)

Okano, Y.; Miyamoto, N.; Kasuya, T.; Wada, M.

2015-04-08

A plasma grid structure was installed to a Bernas-type ion source used for ion implantation equipment. A negative hydrogen (H{sup −}) ion beam was extracted by an AC driven ion source by adjusting the bias to the plasma grid. The extracted electron current was reduced by positively biasing the plasma grid, while an optimum plasma grid bias voltage for negative ion beam extraction was found to be positive 3 V with respect to the arc chamber. Source operations with AC cathode heating show extraction characteristics almost identical to that with DC cathode heating, except a minute increase in H{sup −} current at higher frequency of cathode heating current.

RHIC spin flipper AC dipole controller

Energy Technology Data Exchange (ETDEWEB)

Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

2011-03-28

The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

Occupational adjustment of immigrants in the Netherlands

NARCIS (Netherlands)

Zorlu, A.

2013-01-01

This article examines the speed of the occupational adjustment of immigrants using Labour Force Surveys 2004 and 2005 from Statistics Netherlands. The analysis provides new evidence that immigrants start with jobs at the lower levels of skill distribution. Their occupational achievement improves

Compounding Of Ac Compressor Using Waste Heat Recovery From Exhaust Gas

Directory of Open Access Journals (Sweden)

Bheshma Yogendra Kiran

2015-08-01

Full Text Available This project works on the theme of turbocharger in which a low pressure high speed turbine is placed in the exhaust gas manifold. The exhaust gas from the engine is made to rotate the turbine where the thermal power of exhaust gas is converted into rotary motion through turbine. This rotary motion from turbine is given to the turbocharger compressor which compresses the refrigerant vapor. So through this air conditioning effect is obtained without loss of any crankshaft. The kinetic energy extracted from the turbine is used to run the AC compressor by planetary gear train.

Honeybees' speed depends on dorsal as well as lateral, ventral and frontal optic flows.

Directory of Open Access Journals (Sweden)

Geoffrey Portelli

Full Text Available Flying insects use the optic flow to navigate safely in unfamiliar environments, especially by adjusting their speed and their clearance from surrounding objects. It has not yet been established, however, which specific parts of the optical flow field insects use to control their speed. With a view to answering this question, freely flying honeybees were trained to fly along a specially designed tunnel including two successive tapering parts: the first part was tapered in the vertical plane and the second one, in the horizontal plane. The honeybees were found to adjust their speed on the basis of the optic flow they perceived not only in the lateral and ventral parts of their visual field, but also in the dorsal part. More specifically, the honeybees' speed varied monotonically, depending on the minimum cross-section of the tunnel, regardless of whether the narrowing occurred in the horizontal or vertical plane. The honeybees' speed decreased or increased whenever the minimum cross-section decreased or increased. In other words, the larger sum of the two opposite optic flows in the horizontal and vertical planes was kept practically constant thanks to the speed control performed by the honeybees upon encountering a narrowing of the tunnel. The previously described ALIS ("AutopiLot using an Insect-based vision System" model nicely matches the present behavioral findings. The ALIS model is based on a feedback control scheme that explains how honeybees may keep their speed proportional to the minimum local cross-section of a tunnel, based solely on optic flow processing, without any need for speedometers or rangefinders. The present behavioral findings suggest how flying insects may succeed in adjusting their speed in their complex foraging environments, while at the same time adjusting their distance not only from lateral and ventral objects but also from those located in their dorsal visual field.

New, but slow – technical newness challenges late stage development speed

DEFF Research Database (Denmark)

Smed, Marie; Salomo, Søren; Getz, Kenneth A.

2014-01-01

The down-stream processes where new product prospects undergo pilot testing and adjustments before market launch can have significant impact on development speed. Previous literature has primarily pointed to firm traits as influential factors to speed. However, product specific measures such as t......The down-stream processes where new product prospects undergo pilot testing and adjustments before market launch can have significant impact on development speed. Previous literature has primarily pointed to firm traits as influential factors to speed. However, product specific measures...... such as technical innovativeness may be a critical factor when going through the crucial late stages of development. We have limited knowledge of the relation between product newness and the speed of NPD, and how this may be related to firm size and partnering strategies during development. Combining product traits...... with firm resources relevant to late stage development speed can enrich our understanding of time-tomarket in the aim of improving this crucial measure of NPD. The research model is tested on a dataset of all new drug developments approved for the US market 2000-2010. The results show that newness...

A modification design and adjusting test for instruments and control system of critical assembly

International Nuclear Information System (INIS)

Wu Manrong; Li Guangjian

1996-12-01

A more reliable and safe control system and it's instruments for HFETRCA (high flux engineering test reactor critical assembly) have been built. In the system high performance CMOS unit was used, which has high integration, strong anti-interference and high trigger threshold. In the design of control rod driving circuit, the speed negative feedback principle was applied that results in more stable rotating rate of motors of transmission mechanism and more flexibility of adjusting rod speed. In order to improve reactor safety in accident, additional control circuit is equipped, by which not only control rods with electromagnet will rapidly drop but also other control rods will insert at the speed of 2∼6 times faster than the normal inserting speed. The key technique in the adjustment and new method of anti-interference are also introduced. After more than 40 times physical experiments with (4 x 4 - 4) fuel element in HFETRC, it is proved that the design and adjustment of the system is successful and they can be used as a reference to others. (3 figs., 2 tabs.)

The AC photovoltaic module is here!

Science.gov (United States)

Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

1997-02-01

This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

New possibilities with new technology: the Adjustable Speed Hydro (ASH) generator

International Nuclear Information System (INIS)

Gjengedal, Terje; Gjerde, Jan Ove; Sporild, Roald; Gustafsson, Magnus

2001-01-01

Generators with variable rotational speed can be the solution for the Norwegian power system. The technology is available and is already used abroad. As with all projects, investing in ASH must be based on economic profitability, where all advantages and disadvantages are considered, and on thorough techno-economic analyses. The article describes the fundamental principles of the ASH, its advantages, and discusses its possible installation in already existing power stations

Relative association of processing speed, short-term memory and sustained attention with task on gait speed: a study of community-dwelling people 50 years and older.

Science.gov (United States)

Killane, Isabelle; Donoghue, Orna A; Savva, George M; Cronin, Hilary; Kenny, Rose Anne; Reilly, Richard B

2014-11-01

For single gait tasks, associations have been reported between gait speed and cognitive domains. However, few studies have evaluated if this association is altered in dual gait tasks given gait speed changes with complexity and nature of task. We evaluated relative contributions of specific elements of cognitive function (including sustained attention and processing speed) to dual task gait speed in a nationally representative population of community-dwelling adults over 50 years. Gait speed was obtained using the GaitRite walkway during three gait tasks: single, cognitive (alternate letters), and motor (carrying a filled glass). Linear regression models, adjusted for covariates, were constructed to predict the relative contributions of seven neuropsychological tests to gait speed differences and to investigate gait task effects. The mean age and gait speed of the population (n = 4,431, 55% women) was 62.4 years (SD = 8.2) and 135.85 cm/s (SD = 20.20, single task), respectively. Poorer processing speed, short-term memory, and sustained attention were major cognitive contributors to slower gait speed for all gait tasks. Both dual gait tasks were robust to covariate adjustment and had a significant additional executive function element not found for the single gait task. For community-dwelling older adults processing speed, short-term memory and sustained attention were independently associated with gait speed for all gait tasks. Dual gait tasks were found to highlight specific executive function elements. This result forms a baseline value for dual task gait speed. © The Author 2014. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Research on the Plasma Anemometer Based on AC Glow Discharge

Directory of Open Access Journals (Sweden)

Bing Yu

2017-01-01

Full Text Available A new plasma anemometer based on AC glow discharge is designed in this article. Firstly, theoretical analysis of plasma anemometer working principle is introduced to prove the feasibility of the experimental measurement method. Then the experiments are carried out to study the effects of different parameters on the static discharge characteristics of the plasma anemometer system, by which the system optimization methods are obtained. Finally, several groups of appropriate parameters are selected to build the plasma anemometer system based on resistance capacitance coupling negative feedback AC glow discharge, and different airflow speeds are applied to obtain the achievable velocity measurement range. The results show that there is a linear relationship between airflow velocity and discharge current in an allowable error range, which can be applied for airflow velocity measurement. Negative feedback coupling module, which is composed of the coupling resistance and the coupling capacitance, has good effects on improving the system stability. The measurement range of the airflow velocity is significantly increased when the electrode gap is 3 mm, coupling resistance is 470 Ω, and coupling capacitance is 220 pF.

Sliding Mode Control of a Variable- Speed Wind Energy Conversion System Using a Squirrel Cage Induction Generator

Directory of Open Access Journals (Sweden)

Mohamed Zribi

2017-05-01

Full Text Available This paper deals with the control of a variable-speed wind energy conversion (WEC system using a squirrel cage induction generator (SCIG connected to the grid through a back-to-back three phase (AC-DC-AC power converter. The sliding mode control technique is used to control the WEC system. The objective of the controllers is to force the states of the system to track their desired states. One controller is used to regulate the generator speed and the flux so that maximum power is extracted from the wind. Another controller is used to control the grid side converter, which controls the DC bus voltage and the active and reactive powers injected into the grid. The performance of the controlled wind energy conversion system is verified through MATLAB simulations, which show that the controlled system performs well.

Photonic Technologies for Ultra-High-Speed Information Highways

DEFF Research Database (Denmark)

Bouchoule, S; Lèfevre, R.; Legros, E.

1999-01-01

The ACTS project HIGHWAY (AC067) addresses promising ultra-high speed optoelectronic components and system technologies for 40 Gbit/s time-division-multiplexed (TDM) transport systems. Advanced 40 Gbit/s TDM system lab demonstrators are to be realized and tested over installed field fiber testbeds....... This paper reviews the current status of 40 Gbit/s TDM components and subsystem technologies achieved in HIGHWAY. The results of HIGHWAY 40 Gbit/s TDM systems and field tests will be reported in a subsequent paper. (C) 1999 Academic Press....

The likely market potential for electricity saving ASD devices

International Nuclear Information System (INIS)

Sparow, F.T.; McKenzie, L.

1993-01-01

Many utility demand-side management (DSM) programs encourage the adoption of adjustable speed drives (ASD) in the industrial and commercial sectors, since such devices save KW and KWh. The term open-quotes adjustable speed drives close-quote is used to refer to any device which allows the speed of the motor to be adjusted to better match process requirements. Thus, motor input control devices, such as electronic adjustable speed drives for AC motors (i.e., adjustable frequency drives (AFD)), voltage controlled DC motors, and the use of floating pressure setpoint controls, or other devices which better control on/off compressor operation, would be considered ASD devices. Also included would be motor technologies, such as multi-speed windings, etc., which allow the synchronous speed of the motor to be altered. Not included in this definition would be mechanical systems such as gear boxes, friction disks, etc., which maintain motor speed, but alter the drive r.p.m. to the equipment. The importance of the distinction is that ASDs, as defined above, have the potential to substantially reduce KW and KWh consumption if the equipment duty cycle is varying, while mechanical drive r.p.m. varying devices don't

An evaluation of the Panasonic model UD513AC-1 Thermoluminescence Dosimetry system

International Nuclear Information System (INIS)

Durrer, R.E. Jr.

1991-12-01

An evaluation of the Panasonic UD513AC-1 Thermoluminescence Dosimetry system was performed to determine the system's capabilities as a general purpose thermoluminescence dosimeter measuring device. The tests that were performed included a critique of the user's manual, delimitation of the operating parameters, the quality of construction, and an evaluation of the features that were unique to this system. The UD513AC-1 was found to be an adequate measuring device for most dosimetric applications. It was not well suited for experimental work with thermoluminescence materials due to a low sensitivity displayed by the photomultiplier tube to commonly used materials. The system was well constructed and did not suffer hardware failure during this research. Major attributes of the UD513AC-1 were automatic data storage, highly reproducible heating ramps, an excellent infrared light filter and a unique feature to a single phosphor unit, a dose determination function. Negative aspects of the system included a limited data manipulation capability within the controlling program, a poorly written user's manual, inadequate sensitivity on the part of the photomultiplier tube, and insufficient capability to adjust the hot N 2 gas flow to desired levels

Levitação acústica

OpenAIRE

Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

2015-01-01

A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

Enhancing stability of industrial turbines using adjustable partial arc bearings

Science.gov (United States)

Chasalevris, Athanasios; Dohnal, Fadi

2016-09-01

The paper presents the principal of operation, the simulation and the characteristics of two partial-arc journal bearings of variable geometry and adjustable/controllable stiffness and damping properties. The proposed journals are supposed to consist of a scheme that enables the periodical variation of bearing properties. Recent achievements of suppressing rotor vibrations using plain circular journal bearings of variable geometry motivate the further extension of the principle to bearings of applicable geometry for industrial turbines. The paper describes the application of a partial-arc journal bearing to enhance stability of high speed industrial turbines. The proposed partial-arc bearings with adjustable/controllable properties enhance stability and they introduce stable margins in speeds much higher than the 1st critical.

Simulation comparison of proportional integral derivative and fuzzy logic in controlling AC-DC buck boost converter

Science.gov (United States)

Faisal, A.; Hasan, S.; Suherman

2018-03-01

AC-DC converter is widely used in the commercial industry even for daily purposes. The AC-DC converter is used to convert AC voltage into DC. In order to obtain the desired output voltage, the converter usually has a controllable regulator. This paper discusses buck boost regulator with a power MOSFET as switching component which is adjusted based on the duty cycle of pulse width modulation (PWM). The main problems of the buck boost converter at start up are the high overshoot, the long peak time and rise time. This paper compares the effectiveness of two control techniques: proportional integral derivative (PID) and fuzzy logic control in controlling the buck boost converter through simulations. The results show that the PID is more sensitive to voltage change than fuzzy logic. However, PID generates higher overshoot, long peak time and rise time. On the other hand, fuzzy logic generates no overshoot and shorter rise time.

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

DEFF Research Database (Denmark)

Ljusev, Petar; Andersen, Michael Andreas E.

2004-01-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

A new on-chip all-digital three-phase full-bridge dc/ac power inverter with feedforward and frequency control techniques.

Science.gov (United States)

Chen, Jiann-Jong; Kung, Che-Min

2010-09-01

The communication speed between components is far from satisfactory. To achieve high speed, simple control system configuration, and low cost, a new on-chip all-digital three-phase dc/ac power inverter using feedforward and frequency control techniques is proposed. The controller of the proposed power inverter, called the shift register, consists of six-stage D-latch flip-flops with a goal of achieving low-power consumption and area efficiency. Variable frequency is achieved by controlling the clocks of the shift register. One advantage regarding the data signal (D) and the common clock (CK) is that, regardless of the phase difference between the two, all of the D-latch flip-flops are capable of delaying data by one CK period. To ensure stability, the frequency of CK must be six times higher than that of D. The operation frequency of the proposed power inverter ranges from 10 Hz to 2 MHz, and the maximum output loading current is 0.8 A. The prototype of the proposed circuit has been fabricated with TSMC 0.35 μm 2P4M CMOS processes. The total chip area is 2.333 x 1.698 mm2. The three-phase dc/ac power inverter is applicable in uninterrupted power supplies, cold cathode fluorescent lamps, and motors, because of its ability to convert the dc supply voltage into the three-phase ac power sources.

Introduction to AC machine design

CERN Document Server

Lipo, Thomas A

2018-01-01

AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

Electromagnetic phenomena analysis in brushless DC motor with speed control using PWM method

Science.gov (United States)

Ciurys, Marek Pawel

2017-12-01

Field-circuit model of a brushless DC motor with speed control using PWM method was developed. Waveforms of electrical and mechanical quantities of the designed motor with a high pressure vane pump built in a rotor of the motor were computed. Analysis of electromagnetic phenomena in the system: single phase AC network - converter - BLDC motor was carried out.

Using PBL to Improve Educational Outcomes and Student Satisfaction in the Teaching of DC/DC and DC/AC Converters

Science.gov (United States)

Martinez-Rodrigo, Fernando; Herrero-De Lucas, Luis Carlos; de Pablo, Santiago; Rey-Boue, Alexis B.

2017-01-01

This paper examines the question of how to use project-based learning to increase student performance and satisfaction in a power electronics course addressing the topics of dc/dc and dc/ac converters, the assembly of a dc/dc converter, and the use of a commercial speed drive. A detailed presentation of the methodology is shown, and the results…

The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

International Nuclear Information System (INIS)

Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

2001-11-01

Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

International Nuclear Information System (INIS)

McCarthy, Christina B.; Theilmann, David A.

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

Load Flow Analysis of Hybrid AC-DC Power System with Offshore Wind Power

DEFF Research Database (Denmark)

Dhua, Debasish; Huang, Shaojun; Wu, Qiuwei

2017-01-01

The offshore wind power has received immense attention because of higher wind speed and lower opposition for construction. A wide range of combinations of high-voltage ACDC transmission have been proposed for integrating offshore wind farms and long-distance power transmission. This paper...... is to model such hybrid AC-DC systems including the interfacing converters, which have several control parameters that can change the load flow of the hybrid systems. Then, the paper proposes a Load Flow algorithm based on the Newton-Raphson method, which covers three different section types...

Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

Energy Technology Data Exchange (ETDEWEB)

Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

2008-07-01

Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

Science.gov (United States)

Abbas, Qamar; Béguin, François

2016-06-01

We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

Speed of sound in biodiesel produced by low power ultrasound

Science.gov (United States)

Oliveira, P. A.; Silva, R. M. B.; Morais, G. C.; Alvarenga, A. V.; Costa-Felix, R. P. B.

2018-03-01

The quality control of the biodiesel produced is an important issue to be addressed for every manufacturer or retailer. The speed of sound is a property that has an influence on the quality of the produced fuel. This work presents the evaluation about the speed of sound in biodiesel produced with the aid of low power ultrasound in the frequencies of 1 MHz and 3 MHz. The speed of sound was measured by pulse-echo technique. The ultrasonic frequency used during reaction affects the speed of sound in biodiesel. The larger expanded uncertainty for adjusted curve was 4.9 m.s-1.

Demagnetization diagnosis in permanent magnet synchronous motors under non-stationary speed conditions

Energy Technology Data Exchange (ETDEWEB)

Ruiz, Jordi-Roger Riba [EUETII, Dept. d' Enginyeria Electrica, Universitat Politecnica de Catalunya, Placa del Rei 15, 08700 Igualada, Barcelona (Spain); Garcia Espinosa, Antonio [Dept. d' Enginyeria Electrica, Universitat Politecnica de Catalunya C/Colom 1, 08222 Terrassa (Spain); Romeral, Luis; Cusido, Jordi [Dept. d' Enginyeria Electronica, Universitat Politecnica de Catalunya C/Colom 1, 08222 Terrassa (Spain)

2010-10-15

Permanent magnet synchronous motors (PMSMs) are applied in high performance positioning and variable speed applications because of their enhanced features with respect to other AC motor types. Fault detection and diagnosis of electrical motors for critical applications is an active field of research. However, much research remains to be done in the field of PMSM demagnetization faults, especially when running under non-stationary conditions. This paper presents a time-frequency method specifically focused to detect and diagnose demagnetization faults in PMSMs running under non-stationary speed conditions, based on the Hilbert Huang transform. The effectiveness of the proposed method is proven by means of experimental results. (author)

AcEST: DK954361 [AcEST

Lifescience Database Archive (English)

Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

21 CFR 886.4440 - AC-powered magnet.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

Speed Biases With Real-Life Video Clips

Directory of Open Access Journals (Sweden)

Federica Rossi

2018-03-01

Full Text Available We live almost literally immersed in an artificial visual world, especially motion pictures. In this exploratory study, we asked whether the best speed for reproducing a video is its original, shooting speed. By using adjustment and double staircase methods, we examined speed biases in viewing real-life video clips in three experiments, and assessed their robustness by manipulating visual and auditory factors. With the tested stimuli (short clips of human motion, mixed human-physical motion, physical motion and ego-motion, speed underestimation was the rule rather than the exception, although it depended largely on clip content, ranging on average from 2% (ego-motion to 32% (physical motion. Manipulating display size or adding arbitrary soundtracks did not modify these speed biases. Estimated speed was not correlated with estimated duration of these same video clips. These results indicate that the sense of speed for real-life video clips can be systematically biased, independently of the impression of elapsed time. Measuring subjective visual tempo may integrate traditional methods that assess time perception: speed biases may be exploited to develop a simple, objective test of reality flow, to be used for example in clinical and developmental contexts. From the perspective of video media, measuring speed biases may help to optimize video reproduction speed and validate “natural” video compression techniques based on sub-threshold temporal squeezing.

Dc to ac field conversion due to leaky-wave excitation in a plasma slab behind an ionization front

International Nuclear Information System (INIS)

Kostin, V A; Vvedenskii, N V

2015-01-01

We present a way for generating coherent tunable electromagnetic radiation through dc to ac field conversion by an ionization front. The conversion is caused by the excitation of leaky waves behind the transversely limited ionization front propagating in a uniform electrostatic field. This differs significantly from the well-known dc-to-ac-radiation-converter models which consider Doppler-like frequency conversion by a transversely unlimited ionization front propagating in a spatially periodic electric field. We explore the dispersion properties and excitation of these leaky waves radiated through the transverse plasma boundary at the Cherenkov angle to the direction of propagation of a superluminal ionization front as dependent on the parameters of the plasma produced and on the speed of the ionization front. It is shown that not only the center frequency but also the duration and waveform of the generated pulse may significantly depend on the speed of the ionization front. The results indicate the possibility of using such converters based on planar photoconductive antennas to create sources of microwave and terahertz radiation with controllable waveforms that are transformed from video to radio pulse when the angle of incident ionizing radiation is tuned. (paper)

Adjustment of automatic control systems of production facilities at coal processing plants using multivariant physico- mathematical models

Science.gov (United States)

Evtushenko, V. F.; Myshlyaev, L. P.; Makarov, G. V.; Ivushkin, K. A.; Burkova, E. V.

2016-10-01

The structure of multi-variant physical and mathematical models of control system is offered as well as its application for adjustment of automatic control system (ACS) of production facilities on the example of coal processing plant.

Pitch Angle Control for Variable Speed Wind Turbines

DEFF Research Database (Denmark)

Chen, Zhe; Zhang, Jianzhong; Cheng, M

2008-01-01

Pitch angle control is the most common means for adjusting the aerodynamic torque of the wind turbine when wind speed is above rated speed and various controlling variables may be chosen, such as wind speed, generator speed and generator power. As conventional pitch control usually use PI...... controller, the mathematical model of the system should be known well. A fuzzy logic pitch angle controller is developed in this paper, in which it does not need well known about the system and the mean wind speed is used to compensate the non-linear sensitivity. The fuzzy logic control strategy may have...... the potential when the system contains strong non-linearity, such as wind turbulence is strong, or the control objectives include fatigue loads. The design of the fuzzy logic controller and the comparisons with conversional pitch angle control strategies with various controlling variables are carried out...

SOLAR TO AC POWER SOURCE FOR REMOTE AREAS USING SEIG

Directory of Open Access Journals (Sweden)

MEHMET AKBABA

2012-02-01

Full Text Available Photovoltaic generators (PVG are increasingly used to provide electricity in remote areas. However, in many applications the DC generated electricity by a PVG need to be converted to AC. Traditionally DC to AC inverters have been widely used for this purpose. In this paper, a different system is proposed in which a self excited induction generator (SEIG driven by a permanent magnet DC motor (DCM and powered from a PVG through a maximum power point tracker (MPPT are used. A step-up chopper is utilized as an MPPT unit. The proposed system is modelled in time domain, and a detailed transient and steady-state analysis are presented. The main reason behind analyzing the system in the time domain is because of the fact that for unknown speeds, the methods developed for steady-state analysis of SEIGs can not be applied. The presented work shows that the full available power of the PVG can be harnessed by selecting suitable values for the duty cycle and the frequency of the step up chopper and the excitation capacitor of the SEIG. It is also shown that with such a combination power utilization efficiency of more than 83% can be achieved.

Simultaneous distribution of AC and DC power

Science.gov (United States)

Polese, Luigi Gentile

2015-09-15

A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

Directory of Open Access Journals (Sweden)

LISTYA UTAMI KARMAWAN

2009-03-01

Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

Universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2000-01-01

The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

Very-low speed control of PMSM based on EKF estimation with closed loop optimized parameters.

Science.gov (United States)

Xu, Dong; Zhang, Shaoguang; Liu, Jingmeng

2013-11-01

When calculating the speed from the position of permanent magnet synchronous motor (PMSM), the accuracy and real-time are limited by the precision of the sensor. This problem causes crawling and jitter at very-low speed. Using the angle from the position sensor, an extended Kalman filter (EKF) designed in dq-coordinate is presented to solve this problem. The usage of position sensor simplifies the model and improves the accuracy of speed estimation. Specially, a closed loop optimal (CLO) method is devised to overcome the difficulty to adjust the parameters of the EKF. The EKF is the feedback link of speed control, CLO method is derived from the perspective of the speed step response to optimize the measurement covariance matrix and the system covariance matrix of EKF. Simulation and experimental results, comparing the low-speed performance of the EKF and sensor feedback methods, prove the effectiveness of the method to adjust the parameters of EKF and the advantages in eliminating the low speed jitter. © 2013 ISA. Published by ISA. All rights reserved.

Load flow analysis for variable speed offshore wind farms

DEFF Research Database (Denmark)

Chen, Zhe; Zhao, Menghua; Blaabjerg, Frede

2009-01-01

factors such as the different wind farm configurations, the control of wind turbines and the power losses of pulse width modulation converters are considered. The DC/DC converter model is proposed and integrated into load flow algorithm by modifying the Jacobian matrix. Two iterative methods are proposed...... and integrated into the load flow algorithm: one takes into account the control strategy of converters and the other considers the power losses of converters. In addition, different types of variable speed wind turbine systems with different control methods are investigated. Finally, the method is demonstrated......A serial AC-DC integrated load flow algorithm for variable speed offshore wind farms is proposed. It divides the electrical system of a wind farm into several local networks, and different load flow methods are used for these local networks sequentially. This method is fast, more accurate, and many...

Energetic consequences of human sociality: walking speed choices among friendly dyads.

Directory of Open Access Journals (Sweden)

Janelle Wagnild

Full Text Available Research has shown that individuals have an optimal walking speed-a speed which minimizes energy expenditure for a given distance. Because the optimal walking speed varies with mass and lower limb length, it also varies with sex, with males in any given population tending to have faster optimal walking speeds. This potentially creates an energetic dilemma for mixed-sex walking groups. Here we examine speed choices made by individuals of varying stature, mass, and sex walking together. Individuals (N = 22 walked around a track alone, with a significant other (with and without holding hands, and with friends of the same and opposite sex while their speeds were recorded every 100 m. Our findings show that males walk at a significantly slower pace to match the females' paces (p = 0.009, when the female is their romantic partner. The paces of friends of either same or mixed sex walking together did not significantly change (p>0.05. Thus significant pace adjustment appears to be limited to romantic partners. These findings have implications for both mobility and reproductive strategies of groups. Because the male carries the energetic burden by adjusting his pace (slowing down 7%, the female is spared the potentially increased caloric cost required to walk together. In energetically demanding environments, we will expect to find gender segregation in group composition, particularly when travelling longer distances.

Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

Science.gov (United States)

Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

2012-01-01

The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

Association between gender, process of care measures, and outcomes in ACS in India: results from the detection and management of coronary heart disease (DEMAT registry.

Directory of Open Access Journals (Sweden)

Neha J Pagidipati

Full Text Available Studies from high-income countries have shown that women receive less aggressive diagnostics and treatment than men in acute coronary syndromes (ACS, though their short-term mortality does not appear to differ from men. Data on gender differences in ACS presentation, management, and outcomes are sparse in India.The Detection and Management of Coronary Heart Disease (DEMAT Registry collected data from 1,565 suspected ACS patients (334 women; 1,231 men from ten tertiary care centers throughout India between 2007-2008. We evaluated gender differences in presentation, in-hospital and discharge management, and 30-day death and major adverse cardiovascular event (MACE; death, re-hospitalization, and cardiac arrest rates. Women were less likely to present with STEMI than men (38% vs. 55%, p<0.001. Overall inpatient diagnostics and treatment patterns were similar between men and women after adjustment for potential confounders. Optimal discharge management with aspirin, clopidogrel, beta-blockers, and statin therapy was lower for women than men, (58% vs. 65%, p = 0.03, but these differences were attenuated after adjustment (OR = 0.86 (0.62, 1.19. Neither the outcome of 30-day mortality (OR = 1.40 (0.62, 3.16 nor MACE (OR = 1.00 (0.67, 1.48 differed significantly between men and women after adjustment.ACS in-hospital management, discharge management, and 30-day outcomes did not significantly differ between genders in the DEMAT registry, though consistently higher treatment rates and lower event rates in men compared to women were seen. These findings underscore the importance of further investigation of gender differences in cardiovascular care in India.

Example for electrical energy savings with the pump adjustable electric drive

International Nuclear Information System (INIS)

Mirchevski, Slobodan; Andonov, Zdravko; Saracevic, Fahrudin; Micevski, Darko; Buchkoski, Aleksandar

2004-01-01

Most used method of flow regulation is by throttling the pipeline. Development of power electronic gives opportunity for induction motor pump drives speed control. The common ways of pump flow control are throttling, reducing the working circle, usage of fore circle shovels rotating, by pass and pump speed control Only pump speed control is the most suitable for the energy possibilities. Intensive development of power electronic gives. opportunity to create devices - power converters, which can change the speed of induction motor. For that improvement the energy savings the measurements of power consumption with throttling and speed control have been made. Also, the MATLAB-SIMULINK model of the measured system has been made. The economic effects of saving energy using adjustable speed drives are analyzed for the measured values. The analysis shows that the money payback period of speed controller investment is short compared with the drive lifetime (20 years). (Author)

Automatic efficiency optimization of an axial compressor with adjustable inlet guide vanes

Science.gov (United States)

Li, Jichao; Lin, Feng; Nie, Chaoqun; Chen, Jingyi

2012-04-01

The inlet attack angle of rotor blade reasonably can be adjusted with the change of the stagger angle of inlet guide vane (IGV); so the efficiency of each condition will be affected. For the purpose to improve the efficiency, the DSP (Digital Signal Processor) controller is designed to adjust the stagger angle of IGV automatically in order to optimize the efficiency at any operating condition. The A/D signal collection includes inlet static pressure, outlet static pressure, outlet total pressure, rotor speed and torque signal, the efficiency can be calculated in the DSP, and the angle signal for the stepping motor which control the IGV will be sent out from the D/A. Experimental investigations are performed in a three-stage, low-speed axial compressor with variable inlet guide vanes. It is demonstrated that the DSP designed can well adjust the stagger angle of IGV online, the efficiency under different conditions can be optimized. This establishment of DSP online adjustment scheme may provide a practical solution for improving performance of multi-stage axial flow compressor when its operating condition is varied.

AcMNPV

African Journals Online (AJOL)

USER

2010-08-16

Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

Digital Speed Cascade Control, using Scilab / Xcos Environment

Directory of Open Access Journals (Sweden)

Petru Chioncel

2016-10-01

Full Text Available This paper presents an application of digital cascade control implemented in Scilab / Xcos environment, using a P type regulator for the position adjustment circuit, a PI controller for the speed circuit adjustment; the current respectively moments control circuits are rendered by elements of PT1 type. On this basis the program is done in Scilab and the related signal block diagram implemented in Xcos; through simulation, the step response of the system is analyzed for different sampling times.

Preparation of a New Adsorbent from Activated Carbon and Carbon Nanofiber (AC/CNF for Manufacturing Organic-Vacbpour Respirator Cartridge

Directory of Open Access Journals (Sweden)

Mehdi Jahangiri

2013-01-01

Full Text Available In this study a composite of activated carbon and carbon nanofiber (AC/CNF was prepared to improve the performance of activated carbon (AC for adsorption of volatile organic compounds (VOCs and its utilization for respirator cartridges. Activated carbon was impregnated with a nickel nitrate catalyst precursor and carbonnanofibers (CNF were deposited directly on the AC surface using catalytic chemical vapor deposition. Deposited CNFs on catalyst particles in AC micropores, were activated by CO2 to recover the surface area and micropores.Surface and textural characterizations of the prepared composites were investigated using Brunauer, Emmett andTeller’s (BET technique and electron microscopy respectively. Prepared composite adsorbent was tested forbenzene, toluene and xylene (BTX adsorption and then employed in an organic respirator cartridge in granularform. Adsorption studies were conducted by passing air samples through the adsorbents in a glass column at an adjustable flow rate. Finally, any adsorbed species not retained by the adsorbents in the column were trapped in a charcoal sorbent tube and analyzed by gas chromatography. CNFs with a very thin diameter of about 10-20 nmwere formed uniformly on the AC/CNF. The breakthrough time for cartridges prepared with CO2 activated AC/CNF was 117 minutes which are significantly longer than for those cartridges prepared with walnut shell- based activated carbon with the same weight of adsorbents. This study showed that a granular form CO2 activated AC/CNF composite could be a very effective alternate adsorbent for respirator cartridges due to its larger adsorption capacities and lower weight.

Effects of walking speed on the step-by-step control of step width.

Science.gov (United States)

Stimpson, Katy H; Heitkamp, Lauren N; Horne, Joscelyn S; Dean, Jesse C

2018-02-08

Young, healthy adults walking at typical preferred speeds use step-by-step adjustments of step width to appropriately redirect their center of mass motion and ensure mediolateral stability. However, it is presently unclear whether this control strategy is retained when walking at the slower speeds preferred by many clinical populations. We investigated whether the typical stabilization strategy is influenced by walking speed. Twelve young, neurologically intact participants walked on a treadmill at a range of prescribed speeds (0.2-1.2 m/s). The mediolateral stabilization strategy was quantified as the proportion of step width variance predicted by the mechanical state of the pelvis throughout a step (calculated as R 2 magnitude from a multiple linear regression). Our ability to accurately predict the upcoming step width increased over the course of a step. The strength of the relationship between step width and pelvis mechanics at the start of a step was reduced at slower speeds. However, these speed-dependent differences largely disappeared by the end of a step, other than at the slowest walking speed (0.2 m/s). These results suggest that mechanics-dependent adjustments in step width are a consistent component of healthy gait across speeds and contexts. However, slower walking speeds may ease this control by allowing mediolateral repositioning of the swing leg to occur later in a step, thus encouraging slower walking among clinical populations with limited sensorimotor control. Published by Elsevier Ltd.

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

Proportional-Integral-Resonant AC Current Controller

Directory of Open Access Journals (Sweden)

STOJIC, D.

2017-02-01

Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

On-Chip Enucleation of Bovine Oocytes using Microrobot-Assisted Flow-Speed Control

Directory of Open Access Journals (Sweden)

Akihiko Ichikawa

2013-06-01

Full Text Available In this study, we developed a microfluidic chip with a magnetically driven microrobot for oocyte enucleation. A microfluidic system was specially designed for enucleation, and the microrobot actively controls the local flow-speed distribution in the microfluidic chip. The microrobot can adjust fluid resistances in a channel and can open or close the channel to control the flow distribution. Analytical modeling was conducted to control the fluid speed distribution using the microrobot, and the model was experimentally validated. The novelties of the developed microfluidic system are as follows: (1 the cutting speed improved significantly owing to the local fluid flow control; (2 the cutting volume of the oocyte can be adjusted so that the oocyte undergoes less damage; and (3 the nucleus can be removed properly using the combination of a microrobot and hydrodynamic forces. Using this device, we achieved a minimally invasive enucleation process. The average enucleation time was 2.5 s and the average removal volume ratio was 20%. The proposed new system has the advantages of better operation speed, greater cutting precision, and potential for repeatable enucleation.

Low ac loss geometries in YBCO coated conductors

International Nuclear Information System (INIS)

Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

Low ac loss geometries in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

2007-10-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

Influences of Cutting Speed and Material Mechanical Properties on Chip Deformation and Fracture during High-Speed Cutting of Inconel 718

Directory of Open Access Journals (Sweden)

Bing Wang

2018-03-01

Full Text Available The paper aims to investigate the influences of material constitutive and fracture parameters in addition to cutting speed on chip formation during high-speed cutting of Inconel 718. Finite element analyses for chip formation are conducted with Johnson–Cook constitutive and fracture models. Meanwhile, experiments of high-speed orthogonal cutting are performed to verify the simulation results with cutting speeds ranging from 50 m/min to 7000 m/min. The research indicates that the chip morphology transforms from serrated to fragmented at the cutting speed of 7000 m/min due to embrittlement of the workpiece material under ultra-high cutting speeds. The parameter of shear localization sensitivity is put forward to describe the influences of material mechanical properties on serrated chip formation. The results demonstrate that the effects of initial yield stress and thermal softening coefficient on chip shear localization are much more remarkable than the other constitutive parameters. For the material fracture parameters, the effects of initial fracture strain and exponential factor of stress state on chip shear localization are more much prominent. This paper provides guidance for controlling chip formation through the adjustment of material mechanical properties and the selection of appropriate cutting parameters.

Influences of Cutting Speed and Material Mechanical Properties on Chip Deformation and Fracture during High-Speed Cutting of Inconel 718.

Science.gov (United States)

Wang, Bing; Liu, Zhanqiang; Hou, Xin; Zhao, Jinfu

2018-03-21

The paper aims to investigate the influences of material constitutive and fracture parameters in addition to cutting speed on chip formation during high-speed cutting of Inconel 718. Finite element analyses for chip formation are conducted with Johnson-Cook constitutive and fracture models. Meanwhile, experiments of high-speed orthogonal cutting are performed to verify the simulation results with cutting speeds ranging from 50 m/min to 7000 m/min. The research indicates that the chip morphology transforms from serrated to fragmented at the cutting speed of 7000 m/min due to embrittlement of the workpiece material under ultra-high cutting speeds. The parameter of shear localization sensitivity is put forward to describe the influences of material mechanical properties on serrated chip formation. The results demonstrate that the effects of initial yield stress and thermal softening coefficient on chip shear localization are much more remarkable than the other constitutive parameters. For the material fracture parameters, the effects of initial fracture strain and exponential factor of stress state on chip shear localization are more much prominent. This paper provides guidance for controlling chip formation through the adjustment of material mechanical properties and the selection of appropriate cutting parameters.

75 FR 8353 - Price Index Adjustments for Expenditure Limitations and Lobbyist Bundling Disclosure Threshold

Science.gov (United States)

2010-02-24

... FEDERAL ELECTION COMMISSION [Notice 2010-02] Price Index Adjustments for Expenditure Limitations... price index. See 2 U.S.C. 434(i)(3) and 441a(c)(1), and 11 CFR 109.32 and 110.17(a), (f). The Commission... is increased by 4.35110, which reflects the difference between the price index, as certified to the...

Sensorless interior permanent magnet synchronous motor control with rotational inertia adjustment

Directory of Open Access Journals (Sweden)

Yongle Mao

2016-12-01

Full Text Available Mechanical model is generally required in high dynamic sensorless motor control schemes for zero phase lag estimation of rotor position and speed. However, the rotational inertia uncertainty will cause dynamic estimation errors, eventually resulting in performance deterioration of the sensorless control system. Therefore, this article proposes a high dynamic performance sensorless control strategy with online adjustment of the rotational inertia. Based on a synthetic back electromotive force model, the voltage equation of interior permanent magnet synchronous motor is transformed to that of an equivalent non-salient permanent magnet synchronous motor. Then, an extended nonlinear observer is designed for interior permanent magnet synchronous motor in the stator-fixed coordinate frame, with rotor position, speed and load torque simultaneously estimated. The effect of inaccurate rotational inertia on the estimation of rotor position and speed is investigated, and a novel rotational inertia adjustment approach that employs the gradient descent algorithm is proposed to suppress the dynamic estimation errors. The effectiveness of the proposed control strategy is demonstrated by experimental tests.

AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.

2012-06-01

AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

Research on a novel DDC-based capacity controller for the direct-expansion variable-air-volume A/C system

Energy Technology Data Exchange (ETDEWEB)

Chen Wu, E-mail: chenwu73@263.ne [School of Marine Engineering, Jimei University, Xiamen, Fujian Province 361021 (China); Deng Shiming [Department of Building Services Engineering, The Hong Kong Polytechnic University, Kowloon (Hong Kong)

2010-01-15

A direct-expansion (DX) variable-air-volume (VAV) air-conditioning (A/C) system consists of a VAV air-distribution sub-system and a DX refrigeration plant. This paper reports in detail on a novel capacity controller developed for the DX VAV A/C system to regulate its compressor speed and hence its cooling capacity. The capacity controller consisted of both a numerical calculation algorithm (NCA), which was fundamentally based on the principle of energy balance using a number of real-time measured system's operating parameters, and a dead-band for decoupling the control actions from both the capacity controller and a conventional PI feedback controller for regulating the opening of an electronic expansion valve (EEV) in the refrigeration plant. To study the feasibility of the capacity controller, an experimental rig for the DX VAV A/C system having two conditioned spaces was built and experimental tests were carried out. The test results showed that using the capacity controller, the cooling capacity of the system's refrigeration plant can be accurately and continuously regulated and the supply air temperature well maintained at its desired value. The desirable independent zoning-control for space air temperatures can be successfully achieved by the DX VAV A/C system and the control performance for air temperatures in the conditioned space was highly satisfactory.

Research on a novel DDC-based capacity controller for the direct-expansion variable-air-volume A/C system

Energy Technology Data Exchange (ETDEWEB)

Chen, Wu [School of Marine Engineering, Jimei University, Xiamen, Fujian Province 361021 (China); Deng, Shiming [Department of Building Services Engineering, The Hong Kong Polytechnic University, Kowloon (China)

2010-01-15

A direct-expansion (DX) variable-air-volume (VAV) air-conditioning (A/C) system consists of a VAV air-distribution sub-system and a DX refrigeration plant. This paper reports in detail on a novel capacity controller developed for the DX VAV A/C system to regulate its compressor speed and hence its cooling capacity. The capacity controller consisted of both a numerical calculation algorithm (NCA), which was fundamentally based on the principle of energy balance using a number of real-time measured system's operating parameters, and a dead-band for decoupling the control actions from both the capacity controller and a conventional PI feedback controller for regulating the opening of an electronic expansion valve (EEV) in the refrigeration plant. To study the feasibility of the capacity controller, an experimental rig for the DX VAV A/C system having two conditioned spaces was built and experimental tests were carried out. The test results showed that using the capacity controller, the cooling capacity of the system's refrigeration plant can be accurately and continuously regulated and the supply air temperature well maintained at its desired value. The desirable independent zoning-control for space air temperatures can be successfully achieved by the DX VAV A/C system and the control performance for air temperatures in the conditioned space was highly satisfactory. (author)

Research on a novel DDC-based capacity controller for the direct-expansion variable-air-volume A/C system

International Nuclear Information System (INIS)

Chen Wu; Deng Shiming

2010-01-01

A direct-expansion (DX) variable-air-volume (VAV) air-conditioning (A/C) system consists of a VAV air-distribution sub-system and a DX refrigeration plant. This paper reports in detail on a novel capacity controller developed for the DX VAV A/C system to regulate its compressor speed and hence its cooling capacity. The capacity controller consisted of both a numerical calculation algorithm (NCA), which was fundamentally based on the principle of energy balance using a number of real-time measured system's operating parameters, and a dead-band for decoupling the control actions from both the capacity controller and a conventional PI feedback controller for regulating the opening of an electronic expansion valve (EEV) in the refrigeration plant. To study the feasibility of the capacity controller, an experimental rig for the DX VAV A/C system having two conditioned spaces was built and experimental tests were carried out. The test results showed that using the capacity controller, the cooling capacity of the system's refrigeration plant can be accurately and continuously regulated and the supply air temperature well maintained at its desired value. The desirable independent zoning-control for space air temperatures can be successfully achieved by the DX VAV A/C system and the control performance for air temperatures in the conditioned space was highly satisfactory.

Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

Science.gov (United States)

Han, Xiaomin; Li, Guojing; Zhang, Shuqun

2017-01-01

Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

In-flight particle measurement of glass raw materials in hybrid heating of twelve-phase AC arc with oxygen burner

International Nuclear Information System (INIS)

Liu, Y; Tanaka, M; Ikeba, T; Choi, S; Watanabe, T

2012-01-01

The high temperature provided by a 12-phase AC arc plasma is beneficial to finish vitrification reaction in milliseconds. Another heating method called “hybrid plasma” combines multi-phase AC arc and oxygen burner are expected to improve glass quality and increase productivity with minimum energy consumption. In this study, recent works on the development of in-flight particle measurement in hybrid plasma system are presented. Two-colour pyrometry offers considerable advantages for measuring particle temperatures in flight. A high-speed camera equipped with a band-pass filter system was applied to measure the in-flight temperatures of glass particles. The intensity recorded by the camera was calibrated using a tungsten halogen lamp. This technique also allows evaluating the fluctuation of the average particle temperature within millisecond in plasma region.

Spatial layout affects speed discrimination

Science.gov (United States)

Verghese, P.; Stone, L. S.

1997-01-01

We address a surprising result in a previous study of speed discrimination with multiple moving gratings: discrimination thresholds decreased when the number of stimuli was increased, but remained unchanged when the area of a single stimulus was increased [Verghese & Stone (1995). Vision Research, 35, 2811-2823]. In this study, we manipulated the spatial- and phase relationship between multiple grating patches to determine their effect on speed discrimination thresholds. In a fusion experiment, we merged multiple stimulus patches, in stages, into a single patch. Thresholds increased as the patches were brought closer and their phase relationship was adjusted to be consistent with a single patch. Thresholds increased further still as these patches were fused into a single patch. In a fission experiment, we divided a single large patch into multiple patches by superimposing a cross with luminance equal to that of the background. Thresholds decreased as the large patch was divided into quadrants and decreased further as the quadrants were maximally separated. However, when the cross luminance was darker than the background, it was perceived as an occluder and thresholds, on average, were unchanged from that for the single large patch. A control experiment shows that the observed trend in discrimination thresholds is not due to the differences in perceived speed of the stimuli. These results suggest that the parsing of the visual image into entities affects the combination of speed information across space, and that each discrete entity effectively provides a single independent estimate of speed.

Design procedure for a wind-wheel with self-adjusting blade mechanism

Directory of Open Access Journals (Sweden)

Gennady A. Oborsky

2014-12-01

Full Text Available Developed is a wind-wheel design equipped with the self-adjusting blade. The blade is positioned eccentrically to the balance wheel and can freely rotate around its axis. Elaborated is the method of calculating the energy characteristics for a wind-wheel with the self-adjusting blade, considering not only the wind force but the force of air counter flow resistance to the blade’s rotation. Initially, the blade being located at an angle α = 45 to the wheel rotation plane, the air flow rotates the wheel with the maximum force. Thus, the speed of rotation increases that involves the increase in air counter flow resistance and results in blade turning with respective angle α reduction. This, consequently, reduces the torque. When the torsional force and the resistance enter into equilibrium, the blade takes a certain angle α, and the wheel speed becomes constant. This wind-wheel design including a self-adjusting blade allows increasing the air flow load ratio when compared to the wind-wheel equipped with a jammed blade.

The Impact of Disability and Social Determinants of Health on Condition-Specific Readmissions beyond Medicare Risk Adjustments: A Cohort Study.

Science.gov (United States)

Meddings, Jennifer; Reichert, Heidi; Smith, Shawna N; Iwashyna, Theodore J; Langa, Kenneth M; Hofer, Timothy P; McMahon, Laurence F

2017-01-01

Readmission rates after pneumonia, heart failure, and acute myocardial infarction hospitalizations are risk-adjusted for age, gender, and medical comorbidities and used to penalize hospitals. To assess the impact of disability and social determinants of health on condition-specific readmissions beyond current risk adjustment. Retrospective cohort study of Medicare patients using 1) linked Health and Retirement Study-Medicare claims data (HRS-CMS) and 2) Healthcare Cost and Utilization Project State Inpatient Databases (Florida, Washington) linked with ZIP Code-level measures from the Census American Community Survey (ACS-HCUP). Multilevel logistic regression models assessed the impact of disability and selected social determinants of health on readmission beyond current risk adjustment. Outcomes measured were readmissions ≤30 days after hospitalizations for pneumonia, heart failure, or acute myocardial infarction. HRS-CMS models included disability measures (activities of daily living [ADL] limitations, cognitive impairment, nursing home residence, home healthcare use) and social determinants of health (spouse, children, wealth, Medicaid, race). ACS-HCUP model measures were ZIP Code-percentage of residents ≥65 years of age with ADL difficulty, spouse, income, Medicaid, and patient-level and hospital-level race. For pneumonia, ≥3 ADL difficulties (OR 1.61, CI 1.079-2.391) and prior home healthcare needs (OR 1.68, CI 1.204-2.355) increased readmission in HRS-CMS models (N = 1631); ADL difficulties (OR 1.20, CI 1.063-1.352) and 'other' race (OR 1.14, CI 1.001-1.301) increased readmission in ACS-HCUP models (N = 27,297). For heart failure, children (OR 0.66, CI 0.437-0.984) and wealth (OR 0.53, CI 0.349-0.787) lowered readmission in HRS-CMS models (N = 2068), while black (OR 1.17, CI 1.056-1.292) and 'other' race (OR 1.14, CI 1.036-1.260) increased readmission in ACS-HCUP models (N = 37,612). For acute myocardial infarction, nursing home status

RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

Directory of Open Access Journals (Sweden)

Yamada Nobuya

2010-05-01

Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

Science.gov (United States)

Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

2016-09-01

Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

Hopping models and ac universality

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2002-01-01

Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

Using variable speed drives technology to reap rewards of efficient HVAC design

International Nuclear Information System (INIS)

Anon.

1999-01-01

Electric motors are continuously running at full speed with vanes and throttles used to modulate the output, in most HVAC applications. This results in an excessive wastage of electrical energy, and the solution is the variable speed drive, which can save vast amounts of energy in fans, pumps and compressors across the HVAC system. Users of traditional control methods will not benefit from the energy savings that are possible through variable speed drives because the motor speed remains the same, with the result that some, and in some cases most, of the energy drawn will be wasted. Variable speed drives are more efficient because they control output by regulating the motor speed, rather than run the motor at full speed and use restrictions to reduce the flow. Recently, small so-called micro-drives have been launched, cutting the cost for most variable speed operation. Variable speed motors can also introduce new features to the HVAC system. An example of how drives can save money and improve the indoor climate is cited for Heathrow airport. There, the gateroom was earlier controlled by modulating valves in both heater and cooler coils, with two fans that operated continuously at rated speed. This system was very inefficient because the occupancy of the gateroom varied between zero and maximum several times daily. A new system was installed using two AC drives, in which one drive controls the supply air fan and the other the return air fan. The energy savings amounted to 89% during two tests and 77% in a third. A pump installation in the district heating system of Strasbourg, Germany, showed the savings that are possible in pump applications

PWM CONTROLLER'S MODELS FOR INVESTIGATION ACS IN SPICEFAMILY ECAD PROGRAMS

Directory of Open Access Journals (Sweden)

O. V. VASYLENKO

2018-05-01

Full Text Available Purpose. To improve simulation and design of Automatic Control Systems in the SPICE-compatible programs and to obtain separate economic and universal macromodels of PWM controller. Development of an PWM controller economical macromodel for the study of automatic control systems (ACS in computer-aided design (ECAD  programs, which does not generate algorithmic failures in comparison with the existing models of PWM. Findings. Analysis of SPICE-family applications’ mathematical basis allowed to classifying existing models of PWM-controllers, defining their suitability for ACS simulation. The criteria for the synthesis of new models have been defined. For the SPICE 3G algorithms, the Switch and Averaged models based on behavioral elements has been developed. Universal and economical PWM controller macromodel based on the simple algorithm for determining the output signal with minimum numbers of input parameters has been designed. For the Automated Measuring magnetic susceptibility System, the macromodel of quasi-PWM signal generator have been designed, which is used in the compensation subsystem. This model is different from the existing ones: it synthesizes the staircase output signal instead the pulse one, thus, there is direct control of the amplitude of the output signal, which is taken averaged. The adequacy of the models is confirmed as comparison of the simulation results during investigations of the model already existing in the SPICE program, as well as the results of experiments with real ACS. The modeling of the PWM controller was carried out on the basis of behavioral elements from the ECAD library, simulation (solution of algebra-differential equations systems with programming elements is based on SPICE algorithms. The object of the study was the simulation process of ACS with the pulse-width principle of adjusting the output value. The subject of the research are the models of PWM controllers. Originality. The new macromodel of PWM

Transport AC losses in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

2007-09-15

Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

Effects of AC Electric Field on Small Laminar Nonpremixed Flames

KAUST Repository

Xiong, Yuan

2015-04-01

baseline case, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. By varying applied AC in a wide range of frequency and voltage, several insta- bility modes were observed, including flicking flames, partial pinch-off of flames, and spinning flames. High speed imaging together with Mie scattering techniques were combined to reveal the flame dynamics as well as the flow structure inside the flames. Original steady toroidal vortices triggered by AC were noted to exhibit axisymmetric axial instability in the flicking and partial pinch-off modes and non-axisymmetric azimuthal instability in the spinning mode. Electrical measurements were also conducted simultaneously to identify the voltage, current, and electrical power responses. Integrated power was noted to be sensitive to indicate subtle variation of flames properties and to the occurrence of axial instability. Under low frequency AC forcing with electrical conditions not generating toroidal vortices, responses of flames were further investigated. Several nonlinear flame responses, including frequency doubling and tripling phenomena, were identified. Spectral analysis revealed that such nonlinear responses were attributed to the combined effects of triggering buoyancy-induced oscillation of the flame as well as the Lorenz force generated by applying AC. Phase delay behaviors between the applied voltage and the heat release rate (or flame size) were also studied to explore the potential of applying AC in controlling flame instability. It was found that the phase delay had large variations for AC frequency smaller than

Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Pijar Riza Anugerah

2015-10-01

Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

Adjustments with running speed reveal neuromuscular adaptations during landing associated with high mileage running training.

Science.gov (United States)

Verheul, Jasper; Clansey, Adam C; Lake, Mark J

2017-03-01

It remains to be determined whether running training influences the amplitude of lower limb muscle activations before and during the first half of stance and whether such changes are associated with joint stiffness regulation and usage of stored energy from tendons. Therefore, the aim of this study was to investigate neuromuscular and movement adaptations before and during landing in response to running training across a range of speeds. Two groups of high mileage (HM; >45 km/wk, n = 13) and low mileage (LM; joint stiffness might predominantly be governed by tendon stiffness rather than muscular activations before landing. Estimated elastic work about the ankle was found to be higher in the HM runners, which might play a role in reducing weight acceptance phase muscle activation levels and improve muscle activation efficiency with running training. NEW & NOTEWORTHY Although neuromuscular factors play a key role during running, the influence of high mileage training on neuromuscular function has been poorly studied, especially in relation to running speed. This study is the first to demonstrate changes in neuromuscular conditioning with high mileage training, mainly characterized by lower thigh muscle activation after touch down, higher initial knee stiffness, and greater estimates of energy return, with adaptations being increasingly evident at faster running speeds. Copyright © 2017 the American Physiological Society.

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Electric field measurements in a kHz-driven He jet - The influence of the gas flow speed

NARCIS (Netherlands)

Sobota, A.; Guaitella, O.; Sretenović, G.B.; Krstić, I.B.; Kovačević, V.V.; Obrusník, A.; Nguyen, Y.N.; Zajíčková, L.; Obradović, B.M.; Kuraica, M.M.

2016-01-01

This report focuses on the dependence of electric field strength in the effluent of a vertically downwards-operated plasma jet freely expanding into room air as a function of the gas flow speed. A 30 kHz AC-driven He jet was used in a coaxial geometry, with an amplitude of 2 kV and gas flow between

THERMIONIC AC GENERATION

Science.gov (United States)

is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

21 CFR 880.6320 - AC-powered medical examination light.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

AC machine control : robust and sensorless control by parameter independency

Energy Technology Data Exchange (ETDEWEB)

Samuelsen, Dag Andreas Hals

2009-06-15

In this thesis it is first presented how robust control can be used to give AC motor drive systems competitive dynamic performance under parameter variations. These variations are common to all AC machines, and are a result of temperature change in the machine, and imperfect machine models. This robust control is, however, dependent on sensor operation in the sense that the rotor position is needed in the control loop. Elimination of this control loop has been for many years, and still is, a main research area of AC machines control systems. An integrated PWM modulator and sampler unit has been developed and tested. The sampler unit is able to give current and voltage measurements with a reduced noise component. It is further used to give the true derivative of currents and voltages in the machine and the power converter, as an average over a PWM period, and as separate values for all states of the power converter. In this way, it can give measurements of the currents as well as the derivative of the currents, at the start and at the end of a single power inverter state. This gave a large degree of freedom in parameter and state identification during uninterrupted operation of the induction machine. The special measurement scheme of the system achieved three main goals: By avoiding the time frame where the transistors commutate and the noise in the measurement of the current is large, filtering of the current measurement is no longer needed. The true derivative of the current in the machine is can be measured with far less noise components. This was extended to give any separate derivative in all three switching states of the power converter. Using the computational resources of the FPGA, more advanced information was supplied to the control system, in order to facilitate sensor less operation, with low computational demands on the DSP. As shown in the papers, this extra information was first used to estimate some of the states of the machine, in some or all of the

Ac-dc converter firing error detection

International Nuclear Information System (INIS)

Gould, O.L.

1996-01-01

Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

Directory of Open Access Journals (Sweden)

Amir V. Tavakoli

2017-09-01

Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

Overall impact of speed-related initiatives and factors on crash outcomes.

Science.gov (United States)

D'Elia, A; Newstead, S; Cameron, M

2007-01-01

From December 2000 until July 2002 a package of speed-related initiatives and factors took place in Victoria, Australia. The broad aim of this study was to evaluate the overall impact of the package on crash outcomes. Monthly crash counts and injury severity proportions were assessed using Poisson and logistic regression models respectively. The model measured the overall effect of the package after adjusting as far as possible for non-speed road safety initiatives and socio-economic factors. The speed-related package was associated with statistically significant estimated reductions in casualty crashes and suggested reductions in injury severity with trends towards increased reductions over time. From December 2000 until July 2002, three new speed enforcement initiatives were implemented in Victoria, Australia. These initiatives were introduced in stages and involved the following key components: More covert operations of mobile speed cameras, including flash-less operations; 50% increase in speed camera operating hours; and lowering of cameras' speed detection threshold. In addition, during the period 2001 to 2002, the 50 km/h General Urban Speed Limit (GUSL) was introduced (January 2001), there was an increase in speed-related advertising including the "Wipe Off 5" campaign, media announcements were made related to the above enforcement initiatives and there was a speeding penalty restructure. The above elements combine to make up a package of speed-related initiatives and factors. The package represents a broad, long term program by Victorian government agencies to reduce speed based on three linked strategies: more intensive Police enforcement of speed limits to deter potential offenders, i.e. the three new speed enforcement initiatives just described - supported by higher penalties; a reduction in the speed limit on local streets throughout Victoria from 60 km/h to 50 km/h; and provision of information using the mass media (television, radio and billboard) to

Proposed torque optimized behavior for digital speed control of induction motors

Energy Technology Data Exchange (ETDEWEB)

Metwally, H.M.B.; El-Shewy, H.M.; El-Kholy, M.M. [Zagazig Univ., Dept. of Electrical Engineering, Zagazig (Egypt); Abdel-Kader, F.E. [Menoufyia Univ., Dept. of Electrical Engineering, Menoufyia (Egypt)

2002-09-01

In this paper, a control strategy for speed control of induction motors with field orientation is proposed. The proposed method adjusts the output voltage and frequency of the converter to operate the motor at the desired speed with maximum torque per ampere at all load torques keeping the torque angle equal to 90 deg. A comparison between the performance characteristics of a 2 hp induction motor using three methods of speed control is presented. These methods are the proposed method, the direct torque control method and the constant V/f method. The comparison showed that better performance characteristics are obtained using the proposed speed control strategy. A computer program, based on this method, is developed. Starting from the motor parameters, the program calculates a data set for the stator voltage and frequency required to obtain maximum torque per ampere at any motor speed and load torque. This data set can be used by the digital speed control system of induction motors. (Author)

Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

DEFF Research Database (Denmark)

Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

2009-01-01

This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

Characterisation of AC1: a naturally decaffeinated coffee

Directory of Open Access Journals (Sweden)

Luciana Benjamim Benatti

2012-01-01

Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

A multi-channel AC power supply controller

International Nuclear Information System (INIS)

Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

2003-01-01

A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

Bioinformatics and Astrophysics Cluster (BinAc)

Science.gov (United States)

Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

2017-09-01

BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

Coordinated frequency control from offshore wind power plants connected to multi terminal DC system considering wind speed variation

DEFF Research Database (Denmark)

Sakamuri, Jayachandra N.; Altin, Müfit; Hansen, Anca Daniela

2017-01-01

A coordinated fast primary frequency control scheme from offshore wind power plants (OWPPs) integrated to a three terminal high voltage DC (HVDC) system is proposed in this study. The impact of wind speed variation on the OWPP active power output and thus on the AC grid frequency and DC grid...... the active power support from OWPP with a ramp rate limiter and (iii) An alternative method for the wind turbine overloading considering rotor speed. The effectiveness of the proposed control scheme is demonstrated on a wind power plant integrated into a three terminal HVDC system developed in DIg......SILIENT PowerFactory. The results show that the proposed coordinated frequency control method performs effectively at different wind speeds and minimises the secondary effects on frequency and DC voltage....

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

Direct Torque Control of a Small Wind Turbine with a Sliding-Mode Speed Controller

Science.gov (United States)

Sri Lal Senanayaka, Jagath; Karimi, Hamid Reza; Robbersmyr, Kjell G.

2016-09-01

In this paper. the method of direct torque control in the presence of a sliding-mode speed controller is proposed for a small wind turbine being used in water heating applications. This concept and control system design can be expanded to grid connected or off-grid applications. Direct torque control of electrical machines has shown several advantages including very fast dynamics torque control over field-oriented control. Moreover. the torque and flux controllers in the direct torque control algorithms are based on hvsteretic controllers which are nonlinear. In the presence of a sliding-mode speed control. a nonlinear control system can be constructed which is matched for AC/DC conversion of the converter that gives fast responses with low overshoots. The main control objectives of the proposed small wind turbine can be maximum power point tracking and soft-stall power control. This small wind turbine consists of permanent magnet synchronous generator and external wind speed. and rotor speed measurements are not required for the system. However. a sensor is needed to detect the rated wind speed overpass events to activate proper speed references for the wind turbine. Based on the low-cost design requirement of small wind turbines. an available wind speed sensor can be modified. or a new sensor can be designed to get the required measurement. The simulation results will be provided to illustrate the excellent performance of the closed-loop control system in entire wind speed range (4-25 m/s).

Blurring emotional memories using eye movements: individual differences and speed of eye movements.

Science.gov (United States)

van Schie, Kevin; van Veen, Suzanne C; Engelhard, Iris M; Klugkist, Irene; van den Hout, Marcel A

2016-01-01

In eye movement desensitization and reprocessing (EMDR), patients make eye movements (EM) while recalling traumatic memories. Making EM taxes working memory (WM), which leaves less resources available for imagery of the memory. This reduces memory vividness and emotionality during future recalls. WM theory predicts that individuals with small working memory capacities (WMCs) benefit more from low levels of taxing (i.e., slow EM) whereas individuals with large WMC benefit more from high levels of taxing (i.e., fast EM). We experimentally examined and tested four prespecified hypotheses regarding the role of WMC and EM speed in reducing emotionality and vividness ratings: 1) EM-regardless of WMC and EM speed-are more effective compared to no dual task, 2) increasing EM speed only affects the decrease in memory ratings irrespective of WMC, 3) low-WMC individuals-compared to high-WMC individuals-benefit more from making either type of EM, 4) the EM intervention is most effective when-as predicted by WM theory-EM are adjusted to WMC. Undergraduates with low (n=31) or high (n=35) WMC recalled three emotional memories and rated vividness and emotionality before and after each condition (recall only, recall + slow EM, and recall + fast EM). Contrary to the theory, the data do not support the hypothesis that EM speed should be adjusted to WMC (hypothesis 4). However, the data show that a dual task in general is more effective in reducing memory ratings than no dual task (hypothesis 1), and that a more cognitively demanding dual task increases the intervention's effectiveness (hypothesis 2). Although adjusting EM speed to an individual's WMC seems a straightforward clinical implication, the data do not show any indication that such a titration is helpful.

Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

Directory of Open Access Journals (Sweden)

Evi Ploumpidou

2017-12-01

Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

Instability and electrical response of small laminar coflow diffusion flames under AC electric fields: Toroidal vortex formation and oscillating and spinning flames

KAUST Repository

Xiong, Yuan; Chung, Suk-Ho; Cha, Min

2016-01-01

Dynamical and electrical responses of a small coflow diffusion flame were investigated by applying a high-voltage alternating current (AC), to a fuel jet nozzle. High-speed imaging and electrical diagnostics were adopted to capture flame dynamics and electrical signals, such as voltage (V ), frequency (f ) and current (I ). In the V -f domain of 0-5kV and 0-5kHz, AC-driven instabilities, resulting in various flame modes such as an oscillation, pinch-off and spinning of flames were identified. Characteristic frequency of each mode was determined and a visualization of near-nozzle flow structures suggested a close causality of initial counter-rotating vortices (inner and outer toroidal vortices - ITV and OTV), to the other observed flame. An axisymmetric ITV shedding was identified within oscillating and pinch-off modes, while asymmetric ITV shedding was identified with the spinning mode. Integrated electric power over several AC periods correlated well with variation in the flame surface area for these instabilities, demonstrating that measured electric power is a potential indicator of combustion instabilities in electric-field-assisted combustion.

Instability and electrical response of small laminar coflow diffusion flames under AC electric fields: Toroidal vortex formation and oscillating and spinning flames

KAUST Repository

Xiong, Yuan

2016-06-24

Dynamical and electrical responses of a small coflow diffusion flame were investigated by applying a high-voltage alternating current (AC), to a fuel jet nozzle. High-speed imaging and electrical diagnostics were adopted to capture flame dynamics and electrical signals, such as voltage (V ), frequency (f ) and current (I ). In the V -f domain of 0-5kV and 0-5kHz, AC-driven instabilities, resulting in various flame modes such as an oscillation, pinch-off and spinning of flames were identified. Characteristic frequency of each mode was determined and a visualization of near-nozzle flow structures suggested a close causality of initial counter-rotating vortices (inner and outer toroidal vortices - ITV and OTV), to the other observed flame. An axisymmetric ITV shedding was identified within oscillating and pinch-off modes, while asymmetric ITV shedding was identified with the spinning mode. Integrated electric power over several AC periods correlated well with variation in the flame surface area for these instabilities, demonstrating that measured electric power is a potential indicator of combustion instabilities in electric-field-assisted combustion.

Intelligent control for large-scale variable speed variable pitch wind turbines

Institute of Scientific and Technical Information of China (English)

Xinfang ZHANG; Daping XU; Yibing LIU

2004-01-01

Large-scale wind turbine generator systems have strong nonlinear multivariable characteristics with many uncertain factors and disturbances.Automatic control is crucial for the efficiency and reliability of wind turbines.On the basis of simplified and proper model of variable speed variable pitch wind turbines,the effective wind speed is estimated using extended Kalman filter.Intelligent control schemes proposed in the paper include two loops which operate in synchronism with each other.At below-rated wind speed,the inner loop adopts adaptive fuzzy control based on variable universe for generator torque regulation to realize maximum wind energy capture.At above-rated wind speed, a controller based on least square support vector machine is proposed to adjust pitch angle and keep rated output power.The simulation shows the effectiveness of the intelligent control.

Interaction between MHD generator and DC-AC power conversion system

International Nuclear Information System (INIS)

Tanaka, D.

1982-01-01

Transient characteristics of an MHD power generating system including a DC-AC inverter are analyzed using a time-dependent quasi-one-dimensional approximation. The generator model considered is Faraday type of U-25 class with heavy-oil and air combustion gas. It is found that a short-circuited fault of the invertor may become more serious than an open-circuited fault, resulting in significant gas velocity reduction. An open-circuited fault, if retained for more than 5-8 ms, can substantially increase the gas velocity at the upstream end of the fault region. A protection system composed of a fast-acting DC circuit-breaker and an emergency load resistance is proposed. The switching speed of the DC breaker must be about 500 microsec to stop a pressure increase, resulting, for example, from the short-circuiting of 20 electrode pairs, before it reaches 120% of the initial level

ACS and STEMI treatment: gender-related issues.

Science.gov (United States)

Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

2012-08-01

Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

AC loss in YBCO coated conductors at high dB/dt measured using a spinning magnet calorimeter (stator testbed environment)

Science.gov (United States)

Murphy, J. P.; Gheorghiu, N. N.; Bullard, T.; Haugan, T.; Sumption, M. D.; Majoros, M.; Collings, E. W.

2017-09-01

A new facility for the measurement of AC loss in superconductors at high dB/dt has been developed. The test device has a spinning rotor consisting of permanent magnets arranged in a Halbach array; the sample, positioned outside of this, is exposed to a time varying AC field with a peak radial field of 0.566 T. At a rotor speed of 3600 RPM the frequency of the AC field is 240 Hz, the radial dB/dt is 543 T/s and the tangential dB/dt is 249 T/s. Loss is measured using nitrogen boiloff from a double wall calorimeter feeding a gas flow meter. The system is calibrated using power from a known resistor. YBCO tape losses were measured in the new device and compared to the results from a solenoidal magnet AC loss system measurement of the same samples (in this latter case measurements were limited to a field of amplitude 0.1 T and a dB/dt of 100 T/s). Solenoidal magnet system AC loss measurements taken on a YBCO sample agreed with the Brandt loss expression associated with a 0-0.1 T Ic of 128 A. Subsequently, losses for two more YBCO tapes nominally identical to the first were individually measured in this spinning magnet calorimeter (SMC) machine with a Bmax of 0.566 T and dB/dt of up to 272 T/s. The losses, compared to a simplified version of the Brandt expression, were consistent with the average Ic expected for the tape in the 0-0.5 T range at 77 K. The eddy current contribution was consistent with a 77 K residual resistance ratio, RR, of 4.0. The SMC results for these samples agreed to within 5%. Good agreement was also obtained between the results of the SMC AC loss measurement and the solenoidal magnet AC loss measurement on the same samples.

Simulation of load traffic and steeped speed control of conveyor

Science.gov (United States)

Reutov, A. A.

2017-10-01

The article examines the possibilities of the step control simulation of conveyor speed within Mathcad, Simulink, Stateflow software. To check the efficiency of the control algorithms and to more accurately determine the characteristics of the control system, it is necessary to simulate the process of speed control with real values of traffic for a work shift or for a day. For evaluating the belt workload and absence of spillage it is necessary to use empirical values of load flow in a shorter period of time. The analytical formulas for optimal speed step values were received using empirical values of load. The simulation checks acceptability of an algorithm, determines optimal parameters of regulation corresponding to load flow characteristics. The average speed and the number of speed switching during simulation are admitted as criteria of regulation efficiency. The simulation example within Mathcad software is implemented. The average conveyor speed decreases essentially by two-step and three-step control. A further increase in the number of regulatory steps decreases average speed insignificantly but considerably increases the intensity of the speed switching. Incremental algorithm of speed regulation uses different number of stages for growing and reducing load traffic. This algorithm allows smooth control of the conveyor speed changes with monotonic variation of the load flow. The load flow oscillation leads to an unjustified increase or decrease of speed. Work results can be applied at the design of belt conveyors with adjustable drives.

Data Capture Technique for High Speed Signaling

Science.gov (United States)

Barrett, Wayne Melvin; Chen, Dong; Coteus, Paul William; Gara, Alan Gene; Jackson, Rory; Kopcsay, Gerard Vincent; Nathanson, Ben Jesse; Vranas, Paylos Michael; Takken, Todd E.

2008-08-26

A data capture technique for high speed signaling to allow for optimal sampling of an asynchronous data stream. This technique allows for extremely high data rates and does not require that a clock be sent with the data as is done in source synchronous systems. The present invention also provides a hardware mechanism for automatically adjusting transmission delays for optimal two-bit simultaneous bi-directional (SiBiDi) signaling.

Adjustable electronic load-alarm relay

International Nuclear Information System (INIS)

Mason, C.H.; Sitton, R.S.

1976-01-01

An improved electronic alarm relay for monitoring the current drawn by an ac motor or other electrical load is described. The circuit is designed to measure the load with high accuracy and to have excellent alarm repeatability. Chattering and arcing of the relay contacts are minimal. The operator can adjust the set point easily and can re-set both the high and the low alarm points by means of one simple adjustment. The relay includes means for generating a signal voltage proportional to the motor current. In a preferred form of the invention a first operational amplifier is provided to generate a first constant reference voltage which is higher than a preselected value of the signal voltage. A second operational amplifier is provided to generate a second constant reference voltage which is lower than the aforementioned preselected value of the signal voltage. A circuit comprising a first resistor serially connected to a second resistor is connected across the outputs of the first and second amplifiers, and the junction of the two resistors is connected to the inverting terminal of the second amplifier. Means are provided to compare the aforementioned signal voltage with both the first and second reference voltages and to actuate an alarm if the signal voltage is higher than the first reference voltage or lower than the second reference voltage

Polarization speed meter for gravitational-wave detection

Science.gov (United States)

Wade, Andrew R.; McKenzie, Kirk; Chen, Yanbei; Shaddock, Daniel A.; Chow, Jong H.; McClelland, David E.

2012-09-01

We propose a modified configuration of an advanced gravitational-wave detector that is a speed-meter-type interferometer with improved sensitivity with respect to quantum noise. With the addition of polarization-controlling components to the output of an arm cavity Michelson interferometer, an orthogonal polarization state of the interferometer can be used to store signal, returning it later with opposite phase to cancel position information below the storage bandwidth of the opposite mode. This modification provides an alternative to an external kilometer-scale Fabry-Pérot cavity, as presented in earlier work of Purdue and Chen [Phys. Rev. D 66, 122004 (2002)]. The new configuration requires significantly less physical infrastructure to achieve speed meter operation. The quantity of length and alignment degrees of freedom is also reduced. We present theoretical calculations to show that such a speed meter detector is capable of beating the strain sensitivity imposed by the standard quantum limit over a broad range of frequencies for Advanced Laser Interferometer Gravitational-wave Observatory-like parameters. The benefits and possible difficulties of implementing such a scheme are outlined. We also present results for tuning of the speed meter by adjusting the degree of polarization coupling, a novel possibility that does not exist in previously proposed designs, showing that there is a smooth transition from speed meter operation to that of a signal-recycling Michelson behavior.

Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

Science.gov (United States)

Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, G [Jefferson Lab (United States)

2014-07-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, Gianluigi [JLAB

2015-02-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

Intraindividual variability in executive functions but not speed of processing or conflict resolution predicts performance differences in gait speed in older adults.

Science.gov (United States)

Holtzer, Roee; Mahoney, Jeannette; Verghese, Joe

2014-08-01

The relationship between executive functions (EF) and gait speed is well established. However, with the exception of dual tasking, the key components of EF that predict differences in gait performance have not been determined. Therefore, the current study was designed to determine whether processing speed, conflict resolution, and intraindividual variability in EF predicted variance in gait performance in single- and dual-task conditions. Participants were 234 nondemented older adults (mean age 76.48 years; 55% women) enrolled in a community-based cohort study. Gait speed was assessed using an instrumented walkway during single- and dual-task conditions. The flanker task was used to assess EF. Results from the linear mixed effects model showed that (a) dual-task interference caused a significant dual-task cost in gait speed (estimate = 35.99; 95% CI = 33.19-38.80) and (b) of the cognitive predictors, only intraindividual variability was associated with gait speed (estimate = -.606; 95% CI = -1.11 to -.10). In unadjusted analyses, the three EF measures were related to gait speed in single- and dual-task conditions. However, in fully adjusted linear regression analysis, only intraindividual variability predicted performance differences in gait speed during dual tasking (B = -.901; 95% CI = -1.557 to -.245). Among the three EF measures assessed, intraindividual variability but not speed of processing or conflict resolution predicted performance differences in gait speed. © The Author 2013. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Ac irreversibility line of bismuth-based high temperature superconductors

International Nuclear Information System (INIS)

Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

1997-01-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching

Science.gov (United States)

Taylor, Terri

2009-05-01

In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.

Alternating-Current Motor Drive for Electric Vehicles

Science.gov (United States)

Krauthamer, S.; Rippel, W. E.

1982-01-01

New electric drive controls speed of a polyphase as motor by varying frequency of inverter output. Closed-loop current-sensing circuit automatically adjusts frequency of voltage-controlled oscillator that controls inverter frequency, to limit starting and accelerating surges. Efficient inverter and ac motor would give electric vehicles extra miles per battery charge.

Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

Directory of Open Access Journals (Sweden)

Eriko Kage-Nakadai

Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

On the validity of self-report assessment of cognitive abilities: Attentional control scale associations with cognitive performance, emotional adjustment, and personality.

Science.gov (United States)

Williams, Paula G; Rau, Holly K; Suchy, Yana; Thorgusen, Sommer R; Smith, Timothy W

2017-05-01

Individual differences in attentional control involve the ability to voluntarily direct, shift, and sustain attention. In studies of the role of attentional control in emotional adjustment, social relationships, and vulnerability to the effects of stress, self-report questionnaires are commonly used to measure this construct. Yet, convincing evidence of the association between self-report scales and actual cognitive performance has not been demonstrated. Across 2 independent samples, we examined associations between self-reported attentional control (Attentional Control Scale; ACS), self-reported emotional adjustment, Five-Factor Model personality traits (NEO Personality Inventory-Revised) and performance measures of attentional control. Study 1 examined behavioral performance on the Attention Network Test (ANT; Fan, McCandliss, Sommer, Raz, & Posner, 2002) and the Modified Switching Task (MST; Suchy & Kosson, 2006) in a large sample (n = 315) of healthy young adults. Study 2 (n = 78) examined behavioral performance on standardized neuropsychological tests of attention, including Conner's Continuous Performance Test-II and subtests from the Wechsler Adult Intelligence Scales, Third Edition (WAIS-III; Psychological Corporation, 1997) and Delis-Kaplan Executive Function System (D-KEFS; Delis, Kaplan, & Kramer, 2001). Results indicated that the ACS was largely unrelated to behavioral performance measures of attentional control but was significantly associated with emotional adjustment, neuroticism, and conscientiousness. These findings suggest that although self-reported attentional control may be a useful construct, researchers using the ACS should exercise caution in interpreting it as a proxy for actual cognitive ability or performance. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

Performance of Cableless Magnetic In-Piping Actuator Capable of High-Speed Movement by Means of Inertial Force

Directory of Open Access Journals (Sweden)

Hiroyuki Yaguchi

2011-01-01

Full Text Available The present paper proposes a novel cableless magnetic actuator with a new propulsion module that exhibits a very high thrusting force. This actuator contains an electrical inverter that directly transforms DC from button batteries into AC. The electrical DC-AC inverter incorporates a mass-spring system, a reed switch, and a curved permanent magnet that switches under an electromagnetic force. The actuator is moved by the inertial force of the mass-spring system due to mechanical resonance energy. The experimental results show that the actuator is able to move upward at a speed of 19.7 mm/s when using 10 button batteries when pulling a 20 g load mass. This cableless magnetic actuator has several possible applications, including narrow pipe inspection and maintenance.

Magnetic irreversibility in granular superconductors: ac susceptibility study

International Nuclear Information System (INIS)

Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.

1991-01-01

Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)

10-bit rapid single flux quantum digital-to-analog converter for ac voltage standard

International Nuclear Information System (INIS)

Maezawa, M; Hirayama, F

2008-01-01

Digital-to-analog (D/A) converters based on rapid single flux quantum (RSFQ) technology are under development for ac voltage standard applications. We present design and test results on a prototype 10-bit version integrated on a single chip. The 10-bit chip includes over 6000 Josephson junctions and consumes a bias current exceeding 1 A. To reduce the effects of the high bias current on circuit operation, a custom design method was employed in part and large circuit blocks were divided into smaller ones. The 10-bit chips were fabricated and tested at low speed. The test results suggested that our design approach could manage large bias currents on the order of 1 A per chip

Control of hybrid AC/DC microgrid under islanding operational conditions

DEFF Research Database (Denmark)

Ding, G.; Gao, F.; Zhang, S.

2014-01-01

This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....

Ac irreversibility line of bismuth-based high temperature superconductors

Energy Technology Data Exchange (ETDEWEB)

Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

1997-09-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

Speed Sensorless Control of PMSM using Model Reference Adaptive System and RBFN

OpenAIRE

Wei Gao; Zhirong Guo

2013-01-01

In the speed sensorless vector control system, the amended method of estimating the rotor speed about model reference adaptive system (MRAS) based on radial basis function neural network (RBFN) for PMSM sensorless vector control system was presented. Based on the PI regulator, the radial basis function neural network which is more prominent learning efficiency and performance is combined with MRAS. The reference model and the adjust model are the PMSM itself and the PMSM current, respectively...

Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

Science.gov (United States)

Reitan, D. K.

1973-01-01

Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

Science.gov (United States)

Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

2017-05-01

Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

Low-Speed Control of Heavy-Load Transfer Robot with Long Telescopic Boom Based on Stribeck Friction Model

Directory of Open Access Journals (Sweden)

Bo You

2012-01-01

Full Text Available The severe low-speed creep phenomenon occurs in the telescopic boom system of a heavy-load transfer robot with a long telescopic boom as a result of nonlinear friction. In order to improve control precision and operation performance at low speeds, we built a three-loop control nonlinear model of an AC servo motor with Stribeck friction disturbance. Traditional proportional-integral-derivative controller (PID and fuzzy PID controls were, respectively, adopted in the position loop, and the control performance was simulated. The results showed that a system with fuzzy PID control eliminates “flat top” position tracking and “dead zone” speed tracking, which are generated by traditional PID, and thereby decreases the effect of friction on the performance of the servo system. This elimination also improved the tracking accuracy and robustness of the system.

Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

DEFF Research Database (Denmark)

Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

2004-01-01

of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....

Monetary policy and dynamic adjustment of corporate investment: A policy transmission channel perspective

Directory of Open Access Journals (Sweden)

Qiang Fu

2015-06-01

Full Text Available We investigate monetary policy effects on corporate investment adjustment, using a sample of China’s A-share listed firms (2005–2012, under an asymmetic framework and from a monetary policy transmission channel perspective. We find that corporate investment adjustment is faster in expansionary than contractionary monetary policy periods. Monetary policy has a significant effect on adjustment speed through monetary and credit channels. An increase in the growth rate of money supply or credit accelerates adjustment. Both effects are significantly greater during tightening than expansionary periods. The monetary channel has significant asymmetry, whereas the credit channel has none. Leverage moderates the relationship between monetary policy and adjustment, with a greater effect in expansionary periods. This study enriches the corporate investment behavior literature and can help governments develop and optimize macro-control policies.

Nonlinear AC susceptibility, surface and bulk shielding

Science.gov (United States)

van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

1996-02-01

We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

AC BREAKDOWN IN GASES

Science.gov (United States)

electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

Regulating vacuum pump speed with feedback control

International Nuclear Information System (INIS)

Ludington, D.C.; Aneshansley, D.J.; Pellerin, R.; Guo, F.

1992-01-01

Considerable energy is wasted by the vacuum pump/motor on dairy farms. The output capacity (m 3 /min or cfm) of the vacuum pump always exceeds the capacity needed to milk cows and wash pipelines. Vacuum pumps run at full speed and load regardless of actual need for air. Excess air is admitted through a controller. Energy can be saved from electrical demand reduced by regulating vacuum pump speed according to air based on air usage. An adjustable speed drive (ASD) on the motor and controlled based upon air usage, can reduce the energy used by the vacuum pump. However, the ASD unit tested could not maintain vacuum levels within generally accepted guidelines when air usage changed. Adding a high vacuum reserve and a dual vacuum controller between the vacuum pump and the milking pipeline brought vacuum stability within guidelines. The ASD/dual vacuum system can reduce energy consumption and demand by at least 50 percent during milking and provide better vacuum stability than conventional systems. Tests were not run during washing cycles. Using 1990 costs and only the energy saved during milking, the simple payback on investment in new equipment for a 5 hp motor, speed controller and vacuum regulator would be about 5 years

Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

Science.gov (United States)

Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

2016-01-01

Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

Directory of Open Access Journals (Sweden)

Rudy Ariyanto

2017-11-01

Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

Science.gov (United States)

Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

2014-02-01

Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

A new hydraulic regulation method on district heating system with distributed variable-speed pumps

International Nuclear Information System (INIS)

Wang, Hai; Wang, Haiying; Zhu, Tong

2017-01-01

Highlights: • A hydraulic regulation method was presented for district heating with distributed variable speed pumps. • Information and automation technologies were utilized to support the proposed method. • A new hydraulic model was developed for distributed variable speed pumps. • A new optimization model was developed based on genetic algorithm. • Two scenarios of a multi-source looped system was illustrated to validate the method. - Abstract: Compared with the hydraulic configuration based on the conventional central circulating pump, a district heating system with distributed variable-speed-pumps configuration can often save 30–50% power consumption on circulating pumps with frequency inverters. However, the hydraulic regulations on distributed variable-speed-pumps configuration could be more complicated than ever while all distributed pumps need to be adjusted to their designated flow rates. Especially in a multi-source looped structure heating network where the distributed pumps have strongly coupled and severe non-linear hydraulic connections with each other, it would be rather difficult to maintain the hydraulic balance during the regulations. In this paper, with the help of the advanced automation and information technologies, a new hydraulic regulation method was proposed to achieve on-site hydraulic balance for the district heating systems with distributed variable-speed-pumps configuration. The proposed method was comprised of a new hydraulic model, which was developed to adapt the distributed variable-speed-pumps configuration, and a calibration model with genetic algorithm. By carrying out the proposed method step by step, the flow rates of all distributed pumps can be progressively adjusted to their designated values. A hypothetic district heating system with 2 heat sources and 10 substations was taken as a case study to illustrate the feasibility of the proposed method. Two scenarios were investigated respectively. In Scenario I, the

Annexin A1 N-terminal derived peptide Ac2-26 stimulates fibroblast migration in high glucose conditions.

Directory of Open Access Journals (Sweden)

Valentina Bizzarro

Full Text Available Deficient wound healing in diabetic patients is very frequent, but the cellular and molecular causes are poorly defined. In this study, we have evaluated whether Annexin A1 derived peptide Ac2-26 stimulates fibroblast migration in high glucose conditions. Using normal human skin fibroblasts WS1 in low glucose (LG or high glucose (HG we observed the enrichment of Annexin A1 protein at cell movement structures like lamellipodial extrusions and interestingly, a significant decrease in levels of the protein in HG conditions. The analysis of the translocation of Annexin A1 to cell membrane showed lower levels of Annexin A1 in both membrane pool and supernatants of WS1 cells treated with HG. Wound-healing assays using cell line transfected with Annexin A1 siRNAs indicated a slowing down in migration speed of cells suggesting that Annexin A1 has a role in the migration of WS1 cells. In order to analyze the role of extracellular Annexin A1 in cell migration, we have performed wound-healing assays using Ac2-26 showing that peptide was able to increase fibroblast cell migration in HG conditions. Experiments on the mobilization of intracellular calcium and analysis of p-ERK expression confirmed the activity of the FPR1 following stimulation with the peptide Ac2-26. A wound-healing assay on WS1 cells in the presence of the FPR agonist fMLP, of the FPR antagonist CsH and in the presence of Ac2-26 indicated that Annexin A1 influences fibroblast cell migration under HG conditions acting through FPR receptors whose expression was slightly increased in HG. In conclusion, these data demonstrate that (i Annexin A1 is involved in migration of WS1 cells, through interaction with FPRs; (ii N- terminal peptide of Annexin A1 Ac2-26 is able to stimulate direct migration of WS1 cells in high glucose treatment possibly due to the increased receptor expression observed in hyperglycemia conditions.

A miniaturized piezoelectric turbine with self-regulation for increased air speed range

Energy Technology Data Exchange (ETDEWEB)

Fu, Hailing, E-mail: h.fu14@imperial.ac.uk; Yeatman, Eric M. [Department of Electrical and Electronic Engineering, Imperial College London, London SW7 2AZ (United Kingdom)

2015-12-14

This paper presents the design and demonstration of a piezoelectric turbine with self-regulation for increased air speed range. The turbine's transduction is achieved by magnetic “plucking” of a piezoelectric beam by the passing rotor. The increased speed range is achieved by the self-regulating mechanism which can dynamically adjust the magnetic coupling between the magnets on the turbine rotor and the piezoelectric beam using a micro-spring. The spring is controlled passively by the centrifugal force of the magnet on the rotor. This mechanism automatically changes the relative position of the magnets at different rotational speeds, making the coupling weak at low airflow speeds and strong at high speeds. Hence, the device can start up with a low airflow speed, and the output power can be ensured when the airflow speed is high. A theoretical model was established to analyse the turbine's performance, advantages, and to optimize its design parameters. A prototype was fabricated and tested in a wind tunnel. The start-up airflow speed was 2.34 m/s, showing a 30% improvement against a harvester without the mechanism.

A miniaturized piezoelectric turbine with self-regulation for increased air speed range

International Nuclear Information System (INIS)

Fu, Hailing; Yeatman, Eric M.

2015-01-01

This paper presents the design and demonstration of a piezoelectric turbine with self-regulation for increased air speed range. The turbine's transduction is achieved by magnetic “plucking” of a piezoelectric beam by the passing rotor. The increased speed range is achieved by the self-regulating mechanism which can dynamically adjust the magnetic coupling between the magnets on the turbine rotor and the piezoelectric beam using a micro-spring. The spring is controlled passively by the centrifugal force of the magnet on the rotor. This mechanism automatically changes the relative position of the magnets at different rotational speeds, making the coupling weak at low airflow speeds and strong at high speeds. Hence, the device can start up with a low airflow speed, and the output power can be ensured when the airflow speed is high. A theoretical model was established to analyse the turbine's performance, advantages, and to optimize its design parameters. A prototype was fabricated and tested in a wind tunnel. The start-up airflow speed was 2.34 m/s, showing a 30% improvement against a harvester without the mechanism

AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

Novel fluorescence adjustable photonic crystal materials

Science.gov (United States)

Zhu, Cheng; Liu, Xiaoxia; Ni, Yaru; Fang, Jiaojiao; Fang, Liang; Lu, Chunhua; Xu, Zhongzi

2017-11-01

Novel photonic crystal materials (PCMs) with adjustable fluorescence were fabricated by distributing organic fluorescent powders of Yb0.2Er0.4Tm0.4(TTA)3Phen into the opal structures of self-assembled silica photonic crystals (PCs). Via removing the silica solution in a constant speed, PCs with controllable thicknesses and different periodic sizes were obtained on glass slides. Yb0.2Er0.4Tm0.4(TTA)3Phen powders were subsequently distributed into the opal structures. The structures and optical properties of the prepared PCMs were investigated. Finite-difference-time-domain (FDTD) calculation was used to further analyze the electric field distributions in PCs with different periodic sizes while the relation between periodic sizes and fluorescent spectra of PCMs was discussed. The results showed that the emission color of the PCMs under irradiation of 980 nm laser can be easily adjusted from green to blue by increasing the periodic size from 250 to 450 nm.

Design and synthesis of 225Ac radioimmunopharmaceuticals

International Nuclear Information System (INIS)

McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

2002-01-01

The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

To the Problem of Electromechanical Interaction in Elevators with Controlled Electric Drive and Fuzzy Speed Controller

Directory of Open Access Journals (Sweden)

A. S. Koval

2010-01-01

Full Text Available The paper considers problems concerning electromechanical interaction in elevators with an adjustable asynchronous electric drive equipped with the vector control systems under direct torque control and direct torque control with pulse-width modulator. A mathematical description of electromechanical elevator system with due account of nonlinearity of the worm gear is given in the paper. The paper presents a simplified circuit design of a control system with a fuzzy speed controller. It has been established that the factor of electromechanical interaction in electromechanical system with the adjustable asynchronous electric drive and an fuzzy speed controller is within the range which corresponds to existence of the essential electromechanical interaction.

Nuclear structure of 231Ac

International Nuclear Information System (INIS)

Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

2008-01-01

The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

International Nuclear Information System (INIS)

Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

Marketingová komunikace AC Sparta Praha

OpenAIRE

Fanta, Jan

2016-01-01

Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

Effectiveness of Motorcycle speed controlled by speed hump

Directory of Open Access Journals (Sweden)

Pornsiri Urapa

2014-09-01

Full Text Available Speed humps are one of the traffic calming measures widely accepted to control vehicle speed in the local road. Humps standards from the western countries are designed mainly for the passenger car. This study, therefore, aims to reveal the effectiveness of speed hump to control the motorcycle speed. This study observes the free-flow speed of the riders at the total of 20 speed bumps and humps. They are 0.3-14.8 meter in width and 5-18 centimeter in height. The results reveal that the 85th percentile speeds reduce 15-65 percent when crossing the speed bumps and speed humps. Besides, this study develops the speed model to predict the motorcycle mean speed and 85th percentile speed. It is found that speed humps follow the ITE standard can control motorcycle crossing speeds to be 25-30 Kph which are suitable to travel on the local road.

c-axis ac susceptibility in high-Tc superconductors

International Nuclear Information System (INIS)

Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.

1996-01-01

We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

Fast electric dipole transitions in Ra-Ac nuclei

International Nuclear Information System (INIS)

Ahmad, I.

1985-01-01

Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs

Matching optical flow to motor speed in virtual reality while running on a treadmill

Science.gov (United States)

Lafortuna, Claudio L.; Mugellini, Elena; Abou Khaled, Omar

2018-01-01

We investigated how visual and kinaesthetic/efferent information is integrated for speed perception in running. Twelve moderately trained to trained subjects ran on a treadmill at three different speeds (8, 10, 12 km/h) in front of a moving virtual scene. They were asked to match the visual speed of the scene to their running speed–i.e., treadmill’s speed. For each trial, participants indicated whether the scene was moving slower or faster than they were running. Visual speed was adjusted according to their response using a staircase until the Point of Subjective Equality (PSE) was reached, i.e., until visual and running speed were perceived as equivalent. For all three running speeds, participants systematically underestimated the visual speed relative to their actual running speed. Indeed, the speed of the visual scene had to exceed the actual running speed in order to be perceived as equivalent to the treadmill speed. The underestimation of visual speed was speed-dependent, and percentage of underestimation relative to running speed ranged from 15% at 8km/h to 31% at 12km/h. We suggest that this fact should be taken into consideration to improve the design of attractive treadmill-mediated virtual environments enhancing engagement into physical activity for healthier lifestyles and disease prevention and care. PMID:29641564

Is perception of self-motion speed a necessary condition for intercepting a moving target while walking?

Science.gov (United States)

Morice, Antoine H P; Wallet, Grégory; Montagne, Gilles

2014-04-30

While it has been shown that the Global Optic Flow Rate (GOFR) is used in the control of self-motion speed, this study examined its relevance in the control of interceptive actions while walking. We asked participants to intercept approaching targets by adjusting their walking speed in a virtual environment, and predicted that the influence of the GOFR depended on their interception strategy. Indeed, unlike the Constant Bearing Angle (CBA), the Modified Required Velocity (MRV) strategy relies on the perception of self-displacement speed. On the other hand, the CBA strategy involves specific speed adjustments depending on the curvature of the target's trajectory, whereas the MRV does not. We hypothesized that one strategy is selected among the two depending on the informational content of the environment. We thus manipulated the curvature and display of the target's trajectory, and the relationship between physical walking speed and the GOFR (through eye height manipulations). Our results showed that when the target trajectory was not displayed, walking speed profiles were affected by curvature manipulations. Otherwise, walking speed profiles were less affected by curvature manipulations and were affected by the GOFR manipulations. Taken together, these results show that the use of the GOFR for intercepting a moving target while walking depends on the informational content of the environment. Finally we discuss the complementary roles of these two perceptual-motor strategies. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Simulation of double-fed speed regulation system for 125 MVA motor-generator set

International Nuclear Information System (INIS)

Wang Fen; Wang Shujing; Li Huajun

2007-01-01

A simulation modeling of double-fed motor speed regulation for 125 MVA AC pulsed M-G set of HL-2A is built using Matlab. Some parameters of the project are obtained by the pre-simulation, and the process of start-up is analyzed. In the Matlab simulation the motor model in Simulink can not be connected directly to the cycloconverter model. This problem is solved by adding an ideal transformer model between them, and the satisfactory result is obtained. A new method of control switching two cycloconverter without circulating current has been introduced. (authors)

Advanced DC/AC inverters applications in renewable energy

CERN Document Server

Luo, Fang Lin

2013-01-01

DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

Mixture distributions of wind speed in the UAE

Science.gov (United States)

Shin, J.; Ouarda, T.; Lee, T. S.

2013-12-01

sample wind data, the adjusted coefficient of determination, Bayesian Information Criterion (BIC) and Chi-squared statistics were computed. Results indicate that MHML presents the best performance of parameter estimation for the used mixture distributions. In most of the employed 7 stations, mixture distributions give the best fit. When the wind speed regime shows mixture distributional characteristics, most of these regimes present the kurtotic statistical characteristic. Particularly, applications of mixture distributions for these stations show a significant improvement in explaining the whole wind speed regime. In addition, the Weibull-Weibull mixture distribution presents the best fit for the wind speed data in the UAE.

Nonlinear Adaptive Rotational Speed Control Design and Experiment of the Propeller of an Electric Micro Air Vehicle

Directory of Open Access Journals (Sweden)

Shouzhao Sheng

2016-01-01

Full Text Available Micro Air Vehicles (MAVs driven by electric propellers are of interest for military and civilian applications. The rotational speed control of such electric propellers is an important factor for improving the flight performance of the vehicles, such as their positioning accuracy and stability. Therefore, this paper presents a nonlinear adaptive control scheme for the electric propulsion system of a certain MAV, which can not only speed up the convergence rates of adjustable parameters, but can also ensure the overall stability of the adjustable parameters. The significant improvement of the dynamic tracking accuracy of the rotational speed can be easily achieved through the combination of the proposed control algorithm and linear control methods. The experimental test results have also demonstrated the positive effect of the nonlinear adaptive control scheme on the flight performance of the MAV.

A single-phase embedded Z-source DC-AC inverter.

Science.gov (United States)

Kim, Se-Jin; Lim, Young-Cheol

2014-01-01

In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.

Large Signal Stabilization of Hybrid AC/DC Micro-Grids Using Nonlinear Robust Controller

Directory of Open Access Journals (Sweden)

Reza Pejmanfar

2017-12-01

Full Text Available This paper presents a robust nonlinear integrated controller to improve stability of hybrid AC/DC micro-grids under islanding mode. The proposed controller includes two independent controllers where each one is responsible to control one part of the system. First controller will improve the stability of input DC/DC converter. Using this controller, the voltage of DC bus is fully stabilized such that when a large disturbance occurs, its voltage will become constant without any significant dynamic. The necessity of DC bus regulation which has not been considered in previous studies, is imminent as it not only improves voltage stability of the micro-grid but also protects consumers which are directly connected to the DC bus, against voltage variations. Frequency stability of the micro-grid is provided by the second proposed controller which is applied to output DC/AC converter of the micro-grid. Adaptive method is used to make the controllers proposed in this paper, robust. Duty cycle of converters switches are adjusted such that voltage and frequency of the micro-grid are set on the desired value in minimum possible time under transient disturbances and uncertainty of the loads as well as micro-sources characteristics.

Efficiency of particle swarm optimization applied on fuzzy logic DC motor speed control

Directory of Open Access Journals (Sweden)

Allaoua Boumediene

2008-01-01

Full Text Available This paper presents the application of Fuzzy Logic for DC motor speed control using Particle Swarm Optimization (PSO. Firstly, the controller designed according to Fuzzy Logic rules is such that the systems are fundamentally robust. Secondly, the Fuzzy Logic controller (FLC used earlier was optimized with PSO so as to obtain optimal adjustment of the membership functions only. Finally, the FLC is completely optimized by Swarm Intelligence Algorithms. Digital simulation results demonstrate that in comparison with the FLC the designed FLC-PSO speed controller obtains better dynamic behavior and superior performance of the DC motor, as well as perfect speed tracking with no overshoot.

dc Arc Fault Effect on Hybrid ac/dc Microgrid

Science.gov (United States)

Fatima, Zahra

The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

Wind speed forecasting in the South Coast of Oaxaca, Mexico

Energy Technology Data Exchange (ETDEWEB)

Cadenas, Erasmo [Facultad de Ingenieria Mecanica, Universidad Michoacana de San Nicolas de Hidalgo, Santiago Tapia No. 403, Centro (Mexico); Rivera, Wilfrido [Centro de Investigacion en Energia of the Universidad Nacional Autonoma de Mexico (UNAM), Apartado Postal 34, Temixco 62580, Morelos (Mexico)

2007-10-15

Comparison of two techniques for wind speed forecasting in the South Coast of the state of Oaxaca, Mexico is presented in this paper. The Autoregressive Integrated Moving Average (ARIMA) and the Artificial Neural Networks (ANN) methods are applied to a time series conformed by 7 years of wind speed measurements. Six years were used in the formulation of the models and the last year was used to validate and compare the effectiveness of the generated prediction by the techniques mentioned above. Seasonal ARIMA models present a better sensitivity to the adjustment and prediction of the wind speed for this case in particular. Nevertheless, it was shown both developed models can be used to predict in a reasonable way, the monthly electricity production of the wind power stations in La Venta, Oaxaca, Mexico to support the operators of the Electric Utility Control Centre. (author)

Blurring emotional memories using eye movements: individual differences and speed of eye movements

Directory of Open Access Journals (Sweden)

Kevin van Schie

2016-07-01

Full Text Available Background: In eye movement desensitization and reprocessing (EMDR, patients make eye movements (EM while recalling traumatic memories. Making EM taxes working memory (WM, which leaves less resources available for imagery of the memory. This reduces memory vividness and emotionality during future recalls. WM theory predicts that individuals with small working memory capacities (WMCs benefit more from low levels of taxing (i.e., slow EM whereas individuals with large WMC benefit more from high levels of taxing (i.e., fast EM. Objective: We experimentally examined and tested four prespecified hypotheses regarding the role of WMC and EM speed in reducing emotionality and vividness ratings: 1 EM—regardless of WMC and EM speed—are more effective compared to no dual task, 2 increasing EM speed only affects the decrease in memory ratings irrespective of WMC, 3 low-WMC individuals—compared to high-WMC individuals—benefit more from making either type of EM, 4 the EM intervention is most effective when—as predicted by WM theory—EM are adjusted to WMC. Method: Undergraduates with low (n=31 or high (n=35 WMC recalled three emotional memories and rated vividness and emotionality before and after each condition (recall only, recall + slow EM, and recall + fast EM. Results: Contrary to the theory, the data do not support the hypothesis that EM speed should be adjusted to WMC (hypothesis 4. However, the data show that a dual task in general is more effective in reducing memory ratings than no dual task (hypothesis 1, and that a more cognitively demanding dual task increases the intervention's effectiveness (hypothesis 2. Conclusions: Although adjusting EM speed to an individual's WMC seems a straightforward clinical implication, the data do not show any indication that such a titration is helpful.

Research on the Inductance/Capacitance Switch Model for an LCC-HVDC Converter in an AC/DC Hybrid Grid

Directory of Open Access Journals (Sweden)

Yangyang He

2018-03-01

Full Text Available In order to improve the simulation speed of the AC/DC hybrid grid, the inductance/capacitance (L/C switch model for line-commutated converter of high-voltage direct current (LCC-HVDC is presented in this study. The time domain modeling method is used to analyze the circuit of L/C switch model for the six-pulse system in LCC-HVDC in a switching period. A parameter setting method of L/C switch model is proposed considering the transient response, the steady state performance, switching losses and simulation error of the switch. The inductance/capacitance (L/C switch model for LCC-HVDC has the advantage of keeping the admittance matrix unchanged regardless of the change of switching state, which improves the simulation efficiency. Finally, the validity of the parameter setting method is verified. Compared with the test results of PSCAD/EMTDC, the accuracy of the proposed LCC-HVDC simulation model is proved. The model is suitable for real-time or offline simulation of AC/DC hybrid grid.

Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.

Science.gov (United States)

Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong

2018-05-01

Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.

Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

Science.gov (United States)

Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

2015-10-01

Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

International Nuclear Information System (INIS)

García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.

2016-01-01

The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.

Using SHRP 2 naturalistic driving data to assess drivers' speed choice while being engaged in different secondary tasks.

Science.gov (United States)

Schneidereit, Tina; Petzoldt, Tibor; Keinath, Andreas; Krems, Josef F

2017-09-01

The engagement in secondary tasks while driving has been found to result in considerable impairments of driving performance. Texting has especially been suspected to be associated with an increased crash risk. At the same time, there is evidence that drivers use various self-regulating strategies to compensate for the increased demands caused by secondary task engagement. One of the findings reported from multiple studies is a reduction in driving speed. However, most of these studies are of experimental nature and do not let the drivers decide for themselves to (not) engage in the secondary task, and therefore, eliminate other strategies of self-regulation (e.g., postponing the task). The goal of the present analysis was to investigate if secondary task engagement results in speed adjustment also under naturalistic conditions. Our analysis relied on data of the SHRP 2 naturalistic driving study. To minimize the influence of potentially confounding factors on drivers' speed choice, we focused on episodes of free flow driving on interstates/highways. Driving speed was analyzed before, during, and after texting, smoking, eating, and adjusting/monitoring radio or climate control; in a total of 403 episodes. Data show some indication for speed adjustment for texting, especially when driving with high speed. However, the effect sizes were small and behavioral patterns varied considerably between drivers. The engagement in the other tasks did not influence drivers' speed behavior significantly. While drivers might indeed reduce speed slightly to accommodate for secondary task engagement, other forms of adaptation (e.g., strategic decisions) might play a more important role in a natural driving environment. The use of naturalistic driving data to study drivers' self-regulatory behavior at an operational level has proven to be promising. Still, in order to obtain a comprehensive understanding about drivers' self-regulatory behavior, a mixed-method approach is required

Superconducting three element synchronous ac machine

International Nuclear Information System (INIS)

Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

1975-01-01

There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

Empirical evidence for resource-rational anchoring and adjustment.

Science.gov (United States)

Lieder, Falk; Griffiths, Thomas L; M Huys, Quentin J; Goodman, Noah D

2018-04-01

People's estimates of numerical quantities are systematically biased towards their initial guess. This anchoring bias is usually interpreted as sign of human irrationality, but it has recently been suggested that the anchoring bias instead results from people's rational use of their finite time and limited cognitive resources. If this were true, then adjustment should decrease with the relative cost of time. To test this hypothesis, we designed a new numerical estimation paradigm that controls people's knowledge and varies the cost of time and error independently while allowing people to invest as much or as little time and effort into refining their estimate as they wish. Two experiments confirmed the prediction that adjustment decreases with time cost but increases with error cost regardless of whether the anchor was self-generated or provided. These results support the hypothesis that people rationally adapt their number of adjustments to achieve a near-optimal speed-accuracy tradeoff. This suggests that the anchoring bias might be a signature of the rational use of finite time and limited cognitive resources rather than a sign of human irrationality.

Optimal swimming speed in head currents and effects on distance movement of winter-migrating fish

DEFF Research Database (Denmark)

Brodersen, J.; Nilsson, P.A.; Ammitzbøl, J.

2008-01-01

ecologically and economically important. We here use passive and active telemetry to study how winter migrating roach regulate swimming speed and distance travelled per day in response to variations in head current velocity. Furthermore, we provide theoretical predictions on optimal swimming speeds in head...... currents and relate these to our empirical results. We show that fish migrate farther on days with low current velocity, but travel at a greater ground speed on days with high current velocity. The latter result agrees with our predictions on optimal swimming speed in head currents, but disagrees...... with previously reported predictions suggesting that fish ground speed should not change with head current velocity. We suggest that this difference is due to different assumptions on fish swimming energetics. We conclude that fish are able to adjust both swimming speed and timing of swimming activity during...

Nontrivial ac spin response in the effective Luttinger model

International Nuclear Information System (INIS)

Hu Liangbin; Zhong Jiansong; Hu Kaige

2006-01-01

Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before

Socioeconomic disparities in gait speed and associated characteristics in early old age.

Science.gov (United States)

Plouvier, S; Carton, M; Cyr, D; Sabia, S; Leclerc, A; Zins, M; Descatha, A

2016-04-23

A few studies have documented associations between socioeconomic position and gait speed, but the knowledge about factors from various domains (personal factors, lifestyle, occupation…) which contribute to these disparities is limited. Our objective was to assess socioeconomic disparities in usual gait speed in a general population in early old age in France, and to identify potential contributors to the observed disparities, including occupational factors. The study population comprised 397 men and 339 women, aged 55 to 69, recruited throughout France for the field pilot of the CONSTANCES cohort. Gait speed was measured in meters/second. Socioeconomic position was based on self-reported occupational class. Information on personal characteristics, lifestyle, comorbidities and past or current occupational physical exposure came either from the health examination, from interview or from self-administered questionnaire. Four groups were considered according to sex-specific distributions of speed (the two slowest thirds versus the fastest third, for each gender). Logistic regression models adjusted for health screening center and age allowed to the study of cross-sectional associations between: 1- slower speed and occupational class; 2- slower speed and each potential contributor; 3- occupational class and selected potential contributors. The association between speed and occupational class was then further adjusted for the factors significantly associated both with speed and occupational class, in order to assess the potential contribution of these factors to disparities. With reference to managers/executives, gait speed was reduced in less skilled categories among men (OR 1.21 [0.72-2.05] for Intermediate/Tradesmen, 1.95 [0.80-4.76] for Clerks, Sale/service workers, 2.09 [1.14-3.82] for Blue collar/Craftsmen) and among women (OR 1.12 [0.55-2.28] for Intermediate/Tradesmen, 2.33 [1.09-4.97] for Clerks, 2.48 [1.18-5.24] for Sale/service workers/Blue collar

7 CFR 1737.31 - Area Coverage Survey (ACS).

Science.gov (United States)

2010-01-01

... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...

A Dynamic Consensus Algorithm to Adjust Virtual Impedance Loops for Discharge Rate Balancing of AC Microgrid Energy Storage Units

DEFF Research Database (Denmark)

Guan, Yajuan; Meng, Lexuan; Li, Chendan

2018-01-01

A dynamic consensus algorithm (DCA)-based coordinated secondary control with an autonomous current-sharing control strategy is proposed in this paper for balancing the discharge rate of energy storage systems (ESSs) in an islanded AC microgrid. The DCA is applied for information sharing between......, the proposed approach can provide higher system reliability, expandability, and flexibility due to its distributed control architecture. The proposed controller can effectively prevent operation failure caused by over-current and unintentional outage of DGs by means of balanced discharge rate control. It can...... also provide fast response and accurate current sharing performance. A generalizable linearized state-space model for n-DG network in the z-domain is also derived and proposed in this paper; the model includes electrical, controller, and communication parts. The system stability and parameter...

Estimating the Contribution of Industry Structure Adjustment to the Carbon Intensity Target: A Case of Guangdong

Directory of Open Access Journals (Sweden)

Ping Wang

2016-04-01

Full Text Available Industry structure adjustment is an effective measure to achieve the carbon intensity target of Guangdong Province. Accurately evaluating the contribution of industry structure adjustment to the carbon intensity target is helpful for the government to implement more flexible and effective policies and measures for CO2 emissions reduction. In this paper, we attempt to evaluate the contribution of industry structure adjustment to the carbon intensity target. Firstly, we predict the gross domestic product (GDP with scenario forecasting, industry structure with the Markov chain model, CO2 emissions with a novel correlation mode based on least squares support vector machine, and then we assess the contribution of industry structure adjustment to the carbon intensity target of Guangdong during the period of 2011–2015 under nine scenarios. The obtained results show, in the ideal scenario, that the economy will grow at a high speed and the industry structure will be significantly adjusted, and thus the carbon intensity in 2015 will decrease by 25.53% compared to that in 2010, which will make a 130.94% contribution to the carbon intensity target. Meanwhile, in the conservative scenario, the economy will grow at a low speed and the industry structure will be slightly adjusted, and thus the carbon intensity in 2015 will decrease by 23.89% compared to that in 2010, which will make a 122.50% contribution to the carbon intensity target.

High speed elevator s rise high rise building; Chokoso biru wo kakenoboru elevator

Energy Technology Data Exchange (ETDEWEB)

Tanabe, K. [Mitsubishi Electric Corp., Tokyo (Japan)

1994-10-20

The world`s fastest (750 m/min) elevators are operating in Yokohama Landmark Tower. This paper describes how engineers solved the technological problems to realize the high-speed elevator. Buildings in Japan have become higher and higher. At the present, this Tower is the highest in Japan (296 m, 70 stories). The Ministry of Construction is going to start a research team to study construction of buildings of the order of 1,000 m high. An important issue for a skyscraper is how to reduce the elevator space adapting to the increase of the number of inhabitants in the building. The basic solution is to increase the elevator speed and to plan the best elevator moving line. The 120 kW AC motor direct-driven winding machine that withstands the superhigh-speed suspending load was developed. Vibrations from the motor and the mechanical system are minimized and the touch-down tolerances for the elevator cage are controlled to {plus_minus}15 mm. The safety devices of the elevator include the emergency stopper of special ceramic material and the hydraulic shock absorber with the optimum reduction characteristic. 2 refs., 3 figs.

Importance of Attenuation Correction (AC) for Small Animal PET Imaging

DEFF Research Database (Denmark)

El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

2012-01-01

was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

THE ACS NEARBY GALAXY SURVEY TREASURY

International Nuclear Information System (INIS)

Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

2009-01-01

The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

Predicting AC loss in practical superconductors

International Nuclear Information System (INIS)

Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

2006-01-01

Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

Scaling and universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Schrøder, Thomas; Dyre, Jeppe

2000-01-01

Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

Tomato leaf curl Kerala virus (ToLCKeV AC3 protein forms a higher order oligomer and enhances ATPase activity of replication initiator protein (Rep/AC1

Directory of Open Access Journals (Sweden)

Mukherjee Sunil K

2010-06-01

Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.

Preliminary study on AC superconducting machines

International Nuclear Information System (INIS)

Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

1988-01-01

This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

21 CFR 880.5500 - AC-powered patient lift.

Science.gov (United States)

2010-04-01

...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

Speed-related spinal excitation from ankle dorsiflexors to knee extensors during human walking

DEFF Research Database (Denmark)

Iglesias, Caroline; Nielsen, Jens Bo; Marchand-Pauvert, Véronique

2008-01-01

Automatic adjustments of muscle activity throughout the body are required for the maintenance of balance during human walking. One mechanism that is likely to contribute to this control is the heteronymous spinal excitation between human ankle dorsiflexors and knee extensors (CPQ-reflex). Here, we...... investigated the CPQ-reflex at different walking speeds (1-6 km/h) and stride frequencies (0.6-1.3 Hz) in healthy human subjects to provide further evidence of its modulation, and its role in ensuring postural stability during walking. The CPQ-reflex was small or absent at walking speeds below 2-3 km....../h, then increased with walking speeds about 3-4 km/h, and reached a plateau without any further change at walking speeds from 4 to 6 km/h. The reflex showed no modulation when the stride cycle was varied at constant speed (4 km/h; short steps versus long steps). These changes were unlikely to be only caused...

Cooperative Frequency Control for Autonomous AC Microgrids

DEFF Research Database (Denmark)

Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

2015-01-01

Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

Diagnostics of the Fermilab Tevatron using an AC dipole

Energy Technology Data Exchange (ETDEWEB)

Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

2008-08-01

The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

Acoustic grating fringe projector for high-speed and high-precision three-dimensional shape measurements

International Nuclear Information System (INIS)

Yin Xuebing; Zhao Huijie; Zeng Junyu; Qu Yufu

2007-01-01

A new acoustic grating fringe projector (AGFP) was developed for high-speed and high-precision 3D measurement. A new acoustic grating fringe projection theory is also proposed to describe the optical system. The AGFP instrument can adjust the spatial phase and period of fringes with unprecedented speed and accuracy. Using rf power proportional-integral-derivative (PID) control and CCD synchronous control, we obtain fringes with fine sinusoidal characteristics and realize high-speed acquisition of image data. Using the device, we obtained a precise phase map for a 3D profile. In addition, the AGFP can work in running fringe mode, which could be applied in other measurement fields

Multi-Agent-Based Controller for Voltage Enhancement in AC/DC Hybrid Microgrid Using Energy Storages

Directory of Open Access Journals (Sweden)

Ahmadali Khatibzadeh

2017-02-01

Full Text Available Development of renewable energies and DC loads have led microgrids toward the creation of DC networks. The predictions show that the hybrid microgrids will be used widely in the future. This article has studied the voltage stability in the presence of sources of energy storage in AC/DC hybrid networks. However, because the different dynamics of hybrid networks applying centralized and distributed controllers will be faced with different problems, in this study, a multi-agent control for the microgrid has been used. A new structure referred to here as an event-driven microgrid control management (EDMCM has been developed to control the microgrid. This method increases response speed and accuracy of decision making. Hybrid Network Simulation results confirm the validity of the developed model.

Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

DEFF Research Database (Denmark)

Qin, Zian

. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

AC power flow importance measures considering multi-element failures

International Nuclear Information System (INIS)

Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

2017-01-01

Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

Safe Speeds and Credible Speed Limits (SaCredSpeed): New Vision for Decision Making on Speed Management.

NARCIS (Netherlands)

Aarts, L. Nes, N. van Wegman, F.C.M. Schagen, I.N.L.G. van & Louwerse, R.

2009-01-01

Speed is an inherent characteristic of mobility and a hazard to safety. Several approaches exist of how to manage speed. In the Netherlands, the emphasis has mainly been on harm minimisation during the last decades, due to the implementation of the Sustainable Safety vision. Speed management remains

Measurement of Anisotropic Particle Interactions with Nonuniform ac Electric Fields.

Science.gov (United States)

Rupp, Bradley; Torres-Díaz, Isaac; Hua, Xiaoqing; Bevan, Michael A

2018-02-20

Optical microscopy measurements are reported for single anisotropic polymer particles interacting with nonuniform ac electric fields. The present study is limited to conditions where gravity confines particles with their long axis parallel to the substrate such that particles can be treated using quasi-2D analysis. Field parameters are investigated that result in particles residing at either electric field maxima or minima and with long axes oriented either parallel or perpendicular to the electric field direction. By nonintrusively observing thermally sampled positions and orientations at different field frequencies and amplitudes, a Boltzmann inversion of the time-averaged probability of states yields kT-scale energy landscapes (including dipole-field, particle-substrate, and gravitational potentials). The measured energy landscapes show agreement with theoretical potentials using particle conductivity as the sole adjustable material property. Understanding anisotropic particle-field energy landscapes vs field parameters enables quantitative control of local forces and torques on single anisotropic particles to manipulate their position and orientation within nonuniform fields.

Comparing Ns-DBD vs Ac-DBD plasma actuation mechanisms on a NACA 0012 airfoil

Science.gov (United States)

Singh, Ashish; Durasiewicz, Claudia; Little, Jesse

2017-11-01

A NACA 0012 airfoil is used to study ns-DBD and ac-DBD plasma actuators at a Reynolds number of 740,000 (U∞=40 m/s). Ns-DBD plasma actuators are hypothesized to work on the principle of joule heating whereas ac-DBD actuators add momentum to the flow. Short duration forcing at a time scale much smaller than the convective time based on model chord is employed to study the control mechanism and flow field response. 2-D PIV carried out over a convective time range of 0-10 is used to study the flow structure. The results show the breakup of shear layer vorticity at the point of actuation followed by reattachment to the suction side of the airfoil and finally stall again. These events are very similar between the two actuators and indicate a similar flow response to different perturbation types. The pulse energies are varied and the response shows little change. The results are compared to other transitory separation control studies using more conventional actuators. The detailed study of these two control mechanisms with the separated flow over an airfoil helps to shed light on the evolution of the flow control process. Additional results on a simplified model problem (low speed mixing layer) are included to provide context. Supported by U.S. Army Research Office (W911NF-14-1-0662).

Systémový pohled na klub AC Sparta

OpenAIRE

Čečák, František

2015-01-01

Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

Energy Technology Data Exchange (ETDEWEB)

Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

1991-04-30

This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

Aragonite coating solutions (ACS) based on artificial seawater

Science.gov (United States)

Tas, A. Cuneyt

2015-03-01

Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

Energy Technology Data Exchange (ETDEWEB)

McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

2002-12-01

The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

Factors associated with maximal walking speed among older community-living adults

DEFF Research Database (Denmark)

Sallinen, Janne; Mänty, Minna; Leinonen, Raija

2011-01-01

explained to 38%. Further adjusting for physical activity, smoking status and use of alcohol increased the variation explained by additional 7%. A minor further increase in variability explained was gained by adding chronic diseases and depressive symptoms in the model. In the final model, the single most...... 07330512) involving 605 community-living ambulatory adults aged 75-81 years. Maximal walking speed, leg extensor power, standing balance and body mass index were measured at the research center. Physical activity, smoking, use of alcohol, chronic diseases and depressive symptoms were self-reported using...... standard questionnaires. Results: The mean maximal walking speed was 1.4 m/s (range 0.3-2.9). In linear regression analysis, age, gender and body mass index explained 11% of the variation in maximal walking speed. Adding leg extensor power and standing balance into the model increased the variation...

Systémový pohled na klub AC Sparta

OpenAIRE

Čečák, František

2014-01-01

Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

Evaluation of adjustment functions in a heuristic algorithm; Evaluacion de funciones de ajuste en un algoritmo heuristico

Energy Technology Data Exchange (ETDEWEB)

Perusquia del Cueto, R.; Montes T, J. L.; Ortiz S, J. J.; Castillo M, A., E-mail: raul.perusquia@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

2011-11-15

At present the techniques of evolution al computation receive an increasing attention in the scientific and technological areas. This situation is due to its enormous potential in the optimization applied to problems of discussed computational complexity. In the nuclear area these techniques are used in diverse problems of combinatory optimization related with designing cores of power reactors. A distinctive characteristic of the evolution al and/or meta-heuristic algorithms is that appeal in each one from their applications to an adjustment function, fitness or of quality. This function allows to discriminate or to evaluate potentials solutions of the problem to solve. The definition of this situation is very important since it allows following the search of the algorithm toward different regions of the search space. In this work the impact that has the election of this function in the quality of the found solution is shown. The optimization technique by ant colonies or Acs (ant colony system) was used applied to the radial design of fuel cells for a boiling water power reactor. The notable results of the Acs allowed to propose the adjustment method of the importance and with this to obtain adjustment functions that guide the search of solutions of collective algorithms efficiently, basic capacity to develop the proposal of emulation of the natural selection and to investigate the possibility that on order of specify goals, to obtain the corresponding decision variables. A variety of re tro-exit (re tro-out) complementary process of feedback (re tro-in) that opens extended application perspectives of be feasible. (Author)

Cooperative control of VSC-HVDC connected offshore wind farm with Low-Voltage Ride-Through capability

DEFF Research Database (Denmark)

Liu, Yan; Wang, Xiongfei; Chen, Zhe

2012-01-01

The Low-Voltage Ride-Through (LVRT) has become an important grid requirement for offshore wind farms connecting with Voltage Source Converter based High Voltage Direct Current (VSC-HVDC) links. In this paper, a cooperative control strategy with LVRT ability is proposed for a VSC-HVDC connected...... variable speed Squirrel-Cage Induction Generator (SCIG) wind farm. The approach employs a DC-link voltage versus offshore AC-bus frequency droop control on the offshore converter of VSC-HVDC link. Thus, the back-to-back converters of SCIG wind turbines can adjust the generated active power based on the AC......-bus frequency deviations, so that a fast power reduction on the wind farm side can be achieved. The EMTDC/PSCAD simulations are performed on a 300 MW offshore variable speed SCIG wind farm. Simulation results confirm the effectiveness of the proposed control method....

Mapa acústico parcial de Benetusser

OpenAIRE

MORILLA CASTELLANOS, EMILIO

2012-01-01

Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

Improving speed behaviour : the potential of in-car speed assistance and speed limit credibility.

NARCIS (Netherlands)

Nes, C.N. van Houtenbos, M. & Schagen, I.N.L.G. van

2009-01-01

Speeding is still a common practice on many roads and it contributes to a significant number of crashes. Two new approaches to solve speeding issues are focused on: intelligent speed assistance systems (ISA) and speed limit credibility. Research has indicated that ISA is promising with respect to

Six switches solution for single-phase AC/DC/AC converter with capability of second-order power mitigation in DC-link capacitor

DEFF Research Database (Denmark)

Liu, Xiong; Wang, Peng; Loh, Poh Chiang

2011-01-01

This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...

Dual stator winding variable speed asynchronous generator: optimal design and experiments

International Nuclear Information System (INIS)

Tutelea, L N; Deaconu, S I; Popa, G N

2015-01-01

In the present paper is carried out a theoretical and experimental study of dual stator winding squirrel cage asynchronous generator (DSWA) behavior in the presence of saturation regime (non-sinusoidal) due to the variable speed operation. The main aims are the determination of the relations of calculating the equivalent parameters of the machine windings to optimal design using a Matlab code. Issue is limited to three phase range of double stator winding cage-induction generator of small sized powers, the most currently used in the small adjustable speed wind or hydro power plants. The tests were carried out using three-phase asynchronous generator having rated power of 6 [kVA]. (paper)

AC conductivity of a quantum Hall line junction

International Nuclear Information System (INIS)

Agarwal, Amit; Sen, Diptiman

2009-01-01

We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.

Mass of AC Andromedae

International Nuclear Information System (INIS)

King, D.S.; Cox, A.N.; Hodson, S.W.

1975-01-01

Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)

ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus

International Nuclear Information System (INIS)

Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi

2007-01-01

orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae

Probable alpha and 14C cluster emission from hyper Ac nuclei

International Nuclear Information System (INIS)

Santhosh, K.P.

2013-01-01

A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)

Detection of Genetic Modification 'ac2' in Potato Foodstuffs

Directory of Open Access Journals (Sweden)

Petr Kralik

2009-01-01

Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

Arthroscopically Assisted Reconstruction of Acute Acromioclavicular Joint Dislocations: Anatomic AC Ligament Reconstruction With Protective Internal Bracing—The “AC-RecoBridge” Technique

Science.gov (United States)

Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk

2015-01-01

An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493

Speed

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. Speed. The rate of information transferred per second is the speed of the information. Measured in bits per second. Need for speed on the net: You-Tube phenomenon; IPTV; 3D Video telephony. Online gaming; HDTV.

Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

Indian Academy of Sciences (India)

SHARIF F ZAMAN

the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.

Callosal tissue loss parallels subtle decline in psychomotor speed. A longitudinal quantitative MRI study. The LADIS Study

DEFF Research Database (Denmark)

Jokinen, Hanna; Frederiksen, Kristian S; Garde, Ellen

2012-01-01

in a compound measure of cognitive speed and motor control, but not in those of executive functions, memory, or global cognitive function. Total CC area and midbody remained significant predictors of speed also after adjusting for baseline WML volume, WML progression, and global brain atrophy. However......, the relationship between anterior CC and speed performance was mediated by WML volume. In conclusion, the overall and regional rate of CC tissue loss parallels longitudinal slowing of psychomotor performance. The adverse effect of CC tissue loss on psychomotor function may be driven by altered interhemispheric...

Plasma antennas driven by 5–20 kHz AC power supply

Energy Technology Data Exchange (ETDEWEB)

Zhao, Jiansen, E-mail: 67093058@qq.com; Chen, Yuli; Sun, Yang; Wu, Huafeng; Liu, Yue; Yuan, Qiumeng [Merchant Marine College, Shanghai Maritime University, Shanghai, 201306 (China)

2015-12-15

The experiments described in this work were performed with the aim of introducing a new plasma antenna that was excited by a 5–20 kHz alternating current (AC) power supply, where the antenna was transformed into a U-shape. The results show that the impedance, voltage standing-wave ratio (VSWR), radiation pattern and gain characteristics of the antenna can be controlled rapidly by varying not only the discharge power, but also by varying the discharge frequency in the range from 5 to 20 kHz. When the discharge frequency is adjusted from 10 to 12 kHz, the gain is higher within a relatively broad frequency band and the switch-on time is less than 1 ms when the discharge power is less than 5 W, meaning that the plasma antenna can be turned on and off rapidly.

Estimation of the Thurstonian model for the 2-AC protocol

DEFF Research Database (Denmark)

Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

2012-01-01

. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...

System and method for determining stator winding resistance in an AC motor

Science.gov (United States)

Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI

2011-05-31

A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.

Lamin A/C might be involved in the EMT signalling pathway.

Science.gov (United States)

Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu

2018-07-15

We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.

Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

DEFF Research Database (Denmark)

Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

2013-01-01

sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...

Measured displacement coefficients of an adjustable hydrodynamic journal rotor bearing

OpenAIRE

Martin, J. K.

2013-01-01

In simulating a proposed machine tool grinding wheel design, a bearing system comprised a stationary spindle or shaft with fluid film bearings supporting a belt driven rotor. Two hydrodynamic bearings acted in parallel, and built into the shaft were the means to effect continuous pro-active adjustments to their performance characteristics during operation, irrespective of load, speed and other running conditions. The design is outlined, as is a specially constructed test rig for evaluating it...

Experimental enhancement of fuzzy fractional order PI+I controller of grid connected variable speed wind energy conversion system

International Nuclear Information System (INIS)

Beddar, Antar; Bouzekri, Hacene; Babes, Badreddine; Afghoul, Hamza

2016-01-01

Highlights: • Fuzzy fractional order PI+I for wind energy conversion system is developed. • Investigation of the control methods performances under wind and load variations. • PSO algorithm with frequency method are used for parameters tuning. • Experimental results are presented. - Abstract: In this paper, fuzzy fractional order PI+I (FFOPI+I) controller for grid connected Variable Speed Wind Energy Conversion System (VS-WECS) is proposed. The FFOPI+I controller is applied to control a Permanent Magnet Synchronous Generator (PMSG) connected to the grid and nonlinear load through a back-to-back AC-DC-AC PWM converter. The control strategy of the Machine Side Converter (MSC) aims, at first, to extract a maximum power under fluctuating wind speed. Then, the Grid Side Converter (GSC) is controlled to improve the power quality and ensure sinusoidal current in the grid side. The FFOPI+I controller implements a Fuzzy Logic Controller (FLC) in parallel with Fractional Order PI (FOPI) and conventional PI controllers by having a commune proportional gain. The FLC changes the integral gains at runtime. The initial parameters of the FFOPI+I controller were calculated using a frequency method to create a search space then the PSO algorithm is used to select the optimal parameters. To evaluate the performance of the proposed controller in steady and transient states, an experimental test bench has been built in laboratory using dSPACE1104 card. The experimental results demonstrate the effectiveness and feasibility of the FFOPI+I over FOPI and conventional PI controllers by realizing maximum power extraction and improving the grid-side power factor for a wide range of wind speed.

Speed, speed variation and crash relationships for urban arterials.

Science.gov (United States)

Wang, Xuesong; Zhou, Qingya; Quddus, Mohammed; Fan, Tianxiang; Fang, Shou'en

2018-04-01

Speed and speed variation are closely associated with traffic safety. There is, however, a dearth of research on this subject for the case of urban arterials in general, and in the context of developing nations. In downtown Shanghai, the traffic conditions in each direction are very different by time of day, and speed characteristics during peak hours are also greatly different from those during off-peak hours. Considering that traffic demand changes with time and in different directions, arterials in this study were divided into one-way segments by the direction of flow, and time of day was differentiated and controlled for. In terms of data collection, traditional fixed-based methods have been widely used in previous studies, but they fail to capture the spatio-temporal distributions of speed along a road. A new approach is introduced to estimate speed variation by integrating spatio-temporal speed fluctuation of a single vehicle with speed differences between vehicles using taxi-based high frequency GPS data. With this approach, this paper aims to comprehensively establish a relationship between mean speed, speed variation and traffic crashes for the purpose of formulating effective speed management measures, specifically using an urban dataset. From a total of 234 one-way road segments from eight arterials in Shanghai, mean speed, speed variation, geometric design features, traffic volume, and crash data were collected. Because the safety effects of mean speed and speed variation may vary at different segment lengths, arterials with similar signal spacing density were grouped together. To account for potential correlations among these segments, a hierarchical Poisson log-normal model with random effects was developed. Results show that a 1% increase in mean speed on urban arterials was associated with a 0.7% increase in total crashes, and larger speed variation was also associated with increased crash frequency. Copyright © 2018 Elsevier Ltd. All rights

The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology

Directory of Open Access Journals (Sweden)

Anja Pahor

2018-01-01

Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.

AC power losses in Bi-2223/Ag HTS tapes

International Nuclear Information System (INIS)

Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.

1998-01-01

Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

Nuclear structure of {sup 231}Ac

Energy Technology Data Exchange (ETDEWEB)

Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

2008-10-15

The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

Statistical time lags in ac discharges

International Nuclear Information System (INIS)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F

2011-01-01

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Statistical time lags in ac discharges

Energy Technology Data Exchange (ETDEWEB)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

2011-04-06

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Machinability of lithium disilicate glass ceramic in in vitro dental diamond bur adjusting process.

Science.gov (United States)

Song, Xiao-Fei; Ren, Hai-Tao; Yin, Ling

2016-01-01

Esthetic high-strength lithium disilicate glass ceramics (LDGC) are used for monolithic crowns and bridges produced in dental CAD/CAM and oral adjusting processes, which machinability affects the restorative quality. A machinability study has been made in the simulated oral clinical machining of LDGC with a dental handpiece and diamond burs, regarding the diamond tool wear and chip control, machining forces and energy, surface finish and integrity. Machining forces, speeds and energy in in vitro dental adjusting of LDGC were measured by a high-speed data acquisition and force sensor system. Machined LDGC surfaces were assessed using three-dimensional non-contact chromatic confocal optical profilometry and scanning electron microscopy (SEM). Diamond bur morphology and LDGC chip shapes were also examined using SEM. Minimum tool wear but significant LDGC chip accumulations were found. Machining forces and energy significantly depended on machining conditions (pceramics (pceramics (pceramics. Surface roughness for machined LDGC was comparable for other glass ceramics. The removal mechanisms of LDGC were dominated by penetration-induced brittle fracture and shear-induced plastic deformation. Unlike most other glass ceramics, distinct intergranular and transgranular fractures of lithium disilicate crystals were found in LDGC. This research provides the fundamental data for dental clinicians on the machinability of LDGC in intraoral adjustments. Copyright © 2015 Elsevier Ltd. All rights reserved.

High-speed two-frame gated camera for parameters measurement of Dragon-Ⅰ LIA

International Nuclear Information System (INIS)

Jiang Xiaoguo; Wang Yuan; Zhang Kaizhi; Shi Jinshui; Deng Jianjun; Li Jin

2012-01-01

The time-resolved measurement system which can work at very high speed is necessary in electron beam parameter diagnosis for Dragon-Ⅰ linear induction accelerator (LIA). A two-frame gated camera system has been developed and put into operation. The camera system adopts the optical principle of splitting the imaging light beam into two parts in the imaging space of a lens with long focus length. It includes lens coupled gated image intensifier, CCD camera, high speed shutter trigger device based on large scale field programmable gate array. The minimum exposure time for each image is about 3 ns, and the interval time between two images can be adjusted with a step of about 0.5 ns. The exposure time and the interval time can be independently adjusted and can reach about 1 s. The camera system features good linearity, good response uniformity, equivalent background illumination (EBI) as low as about 5 electrons per pixel per second, large adjustment range of sensitivity, and excel- lent flexibility and adaptability in applications. The camera system can capture two frame images at one time with the image size of 1024 x 1024. It meets the requirements of measurement for Dragon-Ⅰ LIA. (authors)

Analysis and design of a speed and position system for maglev vehicles.

Science.gov (United States)

Dai, Chunhui; Dou, Fengshan; Song, Xianglei; Long, Zhiqiang

2012-01-01

This paper mainly researches one method of speed and location detection for maglev vehicles. As the maglev train doesn't have any physical contact with the rails, it has to use non-contact measuring methods. The technology based on the inductive loop-cable could fulfill the requirement by using an on-board antenna which could detect the alternating magnetic field produced by the loop-cable on rails. This paper introduces the structure of a speed and position system, and analyses the electromagnetic field produced by the loop-cable. The equivalent model of the loop-cable is given and the most suitable component of the magnetic flux density is selected. Then the paper also compares the alternating current (AC) resistance and the quality factor between two kinds of coils which the antenna is composed of. The effect of the rails to the signal receiving is also researched and then the structure of the coils is improved. Finally, considering the common-mode interference, 8-word coils are designed and analyzed.

Analysis and Design of a Speed and Position System for Maglev Vehicles

Directory of Open Access Journals (Sweden)

Zhiqiang Long

2012-06-01

Full Text Available This paper mainly researches one method of speed and location detection for maglev vehicles. As the maglev train doesn’t have any physical contact with the rails, it has to use non-contact measuring methods. The technology based on the inductive loop-cable could fulfill the requirement by using an on-board antenna which could detect the alternating magnetic field produced by the loop-cable on rails. This paper introduces the structure of a speed and position system, and analyses the electromagnetic field produced by the loop-cable. The equivalent model of the loop-cable is given and the most suitable component of the magnetic flux density is selected. Then the paper also compares the alternating current (AC resistance and the quality factor between two kinds of coils which the antenna is composed of. The effect of the rails to the signal receiving is also researched and then the structure of the coils is improved. Finally, considering the common-mode interference, 8-word coils are designed and analyzed.

Study on AC loss measurements of HTS power cable for standardizing

Science.gov (United States)

Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi

2017-09-01

High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..

The Relationship between Processing Speed and Regional White Matter Volume in Healthy Young People.

Directory of Open Access Journals (Sweden)

Daniele Magistro

Full Text Available Processing speed is considered a key cognitive resource and it has a crucial role in all types of cognitive performance. Some researchers have hypothesised the importance of white matter integrity in the brain for processing speed; however, the relationship at the whole-brain level between white matter volume (WMV and processing speed relevant to the modality or problem used in the task has never been clearly evaluated in healthy people. In this study, we used various tests of processing speed and Voxel-Based Morphometry (VBM analyses, it is involves a voxel-wise comparison of the local volume of gray and white, to assess the relationship between processing speed and regional WMV (rWMV. We examined the association between processing speed and WMV in 887 healthy young adults (504 men and 383 women; mean age, 20.7 years, SD, 1.85. We performed three different multiple regression analyses: we evaluated rWMV associated with individual differences in the simple processing speed task, word-colour and colour-word tasks (processing speed tasks with words and the simple arithmetic task, after adjusting for age and sex. The results showed a positive relationship at the whole-brain level between rWMV and processing speed performance. In contrast, the processing speed performance did not correlate with rWMV in any of the regions examined. Our results support the idea that WMV is associated globally with processing speed performance regardless of the type of processing speed task.

a.c. conductance study of polycrystal C60

International Nuclear Information System (INIS)

Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin

1995-01-01

The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))

Control of Power Converters in AC Microgrids

DEFF Research Database (Denmark)

Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

2012-01-01

The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

Droop-free Distributed Control for AC Microgrids

DEFF Research Database (Denmark)

Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.

2016-01-01

A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

Effect of AC electric fields on the stabilization of premixed bunsen flames

KAUST Repository

Kim, Minkuk

2011-01-01

The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

Objectives and status of development of AC600

International Nuclear Information System (INIS)

Zhao Chengkun

1997-01-01

AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

Introduction of hvdc transmission into a predominantly ac network

Energy Technology Data Exchange (ETDEWEB)

Casson, W; Last, F H; Huddart, K W

1966-02-01

Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.

21 CFR 880.5510 - Non-AC-powered patient lift.

Science.gov (United States)

2010-04-01

...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...

Effect of temperature on the AC impedance of protein

Indian Academy of Sciences (India)

The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

The research of automatic speed control algorithm based on Green CBTC

Science.gov (United States)

Lin, Ying; Xiong, Hui; Wang, Xiaoliang; Wu, Youyou; Zhang, Chuanqi

2017-06-01

Automatic speed control algorithm is one of the core technologies of train operation control system. It’s a typical multi-objective optimization control algorithm, which achieve the train speed control for timing, comfort, energy-saving and precise parking. At present, the train speed automatic control technology is widely used in metro and inter-city railways. It has been found that the automatic speed control technology can effectively reduce the driver’s intensity, and improve the operation quality. However, the current used algorithm is poor at energy-saving, even not as good as manual driving. In order to solve the problem of energy-saving, this paper proposes an automatic speed control algorithm based on Green CBTC system. Based on the Green CBTC system, the algorithm can adjust the operation status of the train to improve the efficient using rate of regenerative braking feedback energy while ensuring the timing, comfort and precise parking targets. Due to the reason, the energy-using of Green CBTC system is lower than traditional CBTC system. The simulation results show that the algorithm based on Green CBTC system can effectively reduce the energy-using due to the improvement of the using rate of regenerative braking feedback energy.

A Study on the Effects of Compression Ratio, Engine Speed and Equivalence Ratio on HCCI Combustion of DME

DEFF Research Database (Denmark)

Pedersen, Troels Dyhr; Schramm, Jesper

2007-01-01

An experimental study has been carried out on the homogeneous charge compression ignition (HCCI) combustion of Dimethyl Ether (DME). The study was performed as a parameter variation of engine speed and compression ratio on excess air ratios of approximately 2.5, 3 and 4. The compression ratio...... was adjusted in steps to find suitable regions of operation, and the effect of engine speed was studied at 1000, 2000 and 3000 RPM. It was found that leaner excess air ratios require higher compression ratios to achieve satisfactory combustion. Engine speed also affects operation significantly....

Winding Design for Minimum Power Loss and Low-Cost Manufacture in Application to Fixed-Speed PM Generator

OpenAIRE

Wrobel, Rafal; Staton, David; Lock, Richard J; Booker, Julian D; Drury, David

2015-01-01

This paper presents the results from a coupled thermal and power loss analysis of an open-slot permanent-magnet (PM) generator. The research focus has been placed on the winding design providing minimum power loss at an ac operation, together with low-cost manufacture. The analyzed PM generator is intended to operate at a fixed speed, allowing for the winding design to be finely tuned for a single operating point. Such a design approach has not been widely reported in literature, and the exis...

Speed-calming measures and their Effect on driving speed

DEFF Research Database (Denmark)

Agerholm, Niels; Knudsen, Daniel; Variyeswaran, Kajan

2017-01-01

Highlights •Speed humps and chicanes are widespread speed-calming measures. •Humps and chicanes have virtually the same reducing effect on mean speed. •Chicanes reduce speed variation less than humps and might therefore be a less safe measure....

Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

Directory of Open Access Journals (Sweden)

Vinod Kumar Singh

2016-09-01

Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

Market structure and price adjustment in the U.S. wholesale gasoline markets

International Nuclear Information System (INIS)

Oladunjoye, Olusegun

2008-01-01

The issue of sticky prices in U.S. wholesale gasoline market is re-examined allowing for the effect of market structure due to increased market concentration caused by mergers, acquisitions and joint ventures which started in the late 1990s in the U.S. oil industry. I investigate the effects of market structure on the pattern of price adjustment based on the notion that increased market concentration leads to downward price stickiness and asymmetric short run price adjustment in the transmission of crude price changes to wholesale gasoline price. I find that market concentration has an insignificant asymmetric effect on the speed of price adjustment but a significant asymmetric effect on short run price adjustments in the response of wholesale gasoline prices to crude price shocks in three U.S. wholesale markets. Furthermore, the signs on the coefficients of market concentration effects on price dynamics in the models support the assertion that increased market concentration leads to downward price stickiness in only one of the three markets examined. Overall, the results indicate that market structure does not have a strong effect on the dynamics of price adjustment. (author)

Driving on urban roads: How we come to expect the 'correct' speed.

Science.gov (United States)

Charlton, Samuel G; Starkey, Nicola J

2017-11-01

The subjective categories that drivers use to distinguish between different road types have been shown to influence the speeds they choose to drive but as yet we do not understand the road features that drivers use to make their discriminations. To better understand how drivers describe and categorise the roads they drive, 55 participants were recruited to drive a video of familiar urban roads in a driving simulator at the speed they would drive these roads in their own cars (using the accelerator and brake pedal in the driving simulator to adjust their speed). The participants were then asked to sort photos of the roads they had just driven into piles so that their driving would be the same on all roads in one pile but different to the other piles. Finally, they answered a series of questions about each road to indicate what speed they would drive, the safe speed for the road, their speed limit belief as well as providing ratings of comfort, difficulty and familiarity. Overall, drivers' categorisation of roads was informed by a number of factors including speed limit belief, road features and markings (including medians), road width, and presence of houses, driveways and footpaths. The participants' categories were congruent with what they thought the speed limits were, but not necessarily the actual speed limits. Mismatches between actual speed limits and speed limit beliefs appeared to result from category-level expectations about speed limits that took precedence over recent experience in the simulator. Roads that historically had a 50km/h speed limit but had been reduced to 40km/h were still regarded as 50km/h roads by the participants, underscoring the point that simply posting a sign with a lower speed limit is not enough to overcome drivers' expectations and habits associated with the visual appearance of a road. The findings provided insights into how drivers view and categorise roads, and identify specific areas that could be used to improve speed limit

Effect of the valence electron concentration on the bulk modulus and chemical bonding in Ta2AC and Zr2AC (A=Al, Si, and P)

International Nuclear Information System (INIS)

Schneider, Jochen M.; Music, Denis; Sun Zhimei

2005-01-01

We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion

Low ac loss geometries in YBCO coated conductors and impact on conductor stability

Energy Technology Data Exchange (ETDEWEB)

Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven

International Nuclear Information System (INIS)

Smedley, K.

1992-04-01

The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab

The role of visual processing speed in reading speed development.

Science.gov (United States)

Lobier, Muriel; Dubois, Matthieu; Valdois, Sylviane

2013-01-01

A steady increase in reading speed is the hallmark of normal reading acquisition. However, little is known of the influence of visual attention capacity on children's reading speed. The number of distinct visual elements that can be simultaneously processed at a glance (dubbed the visual attention span), predicts single-word reading speed in both normal reading and dyslexic children. However, the exact processes that account for the relationship between the visual attention span and reading speed remain to be specified. We used the Theory of Visual Attention to estimate visual processing speed and visual short-term memory capacity from a multiple letter report task in eight and nine year old children. The visual attention span and text reading speed were also assessed. Results showed that visual processing speed and visual short term memory capacity predicted the visual attention span. Furthermore, visual processing speed predicted reading speed, but visual short term memory capacity did not. Finally, the visual attention span mediated the effect of visual processing speed on reading speed. These results suggest that visual attention capacity could constrain reading speed in elementary school children.

The role of visual processing speed in reading speed development.

Directory of Open Access Journals (Sweden)

Muriel Lobier

Full Text Available A steady increase in reading speed is the hallmark of normal reading acquisition. However, little is known of the influence of visual attention capacity on children's reading speed. The number of distinct visual elements that can be simultaneously processed at a glance (dubbed the visual attention span, predicts single-word reading speed in both normal reading and dyslexic children. However, the exact processes that account for the relationship between the visual attention span and reading speed remain to be specified. We used the Theory of Visual Attention to estimate visual processing speed and visual short-term memory capacity from a multiple letter report task in eight and nine year old children. The visual attention span and text reading speed were also assessed. Results showed that visual processing speed and visual short term memory capacity predicted the visual attention span. Furthermore, visual processing speed predicted reading speed, but visual short term memory capacity did not. Finally, the visual attention span mediated the effect of visual processing speed on reading speed. These results suggest that visual attention capacity could constrain reading speed in elementary school children.

Flame spread over inclined electrical wires with AC electric fields

KAUST Repository

Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho

2017-01-01

Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field

Fine Tuning the CJ Detonation Speed of a High Explosive products Equation of State

Energy Technology Data Exchange (ETDEWEB)

Menikoff, Ralph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-05-12

For high explosive (HE) simulations, inaccuracies of a per cent or two in the detonation wave speed can result from not suficiently resolving the reaction zone width or from small inaccuracies in calibrating the products equation of state (EOS) or from variation of HE lots. More accurate detonation speeds can be obtained by ne tuning the equation of state to compensate. Here we show that two simple EOS transformations can be used to adjust the CJ detonation speed by a couple of per cent with minimal effect on the CJ release isentrope. The two transformations are (1) a shift in the energy origin and (2) a linear scaling of the speci c volume. The effectiveness of the transformations is demonstrated with simulations of the cylinder test for PBX 9502 starting with a products EOS for which the CJ detonation speed is 1 per cent too low.

Rotor speed estimation for indirect stator flux oriented induction motor drive based on MRAS scheme

Directory of Open Access Journals (Sweden)

Youssef Agrebi

2007-09-01

Full Text Available In this paper, a conventional indirect stator flux oriented controlled (ISFOC induction motor drive is presented. In order to eliminate the speed sensor, an adaptation algorithm for tuning the rotor speed is proposed. Based on the model reference adaptive system (MRAS scheme, the rotor speed is tuned to obtain an exact ISFOC induction motor drive. The reference and adjustable models, developed in stationary stator reference frame, are used in the MRAS scheme to estimate induction rotor peed from measured terminal voltages and currents. The IP gains speed controller and PI gains current controller are calculated and tuned at each sampling time according to the new estimated rotor speed. The proposed algorithm has been tested by numerical simulation, showing the capability of driving active load; and stability is preserved. Experimental results obtained with a general-purpose 1-kW induction machine are presented showing the effectiveness of the proposed approach in terms of dynamic performance.

DC and AC biasing of a transition edge sensor microcalorimeter

International Nuclear Information System (INIS)

Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.

2002-01-01

We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode

Directory of Open Access Journals (Sweden)

Dwi Riana Aryani

2016-06-01

Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.

Aragonite coating solutions (ACS) based on artificial seawater

International Nuclear Information System (INIS)

Tas, A. Cuneyt

2015-01-01

Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

Aragonite coating solutions (ACS) based on artificial seawater

Energy Technology Data Exchange (ETDEWEB)

Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

2015-03-01

Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

Abscisic Acid Antagonizes Ethylene Production through the ABI4-Mediated Transcriptional Repression of ACS4 and ACS8 in Arabidopsis.

Science.gov (United States)

Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng

2016-01-04

Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.

The Cryogenic Anti-Coincidence detector for ATHENA X-IFU: pulse analysis of the AC-S7 single pixel prototype

Science.gov (United States)

D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.

2016-07-01

The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.

Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies

Science.gov (United States)

Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.

2016-11-01

We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.

Development of low AC loss windings for superconducting traction transformer

International Nuclear Information System (INIS)

Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K

2010-01-01

We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.

Hybrid AC-High Voltage DC Grid Stability and Controls

Science.gov (United States)

Yu, Jicheng

The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

Aislamiento acústico a ruido aéreo en acristalamientos de vidrio

Directory of Open Access Journals (Sweden)

Escuder Silla, E.

2007-08-01

Full Text Available In this paper, the Ookura & Saito model is applied to determine the Airborne Sound Insulation of glazing systems. In particular, the calculations that appear are for monolithic glasses of different thicknesses and laminated glasses from different types. There are different prediction models of the airborne acoustic behaviour of multilayer panels (and the laminated glasses can be considered like such. In all of them, the input data are the elastic constants and the loss factor. The monolithic glasses and the intermediate layer have been characterized according to different Standards. The results are compared with experimental measurements and data of the study of Marsh (1, obtaining a range of acceptable adjustment.

En este artículo se aplica el modelo de Ookura & Saito para determinar el aislamiento acústico a ruido aéreo de sistemas constructivos basados en vidrios. En concreto, los cálculos que se presentan son para vidrios monolíticos de distintos espesores y para vidrios laminados de diferentes tipos. Existen diferentes modelos de predicción del comportamiento acústico a ruido aéreo de estructuras multicapa (y los vidrios laminados pueden considerarse como tales. En todos ellos, los datos de entrada son las constantes elásticas y el factor de pérdidas. Tanto los vidrios monolíticos como la capa intermedia se han caracterizado siguiendo diferentes normativas. Los resultados se comparan con medidas experimentales y con datos recogidos del estudio de Marsh (1, obteniéndose un grado de ajuste aceptable.

AC Calorimetric Design for Dynamic of Biological Materials

OpenAIRE

Shigeo Imaizumi

2006-01-01

We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

Study of dielectric relaxation and AC conductivity of InP:S single crystal

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.

2012-07-01

The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.

Self-field AC losses in Bi-2223 superconducting tapes

International Nuclear Information System (INIS)

Mueller, K. H.; Leslie, K.E.

1996-01-01

Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

High-speed scanning stroboscopic fringe-pattern projection technology for three-dimensional shape precision measurement.

Science.gov (United States)

Yang, Guowei; Sun, Changku; Wang, Peng; Xu, Yixin

2014-01-10

A high-speed scanning stroboscopic fringe-pattern projection system is designed. A high-speed rotating polygon mirror and a line-structured laser cooperate to produce stable and unambiguous stroboscopic fringe patterns. The system combines the rapidity of the grating projection with the high accuracy of the line-structured laser light source. The fringe patterns have fast frame rate, great density, high precision, and high brightness, with convenience and accuracy in adjusting brightness, frequency, linewidth, and the amount of phase shift. The characteristics and the stability of this system are verified by experiments. Experimental results show that the finest linewidth can reach 40 μm and that the minimum fringe cycle is 80 μm. Circuit modulation makes the light source system flexibly adjustable, easy to control in real time, and convenient to project various fringe patterns. Combined with different light intensity adjustment algorithms and 3D computation models, the 3D topography with high accuracy can be obtained for objects measured under different environments or objects with different sizes, morphologies, and optical properties. The proposed system shows a broad application prospect for fast 3D shape precision measurements, particularly in the industrial field of 3D online detection for precision devices.

AC susceptibility of thin Pb films in intermediate and mixed state

Energy Technology Data Exchange (ETDEWEB)

Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)

2011-12-15

Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.

Influence of surface oxygenated groups on the formation of active Cu species and the catalytic activity of Cu/AC catalyst for the synthesis of dimethyl carbonate

Science.gov (United States)

Zhang, Guoqiang; Li, Zhong; Zheng, Huayan; Hao, Zhiqiang; Wang, Xia; Wang, Jiajun

2016-12-01

Activated carbon (AC) supported Cu catalysts are employed to study the influence of surface oxygenated groups on the formation of active Cu species and the catalytic activity of Cu/AC catalyst for oxidative carbonylation of methanol to dimethyl carbonate (DMC). The AC supports are thermal treated under different temperatures in order to adjust the levels of surface oxygenated groups. The AC supports are characterized by BET, TPD-MS and XRD, and the Cu/AC catalysts are characterized by BET, XRD, TEM, XPS, AAS, CH3OH-TPD and N2O chemisorption. The results show that as the treatment temperature is below 800 °C, the BET surface area of the corresponding AC supports are nearly unchanged and close to that of the original AC (1529.6 m2/g). But as the thermal treatment temperature is elevated from 1000 to 1600 °C, the BET surface area of AC supports gradually decreases from 1407.6 to 972.2 m2/g. After loading of Cu, the BET surface area of copper catalysts is in the range of 834.4 to 1545.3 m2/g, which is slightly less than that of the respective supports. When AC is thermal treated at 400 and 600 °C, the unstable carboxylic acid and anhydrides groups are selectively removed, which has weakened the mobility and agglomeration of Cu species during the calcination process, and thus improve the Cu species dispersion over AC support. But as the treatment temperature is elevated from 600 °C to 1200 °C, the Cu species dispersion begins to decline suggesting further removal of stable surface oxygenated groups is unfavorable for Cu species dispersion. Moreover, higher thermal treatment temperature (above 1200 °C) promotes the graphitization degree of AC and leds to the decrease of Cu loading on AC support. Meanwhile, the removal of surface oxygenated groups by thermal treatment is conducive to the formation of more π-sites, and thus promote the reduction of Cu2+ to Cu+ and Cu0 as active centers. The specific surface area of (Cu+ + Cu0) is improved by thermal treatment of AC

Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

Science.gov (United States)

Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.

2010-11-01

AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

Pitch link loads reduction of variable speed rotors by variable tuning frequency fluidlastic isolators

Directory of Open Access Journals (Sweden)

Han Dong

2015-10-01

Full Text Available To reduce the pitch link loads of variable speed rotors, variable tuning frequency fluidlastic isolators are proposed. This isolator utilizes the variation of centrifugal force due to the change of rotor speed to change the tuning port area ratio, which can change the tuning frequency of the isolator. A rotor model including the model of fluidlastic isolator is coupled with a fuselage model to predict the steady responses of the rotor system in forward flight. The aeroelastic analyses indicate that distinct performance improvement in pitch link load control can be achieved by the utilization of variable frequency isolators compared with the constant tuning frequency isolators. The 4/rev (per revolution pitch link load is observed to be reduced by 87.6% compared with the increase of 56.3% by the constant frequency isolator, when the rotor speed is reduced by 16.7%. The isolation ability at different rotor speeds in different flight states is investigated. To achieve overall load reduction within the whole range of rotor speed, the strategy of the variation of tuning frequency is adjusted. The results indicate that the 4/rev pitch link load within the whole rotor speed range is decreased.

Flexible AC transmission systems: the state of the art

Energy Technology Data Exchange (ETDEWEB)

Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

1994-12-31

Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

Operation of AC Adapters Visualized Using Light-Emitting Diodes

Science.gov (United States)

Regester, Jeffrey

2016-01-01

A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

A.C. losses in current-carrying superconductors

International Nuclear Information System (INIS)

Reuver, J.L. de.

1985-01-01

The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

Evaluation of coronary features of HIV patients presenting with ACS: The CUORE, a multicenter study.

Science.gov (United States)

Peyracchia, Mattia; De Lio, Giulia; Montrucchio, Chiara; Omedè, Pierluigi; d'Ettore, Gabriella; Calcagno, Andrea; Vullo, Vincenzo; Cerrato, Enrico; Pennacchi, Mauro; Sardella, Gennaro; Manga, Pravin; GrossoMarra, Walter; Vullo, Francesco; Fedele, Francesco; Biondi-Zoccai, Giuseppe; Moretti, Claudio; Vachiat, Ahmed; Bonora, Stefano; Rinaldi, Mauro; Mancone, Massimo; D'Ascenzo, Fabrizio

2018-05-05

The risk of recurrence of myocardial infarction (MI) in HIV patients presenting with acute coronary syndrome (ACS) is well known, but there is limited evidence about potential differences in coronary plaques compared to non-HIV patients. In this multicenter case-control study, HIV patients presenting with ACS, with intravascular-ultrasound (IVUS) data, enrolled between February 2015 and June 2017, and undergoing highly active antiretroviral therapy (HAART), were retrospectively compared to non-HIV patients presenting with ACS, before and after propensity score with matching, randomly selected from included centers. Primary end-point was the prevalence of multivessel disease. Secondary end-points were the prevalence of abnormal features at IVUS, the incidence of major-acute-cardiovascular-events (MACE), a composite end point of cardiovascular death, MI, target lesion revascularization (TLR), stent thrombosis (ST), non-cardiac death and target vessel revascularization (TVR). For each end-point, a subgroup analysis was conducted in HIV patients with CD4 cell count <200/mm 3 . Before propensity score, 66 HIV patients and 120 non-HIV patients were selected, resulting in 20 and 40 after propensity score. Patients with multivessel disease were 11 and 17, respectively (p = 0.56). IVUS showed a lower plaque burden (71% vs. 75%, p < 0.001) and a higher prevalence of hyperechoic non-calcified plaques (100% vs. 35%, p < 0.05) in HIV patients; a higher prevalence of hypoechoic plaques (7% vs. 0%, p < 0.05), a higher incidence of MACE (17.4% vs. 9.1% vs. l'8.0%, p < 0.05), MI recurrence (17.2% vs. 0.0% vs. 2.3%, p < 0.05), and ST (6.7% vs. 0.3% vs. 03%, p < 0.05) in HIV patients with CD4 < 200/mm 3 . Our study may provide a part of the pathophysiological basis of the differences in coronary arteries between HIV-positive and HIV-negative patients, suggesting that the former present with peculiar morphological features at IVUS, even after adjustment for clinical variables

The effect of speed-accuracy strategy on response interference control in Parkinson's disease.

Science.gov (United States)

Wylie, S A; van den Wildenberg, W P M; Ridderinkhof, K R; Bashore, T R; Powell, V D; Manning, C A; Wooten, G F

2009-07-01

Studies that used conflict paradigms such as the Eriksen Flanker task show that many individuals with Parkinson's disease (PD) have pronounced difficulty resolving the conflict that arises from the simultaneous activation of mutually exclusive responses. This finding fits well with contemporary views that postulate a key role for the basal ganglia in action selection. The present experiment aims to specify the cognitive processes that underlie action selection deficits among PD patients in the context of variations in speed-accuracy strategy. PD patients (n=28) and healthy controls (n=17) performed an arrow version of the flanker task under task instructions that either emphasized speed or accuracy of responses. Reaction time (RT) and accuracy rates decreased with speed compared to accuracy instructions, although to a lesser extent for the PD group. Differences in flanker interference effects among PD and healthy controls depended on speed-accuracy strategy. Compared to the healthy controls, PD patients showed larger flanker interference effects under speed stress. RT distribution analyses suggested that PD patients have greater difficulty suppressing incorrect response activation when pressing for speed. These initial findings point to an important interaction between strategic and computational aspects of interference control in accounting for cognitive impairments of PD. The results are also compatible with recent brain imaging studies that demonstrate basal ganglia activity to co-vary with speed-accuracy adjustments.

Logistics Reduction: Advanced Clothing System (ACS)

Data.gov (United States)

National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

Early function of the Abutilon mosaic virus AC2 gene as a replication brake.

Science.gov (United States)

Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger

2015-04-01

The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on

Impact of CYP2C19 Metabolizer Status on Patients With ACS Treated With Prasugrel Versus Clopidogrel.

Science.gov (United States)

Doll, Jacob A; Neely, Megan L; Roe, Matthew T; Armstrong, Paul W; White, Harvey D; Prabhakaran, Dorairaj; Winters, Kenneth J; Duvvuru, Suman; Sundseth, Scott S; Jakubowski, Joseph A; Gurbel, Paul A; Bhatt, Deepak L; Ohman, E Magnus; Fox, Keith A A

2016-03-01

Certain alleles of the CYP2C19 gene are associated with higher platelet reactivity and increased ischemic events among patients treated with clopidogrel. However, the relationship of CYP2C19 genotype and outcomes in medically managed patients with acute coronary syndromes (ACS) is not known. This study sought to assess the effect of CYP2C19 genotype on ischemic outcomes in patients with ACS initially managed medically without revascularization who were randomized to either clopidogrel or prasugrel. We classified patients as extensive metabolizers (EM) or reduced metabolizers (RM) based on CYP2C19 genotype and evaluated ischemic outcomes and platelet reactivity. Among 9,326 patients enrolled from 2008 to 2011, 5,736 participated in the genetics cohort; of these, 2,236 had platelet function testing data. There was no association between CYP2C19 metabolizer status (EM vs. RM) and the primary composite endpoint of cardiovascular death, myocardial infarction (MI), or stroke (hazard ratio [HR]: 0.86). EM and RM patients had similar rates of the primary endpoint whether treated with prasugrel (HR: 0.82) or clopidogrel (HR: 0.91; p for interaction = 0.495). After adjusting for clinical and treatment variables, EM patients had a lower risk of MI versus RM patients (HR: 0.80), but risks of other outcomes were similar. RM patients had significantly higher mean P2Y12 reaction units versus EM patients when treated with clopidogrel (39.93), but not with prasugrel (3.87). CYP2C19 metabolizer status is not associated with the composite outcome of cardiovascular death, MI, or stroke in medically managed ACS patients treated with clopidogrel or prasugrel. Our findings do not support routine CYP2C19 genetic testing in this population. (A Comparison of Prasugrel and Clopidogrel in Acute Coronary Syndrome Subjects [TRILOGY ACS]; NCT00699998). Copyright © 2016 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

Monolithic blue LED series arrays for high-voltage AC operation

Energy Technology Data Exchange (ETDEWEB)

Ao, Jin-Ping [Satellite Venture Business Laboratory, University of Tokushima, Tokushima 770-8506 (Japan); Sato, Hisao; Mizobuchi, Takashi; Morioka, Kenji; Kawano, Shunsuke; Muramoto, Yoshihiko; Sato, Daisuke; Sakai, Shiro [Nitride Semiconductor Co. Ltd., Naruto, Tokushima 771-0360 (Japan); Lee, Young-Bae; Ohno, Yasuo [Department of Electrical and Electronic Engineering, University of Tokushima, Tokushima 770-8506 (Japan)

2002-12-16

Design and fabrication of monolithic blue LED series arrays that can be operated under high ac voltage are described. Several LEDs, such as 3, 7, and 20, are connected in series and in parallel to meet ac operation. The chip size of a single device is 150 {mu}m x 120 {mu}m and the total size is 1.1 mm x 1 mm for a 40(20+20) LED array. Deep dry etching was performed as device isolation. Two-layer interconnection and air bridge are utilized to connect the devices in an array. The monolithic series array exhibit the expected operation function under dc and ac bias. The output power and forward voltage are almost proportional to LED numbers connected in series. On-wafer measurement shows that the output power is 40 mW for 40(20+20) LED array under ac 72 V. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

pH sensing via bicarbonate-regulated ‘soluble’ adenylyl cyclase (sAC

Directory of Open Access Journals (Sweden)

Nawreen eRahman

2013-11-01

Full Text Available Soluble adenylyl cyclase (sAC is a source of the second messenger cyclic adenosine 3',5' monophosphate (cAMP. sAC is directly regulated by bicarbonate (HCO3- ions. In living cells, HCO3- ions are in nearly instantaneous equilibrium with carbon dioxide (CO2 and pH due to the ubiquitous presence of carbonic anhydrases. Numerous biological processes are regulated by CO2, HCO3-, and/or pH, and in a number of these, sAC has been shown to function as a physiological CO2/HCO3/pH sensor. In this review, we detail the known pH sensing functions of sAC, and we discuss two highly-studied, pH-dependent pathways in which sAC might play a role.

Walking smoothness is associated with self-reported function after accounting for gait speed.

Science.gov (United States)

Lowry, Kristin A; Vanswearingen, Jessie M; Perera, Subashan; Studenski, Stephanie A; Brach, Jennifer S

2013-10-01

Gait speed has shown to be an indicator of functional status in older adults; however, there may be aspects of physical function not represented by speed but by the quality of movement. The purpose of this study was to determine the relations between walking smoothness, an indicator of the quality of movement based on trunk accelerations, and physical function. Thirty older adults (mean age, 77.7±5.1 years) participated. Usual gait speed was measured using an instrumented walkway. Walking smoothness was quantified by harmonic ratios derived from anteroposterior, vertical, and mediolateral trunk accelerations recorded during overground walking. Self-reported physical function was recorded using the function subscales of the Late-Life Function and Disability Instrument. Anteroposterior smoothness was positively associated with all function components of the Late-Life Function and Disability Instrument, whereas mediolateral smoothness exhibited negative associations. Adjusting for gait speed, anteroposterior smoothness remained associated with the overall and lower extremity function subscales, whereas mediolateral smoothness remained associated with only the advanced lower extremity subscale. These findings indicate that walking smoothness, particularly the smoothness of forward progression, represents aspects of the motor control of walking important for physical function not represented by gait speed alone.

Normal form of particle motion under the influence of an ac dipole

Directory of Open Access Journals (Sweden)

R. Tomás

2002-05-01

Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.

Microcavity-coupled fiber Bragg grating with tunable reflection spectra and speed of light.

Science.gov (United States)

Chen, Lei; Han, Ya; Liu, Qian; Liu, Yan-Ge; Zhang, Weigang; Chou, Keng C

2018-04-15

After a fiber Bragg grating (FBG) is fabricated, the reflection spectrum of the FBG is generally not tunable without mechanical deformation or temperature adjustment. Here we present a microcavity-coupled FBG with both a tunable reflection lineshape and dispersion using electromagnetically induced transparency. The Fano interference of light in the FBG and the microcavity allows for dramatic modification of the reflection spectrum. The phase of the reflected spectrum is continuously tunable between 0 and 2π to produce various Fano lineshapes. The dispersion of the output light is adjustable from normal dispersion to abnormal dispersion, consequently providing an adjustable speed of light. Additionally, it allows the FBG to switch from a notch filter to a bandpass filter at the resonant wavelength, which is not possible in a conventional uniform FBG.

Analysis of Input and Output Ripples of PWM AC Choppers

Directory of Open Access Journals (Sweden)

Pekik Argo Dahono

2008-11-01

Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

Cosmic shear analysis of archival HST/ACS data. I. Comparison of early ACS pure parallel data to the HST/GEMS survey

Science.gov (United States)

Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.

2007-06-01

Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.

Balancing High-Speed Rotors at Low Speed

Science.gov (United States)

Giordano, J.; Zorzi, E.

1986-01-01

Flexible balancing reduces vibrations at operating speeds. Highspeed rotors in turbomachines dynamically balanced at fraction of operating rotor speed. New method takes into account rotor flexible rather than rigid.

Pantallas acústicas submarinas de material compuesto multilaminar con matriz metálica

OpenAIRE

Gallego, V.; Laguna, M.; Vázquez, A. J.

1999-01-01

7 pp.-- PACS nr.: 43.30.Ky.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999).

ac superconducting articles

International Nuclear Information System (INIS)

Meyerhoff, R.W.

1977-01-01

A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface

Autonomous Operation of Hybrid Microgrid with AC and DC Sub-Grids

DEFF Research Database (Denmark)

Loh, Poh Chiang; Blaabjerg, Frede

2011-01-01

the power flow among all the sources distributed throughout the two types of sub-grids, which certainly is tougher than previous efforts developed for only either ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc...... sources, ac sources and interlinking converters. Suitable control and normalization schemes are therefore developed for controlling them with results presented for showing the overall performance of the hybrid microgrid.......This paper investigates on the active and reactive power sharing of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac sub-grids, interconnected by power electronic interfaces. The main challenge here is to manage...

A Floquet-Green's function approach to mesoscopic transport under ac bias

International Nuclear Information System (INIS)

Wu, B H; Cao, J C

2008-01-01

The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias

Optimal football strategies: AC Milan versus FC Barcelona

OpenAIRE

Papahristodoulou, Christos

2012-01-01

In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

Preliminary design of reactor coolant pump canned motor for AC600

International Nuclear Information System (INIS)

Deng Shaowen

1998-01-01

The reactor coolant pump canned motor of AC600 PWR is the kind of shielded motors with high moment of inertia, high reliability, high efficiency and nice starting performance. The author briefly presents the main feature, design criterion and technical requirements, preliminary design, computation results and analysis of performance of AC600 reactor coolant pump canned motor, and proposes some problems to be solved for study and design of AC600 reactor coolant pump canned motor

Analytical theory and possible detection of the ac quantum spin Hall effect.

Science.gov (United States)

Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y

2017-07-11

We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.

The Hubble Legacy Archive ACS grism data

Science.gov (United States)

Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

2011-06-01

A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects

Alpha decay 225 Ac → 221Fr

International Nuclear Information System (INIS)

Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.

2004-01-01

Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the

Raising the speed limit from 75 to 80mph on Utah rural interstates: Effects on vehicle speeds and speed variance.

Science.gov (United States)

Hu, Wen

2017-06-01

In November 2010 and October 2013, Utah increased speed limits on sections of rural interstates from 75 to 80mph. Effects on vehicle speeds and speed variance were examined. Speeds were measured in May 2010 and May 2014 within the new 80mph zones, and at a nearby spillover site and at more distant control sites where speed limits remained 75mph. Log-linear regression models estimated percentage changes in speed variance and mean speeds for passenger vehicles and large trucks associated with the speed limit increase. Logistic regression models estimated effects on the probability of passenger vehicles exceeding 80, 85, or 90mph and large trucks exceeding 80mph. Within the 80mph zones and at the spillover location in 2014, mean passenger vehicle speeds were significantly higher (4.1% and 3.5%, respectively), as were the probabilities that passenger vehicles exceeded 80mph (122.3% and 88.5%, respectively), than would have been expected without the speed limit increase. Probabilities that passenger vehicles exceeded 85 and 90mph were non-significantly higher than expected within the 80mph zones. For large trucks, the mean speed and probability of exceeding 80mph were higher than expected within the 80mph zones. Only the increase in mean speed was significant. Raising the speed limit was associated with non-significant increases in speed variance. The study adds to the wealth of evidence that increasing speed limits leads to higher travel speeds and an increased probability of exceeding the new speed limit. Results moreover contradict the claim that increasing speed limits reduces speed variance. Although the estimated increases in mean vehicle speeds may appear modest, prior research suggests such increases would be associated with substantial increases in fatal or injury crashes. This should be considered by lawmakers considering increasing speed limits. Copyright © 2017 Elsevier Ltd and National Safety Council. All rights reserved.

Reducing AC-Winding Losses in High-Current High-Power Inductors

DEFF Research Database (Denmark)

Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

2009-01-01

Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...

Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

Directory of Open Access Journals (Sweden)

Dwi Riana Aryani

2017-11-01

Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

Speed control of diesel generator sets

International Nuclear Information System (INIS)

Jenzer, J.

1989-01-01

In some marine and stationary power plants, it is often of interest to be able to give some information about the dynamic behaviour of the engine when it is loaded according to a given programme: How well it reacts to the application of a step load and to a load rejection. What is the best speed governor type and its optimum parameter adjustment in order to satisfy the requested specification of maximum speed engine deviation and recovery time. How great is the influence of turbocharger options such as jet assist or waste gate on the dynamic behaviour of the plant. Such kinds of questions occur for all stand-by power stations and in marine installations where the engine is submitted to very large load variations in the form of steps, ramps or any other load programme. The computer program GENERAT fully fulfils the aims described above. The comparison of measurements and simulation is good enough to allow us to use simulation as a means of predicting the dynamic behaviour of stationary power plant with four-stroke engines submitted to a given load programme. This program allows us also to determine the optimum generator inertia and to find the optimum governor parameters. The next step of development will be to model the turbocharger and supercharging method for two-stroke engines and some new digital speed controls and to rewrite the program with the help of the simulation package ACSL. This last point presents some advantages, as for example in large reduction of program maintenance and higher flexibility