International Nuclear Information System (INIS)
1981-08-01
Contained are twenty-six abstracts of on-going research programs at Argonne National Laboratory concerning the modeling of environmental air pollutants concentration and transport for January-December 1980. Studies on pollutant transport modeling, fluid flow models, and atmospheric precipitations chemistry are included
Testing of January Anomaly at ISE-100 Index with Power Ratio Method
Directory of Open Access Journals (Sweden)
Şule Yüksel Yiğiter
2015-12-01
Full Text Available AbstractNone of investors that can access all informations in the same ratio is not possible to earn higher returns according to Efficient Market Hypothesis. However, it has been set forth effect of time on returns in several studies and reached conflicting conclusions with hypothesis. In this context, one of the most important existing anomalies is also January month anomaly. In this study, it has been researched that if there is January effect in BIST-100 index covering 2008-2014 period by using power ratio method. The presence of January month anomaly in BIST-100 index within specified period determined by analysis results.Keywords: Efficient Markets Hypothesis, January Month Anomaly, Power Ratio MethodJEL Classification Codes: G1,C22
List of publications, 1989 January - December
International Nuclear Information System (INIS)
1990-02-01
This list includes all the scientific and technical publications of Atomic Energy of Canada Limited. This includes both technical reports and reprints of journal articles and conference proceedings issued from 1989 January to 1989 December. The titles and other bibliographic information are arranged in several categories, each devoted to a broad subject area. In addition, each document is identified with an AECL number
International Nuclear Information System (INIS)
Kumar, Vijay; Murty, G.S.
1990-01-01
This report summarises the research and development activities of the Seismology Section during the periods from January 1988 to December 1989. Apart from the ongoing work on forensic seismology, seismicity studies, rock burst monitoring, elastic wave propagation, a new field system became operational at Bhatsa, located about 100 km from Bombay, comprising 11 station radio-telemetered seismic network with a central recording laboratory to study the reservoir induced seismicity. (author). figs., tabs
RECENT REFERENCES: JANUARY 1, 2005 TO DECEMBER 31, 2005
Energy Technology Data Exchange (ETDEWEB)
WINCHELL, D.F.
2005-12-31
This document lists experimental references added to Nuclear Science References (NSR) during the period January 1, 2005 to December 31, 2005. The first section lists keynumbers and keywords sorted by mass and nuclide. The second section lists all references, ordered by keynumber.
Surveillance of Suicidal Behavior January through December 2013
2015-06-01
Disorder . i Substance Use Disorder includes Drug or Alcohol Use Disorders . j Personality Disorders include Borderline or Antisocial Personality ...include Borderline or Antisocial Personality Disorders . Public Health Report No. S.0008057-13, January through December 2013 D-27 Figure D-8... Antisocial Personality Disorders . m Based on ICE-9 E-codes for self-inflicted injuries which first appear in medical
Nosocomial measles cluster in Denmark following an imported case, December 2008-January 2009
DEFF Research Database (Denmark)
Groth, C; Bottiger, Be; Plesner, A
2009-01-01
A cluster of six confirmed cases with identical measles virus genotype was reported in Denmark between December 2008 and January 2009. The findings highlight the importance of vaccination before travelling and adherence to the routine vaccination schedule.......A cluster of six confirmed cases with identical measles virus genotype was reported in Denmark between December 2008 and January 2009. The findings highlight the importance of vaccination before travelling and adherence to the routine vaccination schedule....
Physics department annual progress report 1 January - 31 December 1978
International Nuclear Information System (INIS)
Moller, H.B.; Lebech, B.
1978-12-01
Research in the Physics Department at Riso covers three main fields: Solid-state physics, Plasma physics, Meteorology. The principal activities in these fields are presented in this report that covers the period from 1 January to 31 December 1978. (Auth.)
Physics department annual progress report, 1 January - 31 December 1977
International Nuclear Information System (INIS)
Bjerrum Moeller, H.; Lebech, B.
1977-01-01
The principal activities in these fields are presented in this report that covers the period from 1 January to 31 December 1977. Introductions to the work in each of the main fields are given in the respective sections of the report. (Auth.)
Environmental and Medical Sciences Division progress report January - December 1975
International Nuclear Information System (INIS)
Johnston, J.E.
1976-07-01
The activities of the AERE Environmental and Medical Sciences Division for January to December 1975 are reported under sections entitled: introduction; inhalation toxicology and radionuclide analysis; whole body counting; radiation physics; environmental analysis, atmospheric pollution; medical; chemical analysis group; publications. (U.K.)
He, Shengping; Wang, Huijun; Gao, Yongqi; Li, Fei
2018-03-01
This study reveals an intensified influence of December Arctic Oscillation (AO) on the subsequent January surface air temperature (SAT) over Eurasia and North Africa in recent decades. The connection is statistically insignificant during 1957/58-1979/80 (P1), which becomes statistically significant during 1989/90-2011/12 (P2). The possible causes are further investigated. Associated with positive December AO during P2, significant anomalous anticyclone emerges over the central North Atlantic, which is accompanied with significant westerly and easterly anomalies along 45°-65°N and 20°-40°N, respectively. This favors the significant influence of December AO on the subsequent January SAT and atmospheric circulation over Eurasia and North Africa via triggering the North Atlantic tripole sea surface temperature (SST) anomaly that persists into the subsequent January. By contrast, the December AO-related anomalous anticyclone during P1 is weak and is characterized by two separate centers located in the eastern and western North Atlantic. Correspondingly, the westerly and easterly anomalies over the North Atlantic Ocean are weak and the-related tripole SST anomaly is not well formed, unfavorable for the persistent impact of the December AO into the subsequent January. Further analyses indicate that the different anomalous anticyclone associated with the December AO over the North Atlantic may be induced by the strengthened synoptic-scale eddy feedbacks over the North Atlantic, which may be related to the interdecadal intensification of the storm track activity. Additionally, the planetary stationary wave related to the December AO propagates from surface into upper stratosphere at mid-latitudes during P2, which further propagates downward to the troposphere and causes anomalous atmospheric circulation in the subsequent January.
Site environmental report for 1994. Environmental report, January--December 1994
International Nuclear Information System (INIS)
1994-01-01
This document is the 1994 site environmental report for the Rocky Flats Environmental Technology Site for January thru December. Compliance programs, radiological and nonradiological monitoring, and significant issues and events are described. In addition, the methodology for radiation dose assessment and the Environmental Restoration, Waste Management, and Quality Assurance programs are discussed
100 Area D4 Project Building Completion Report: December 2008 to December 2009
International Nuclear Information System (INIS)
Finucane, K.G.; Harrie, J.P.
2010-01-01
This report documents the final status of buildings after the completion of D4 activities at the 100 Area of the U.S. Department of Energy Hanford Site from December 1, 2008, to December 31, 2009. The following buildings are included in this report: 11-N Change Room; 13-N Storage Building; 107-N Basin Recirculation Facility; 108-N Chemical Unloading Facility; 183-ND Resin Disposal Pit; 183-F Clearwells; 188-D Ash Disposal Pit; 1524-N Hazardous Waste Storage Pad; 1525-N Laydown Storage Area; 1607-Ni Sewage Tank; 1607-N2 Sewage Tank; 1706-NA Sewage Lift Station; 1904-D Outfall Structure; MO-013 Mobile Office Trailer; MO-422 Mobile Office Trailer; and MO-999 Mobile Office Trailer. Demolition debris and soil associated with completion of these buildings were disposed at the Environmental Restoration Disposal Facility (ERDF), located at the Hanford Site. Postdemolition direct hand instrument surveys and Global Positioning Environmental Radiological Survey (GPERS) surveys were performed on excavations after loadout of debris and prior to backfill. The 100 Area D4/Interim Safe Storage (ISS) project personnel worked a total of approximately 137,930 hours (manual and non-manual, not including subcontractors) from December 1, 2008, to December 31, 2009. During this time there were 10 Occupational Safety and Health Administration (OSHA) recordable injuries, two of which involved lost time. There also were 27 first aid cases during this time period. No clothing contamination and no skin contamination incidents occurred during demolition of the 100 Area buildings. Workers received 7,350.2 person-mrem of radiological exposure from December 1, 2008, to December 31, 2009 during their support of D4 activities associated with the buildings discussed in this report. All boundary air sample results were below procedural action levels for the duration of the work performed.
International Nuclear Information System (INIS)
2014-01-01
The report is a summary of research projects undertaken by various centres of the Biotechnology and Nuclear Agriculture Institute (BNARI) of the Ghana Atomic Energy Commission from January to December 2014. Also included are the lists of published journal articles and technical reports issued by Staff.
Report January 1989 - December 1990
International Nuclear Information System (INIS)
1991-01-01
This report describes the experimental research of the Manchester Nuclear Physics Group for the period January 1989-December 1990. Most of the experiments have been performed at the Daresbury Nuclear Structure Facility (NSF) usually in collaboration with other groups from the U.K. and elsewhere. There have also been significant collaborations in experimental work carried out at Argonne, CERN the National Physical Laboratory, SUNY Stony Brook, the Niels Bohr Institute and Oxford. The range of contributions reflects the wide range of techniques and equipment available at the NSF and the wide range of phenomena that can be studied in the nuclear many-body system. Deformation is a recurring theme and the use of γ ray array to extend spectroscopic measurements of fission products to the neutron rich limit of known nuclei has identified 104 Zr with a first excited state energy corresponding to the largest known deformation at low spin and excitation energy. The Daresbury experiments described exploit the range of experimental equipment available at the NSF with the γ-ray array being used most frequently. EUROGAM will provide a further substantial improvement in the equipment available for these measurements and two reports describe the test made on the detectors for it
U.K. nuclear data progress report January-December 1986
International Nuclear Information System (INIS)
Sene, M.R.; Cookson, J.A.
1987-06-01
The paper is the United Kingdom Nuclear Data (UKND) progress report, and summarises nuclear data research in the UK between January and December 1986. The contents of the report contains nuclear data work presented by:- UKAEA Harwell, UKAEA Winfrith, National Physical Laboratory, and the Universities of Birmingham, Edinburgh and Oxford. Included in these contributions are collaborative studies involving institutions in Holland, Italy, West Germany and the United States. The report also contains contributions on Chemical Nuclear Data, as well as the summaries of three invited lectures presented at the 19th UK Nuclear Data Form, Harwell Laboratory, 1986. (U.K.)
Environmental-surveillance report for the Nevada Test Site (January 1982 through December 1982)
International Nuclear Information System (INIS)
Scoggins, W.A.
1983-06-01
This report documents the environmental surveillance program at the Nevada Test Site as conducted from January 1982 through December 1982. The results and evaluations of measurements of radioactivity in air and water, and of direct gamma radiation exposure rates are presented. Relevancy to DOE concentration guides (CG's) is established
Monitoring Forsmark. Meteorological monitoring at Forsmark, January-December 2010
Energy Technology Data Exchange (ETDEWEB)
Andersson, Cari; Jones, Joergen (Swedish Meteorological and Hydrological Institute (SMHI), Norrkoeping (Sweden))
2011-01-15
In the Forsmark area, SKB's meteorological monitoring started in 2003 at the sites Storskaeret and Hoegmasten. However, since July 1, 2007 measurements are only performed at Hoegmasten. Measured and calculated parameters at Hoegmasten are precipitation and corrected precipitation, air temperature, barometric pressure, wind speed and direction, air humidity, global radiation and potential evapotranspiration. The Swedish Meteorological and Hydrological Institute, SMHI, has been responsible for planning and design, as well as for the operation of the stations used for meteorological monitoring. In general, the quality of the meteorological measurements during the period concerned, starting January 1, 2010, and ending December 31, 2010, has shown to be good
Environmental surveillance report for the Nevada Test Site (January 1980-December 1980)
International Nuclear Information System (INIS)
Scoggins, W.A.
1981-01-01
Results are presented for the environmental surveillance program at the Nevada Test Site as conducted by the Department of Energy (DOE) onsite radiological safety contractor from January 1980 through December 1980. The results and evaluations of measurements of radioactivity in air and water, and of direct gamma radiation exposure rates are presented. Relevancy to DOE concentration guides (CG'S) is established
Sunspots sketches during the solar eclipses of 9th January and 29th December of 1777 in Mexico
Domínguez-Castro, Fernando; Gallego, María Cruz; Vaquero, José Manuel
2017-06-01
Two sunspot observations recorded by the Mexican Felipe de Zúñiga y Ontiveros have been revealed from a manuscript. One sunspot group was recorded on 9th January 1777 and four sunspot groups on 29th December 1777. Both records were taken during the observation of solar eclipses from Mexico City and their description also included sketches of the solar disk with sunspots. The sunspot group corresponding to 9th January was also observed by Erasmus Lievog. The observation on 29th December 1777 is the only record corresponding to this date.
Technical publications by JAERI staff from January 1977 to December 1977
International Nuclear Information System (INIS)
1978-11-01
Approximately 430 journal articles, papers at meetings, reports and books are given, which have been published by personnel of JAERI from January 1977 to December 1977. The contents for each entry include the title, language in which it is written, author(s), and journal name or origin. They are presented in INIS subject categories. The indexes are both by authors and report number. A list of the patents, originating at JAERI, including both Japanese and other patents, is also given. (author)
Technical publications by JAERI staff from January 1976 to December 1976
International Nuclear Information System (INIS)
1977-11-01
Approximately 400 journal articles, papers at meetings, reports and books are given, which have been published by personnel of JAERI from January 1976 to December 1976. The contents for each entry include the title, language in which it is written, author(s), and journal name or origin. They are presented in INIS subject categories. The indexes are both by authors and report number. A list of the patents, originating at JAERI, including both Japanese and other patents, is also given. (auth.)
Technical publications by JAERI staff from January 1975 to December 1975
International Nuclear Information System (INIS)
1977-03-01
Approximately 400 journal articles, papers at meetings, reports and books are given, which have been published by personnel of JAERI from January 1975 to December 1975. The contents for each entry include the title, language in which it is written, author (s), and journal name or origin. They are presented in INIS subject categories. The indexes are both by authors and report number. A list of the patents, originating at JAERI, including both Japanese and other patents, is also given. (auth.)
Technical publications by JAERI staff from January 1974 to December 1974
International Nuclear Information System (INIS)
1975-03-01
Approximately 370 journal articles, papers at meetings, reports and books are given, which have been published by personnel of JAERI from January 1974 to December 1974. The contents for each entry include the title, language in which it is written, author(s), and journal name or origin. They are presented in INIS subject categories. The indexes are both by authors and report number. A list of the patents, originating at JAERI, including both Japanese and other patents, is also given. (auth.)
Exports of propane and butanes, January-December 1993
International Nuclear Information System (INIS)
1994-05-01
Tables are presented showing exports of propane and butane for each month of 1993. Comparisons with the same month in 1992 are included, as well as a running total. Export quantities are given in m 3 by region within Canada and for Canada as a whole, and as m 3 /d for Canada as a whole. Average export prices in Canadian cents per liter for the same seven regions and Canada as a whole are also given. Exports show a seasonal trend, with a low of 8,681 m 3 /d in May and a high of 18,565 m 3 in December for propane. Butane exports also show a seasonal trend with a low of 1,806 m 3 /d in June and a high of 9,306 m 3 /d in January. Propane prices ranged from 9.68 cents/l in December to 12.47 cents/l in February, compared to a range of 7.55 to 10.71 cents/l in 1992. Butane prices ranged from 9.22 cents/l in November to 12.38 cents/l in June, compared to a range of 10 to 12.78 cents/l in 1992. Total propane exports in 1993 were 4,761,795 m 3 (6.8% higher than in 1992) and total butane exports were 1,974,682 m 3 (13% lower than in 1992). 24 tabs
Environmental surveillance report for the Nevada Test Site (January 1981 through December 1981)
International Nuclear Information System (INIS)
Scoggins, W.A.
1982-05-01
This report documents the environmental surveillance program at the Nevada Test Site as conducted by the Department of Energy (DOE) onsite radiological safety contractor from January 1981 through December 1981. The results and evaluations of measurements of radioactivity in air and water, and of direct gamma radiation exposure rates are presented. Relevancy to DOE concentration guides (CG'S) is established
Nuclear medicine and imaging research. Progress report, January 1, 1981-December 31, 1981
International Nuclear Information System (INIS)
Beck, R.N.; Cooper, M.C.
1981-09-01
The Progress Report for the period January 1, 1981-December 31, 1981 of the Franklin Memorial Research Institute discusses instrumentation and quantitative methods of evaluation in nuclear medicine and imaging research. Imaging systems and image evaluation are discussed in four projects: Radiation Detector Studies, Dual Purpose Scanner for Thyroid Imaging, Instrumentation for Image Processing and Enhancement, and Energy-Coded Processing in Nuclear Medicine
Worldwide OMEGA and Very Low Frequency (VLF) Transmitter Outages, January to December 1980.
1981-05-01
WORLDWIDE OMEGA AND VERY LOW FREQUENCY IVLF) TRANSMITTER OUTAGE--ETC, MAY 81 L RZONCA ,’,L.ASSI LED FAA-CT-81-26 FAA-RD- B1 -29 UL7 A-I’ l15FDRL AIO...computer for the time period GBR - Rugby , England (16.00 kHz) January to December 1980. (For the purposes of this report, any downtime NA - Cutler, Maine
Floods of December 1964 and January 1965 in the Far Western States; Part 1 Description
Waananen, A.O.; Harris, D.D.; Williams, R.C.
1971-01-01
The floods of December 1964 and January 1965 in the Far Western States were extreme; in many areas, the greatest in the history of recorded streamflow and substantially greater than those of December 1955. An unusually large area--Oregon, most of Idaho, northern California, southern Washington, and small areas in western and northern Nevada--was involved. It exceeded the area flooded in 1955. Outstanding features included recordbreaking peak discharges, high sediment concentrations, large sediment loads, and extensive flood damage. The loss of 47 lives and direct property damage of more than $430 million was attributable to the floods. Yet, storage in reservoirs and operation of flood-control facilities were effective in preventing far greater damages in many areas, particularly in the Central Valley in California and the Willamette River basin in Oregon. The floods were caused by three principal storms during the period December 19 to January 31. The December 19-23 storm was the greatest in overall intensity and areal extent. Crests occurred on many major streams December 23, 1964, 9 years to the day after the great flood of December 23, 1955. The January 2-7 storm produced extreme floods in some basins in California. The January 21-31 storm produced maximum stages in some streams in northeastern Oregon and southeastern Washington and a repetition of high flows in part of the Willamette River basin and in some basins in coastal Oregon. All the storms, and particularly the warm torrential rain December 21-23, reflected the combined effect of moist unstable airmasses, strong west-southwest winds, and mountain ranges oriented nearly at right angles to the flow of air. High air temperatures and strong winds associated with the storms caused melting of snow, and the meltwater augmented the rain that fell on frozen ground. The coastal areas of northern California and southern Oregon had measurable rain on as many as 50 days in December and January. A maximum
Geothermal technology publications and related reports: a bibliography, January 1984-December 1985
Energy Technology Data Exchange (ETDEWEB)
Cooper, D.L. (ed.)
1986-09-01
Technological limitations restrict the commercial availability of US geothermal resources and prevent effective evaluation of large resources, as magma, to meet future US needs. The US Department of Energy has asked Sandia to serve as the lead laboratory for research in Geothermal Technologies and Magma Energy Extraction. In addition, technology development and field support has been provided to the US Continental Scientific Drilling Program. Published results for this work from January 1984 through December 1985 are listed in this bibliography.
BY tank farm waste inventory and transfer data for ITS-2 operation during January To December 1971
Energy Technology Data Exchange (ETDEWEB)
Reich, F.R., Westinghouse Hanford
1996-08-02
Data record inventory of pumping activities and liquid level changes including occasional operations comments for the BY Tank Farm. Waste inventory and transfer data for ITS-2 operation during January to December 1971.
Physics Department. Annual progress report 1 January - 31 December 1990
International Nuclear Information System (INIS)
Als-Nielsen, J.; Skov Pedersen, J.; Lebech, B.
1991-01-01
Research in the Physics Department covers the field of condensed matter physics. The principal activities of the department are presented in this Progress Report for the period from 1 January to 31 December 1990. The condensed matter physics research is predominantly experimental utilising diffraction of neutrons and X-rays. The research topics range from studies of two- and three-dimensional structures, magnetic ordering, heavy fermions, phase transitions in model systems to studies of texture and recrystallization kinetics with a more applie nature. In the field high T c superconductors neutron and X-ray diffraction are used both for studying the basic mechanism responsible for the superconductivity and in the analysis of the solid state syntheses of the materials. (author) 9 tabs., 79 ills., 104 refs
Safeguards Summary Event List (SSEL), January 1, 1990--December 31, 1991
International Nuclear Information System (INIS)
Yardumian, J.; Fadden, M.
1992-07-01
The Safeguards Summary Event List (SSEL), Vol. 2, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990 through December 31, 1991. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, tampering/vandalism, arson, firearms, radiological sabotage, nonradiological sabotage, and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels
Safeguards and security progress report, January-December 1984
Energy Technology Data Exchange (ETDEWEB)
Smith, D.B. (comp.)
1986-01-01
From January to December 1984, the Los Alamos Safeguards and Security Program was involved in the activities described in the first four parts of this report: Nuclear Facility Support, Security Development and Support, Safeguards Technology Development, and International Safeguards. Part 1 covers efforts of direct assistance to the Department of Energy (DOE) and Nuclear Regulatory Commission (NRC) licensee facilities. Part 2 treats activities aimed at the security of information and computer systems. was Part 3 describes the broad development efforts essential to continuing improvements in the practice of safeguards. Although these projects are properly classified as developmental, they address recognized problems that commonly occur in operating facilities. Finally, Part 4 covers international safeguards activities, including both support to the International Atomic Energy Agency and bilateral exchanges. Enrichment plant safeguards, especially those concerning the Gas Centrifuge Enrichment Plant, required a significant portion of our resources. These efforts are beginning to provide substantial returns on our investment in technology transfer, not only in raising the level of safeguards effectiveness but also in benefiting from field experiences in operating environments.
Safeguards and security progress report, January-December 1984
International Nuclear Information System (INIS)
Smith, D.B.
1986-01-01
From January to December 1984, the Los Alamos Safeguards and Security Program was involved in the activities described in the first four parts of this report: Nuclear Facility Support, Security Development and Support, Safeguards Technology Development, and International Safeguards. Part 1 covers efforts of direct assistance to the Department of Energy (DOE) and Nuclear Regulatory Commission (NRC) licensee facilities. Part 2 treats activities aimed at the security of information and computer systems. was Part 3 describes the broad development efforts essential to continuing improvements in the practice of safeguards. Although these projects are properly classified as developmental, they address recognized problems that commonly occur in operating facilities. Finally, Part 4 covers international safeguards activities, including both support to the International Atomic Energy Agency and bilateral exchanges. Enrichment plant safeguards, especially those concerning the Gas Centrifuge Enrichment Plant, required a significant portion of our resources. These efforts are beginning to provide substantial returns on our investment in technology transfer, not only in raising the level of safeguards effectiveness but also in benefiting from field experiences in operating environments
Physics division. Progress report, January 1, 1995--December 31, 1996
International Nuclear Information System (INIS)
Stewart, M.; Bacon, D.S.; Aine, C.J.; Bartsch, R.R.
1997-10-01
This issue of the Physics Division Progress Report describes progress and achievements in Physics Division research during the period January 1, 1995-December 31, 1996. The report covers the five main areas of experimental research and development in which Physics Division serves the needs of Los Alamos National Laboratory and the nation in applied and basic sciences: (1) biophysics, (2) hydrodynamic physics, (3) neutron science and technology, (4) plasma physics, and (5) subatomic physics. Included in this report are a message from the Division Director, the Physics Division mission statement, an organizational chart, descriptions of the research areas of the five groups in the Division, selected research highlights, project descriptions, the Division staffing and funding levels for FY95-FY97, and a list of publications and presentations
Physics division. Progress report, January 1, 1995--December 31, 1996
Energy Technology Data Exchange (ETDEWEB)
Stewart, M.; Bacon, D.S.; Aine, C.J.; Bartsch, R.R. [eds.] [comps.] [and others
1997-10-01
This issue of the Physics Division Progress Report describes progress and achievements in Physics Division research during the period January 1, 1995-December 31, 1996. The report covers the five main areas of experimental research and development in which Physics Division serves the needs of Los Alamos National Laboratory and the nation in applied and basic sciences: (1) biophysics, (2) hydrodynamic physics, (3) neutron science and technology, (4) plasma physics, and (5) subatomic physics. Included in this report are a message from the Division Director, the Physics Division mission statement, an organizational chart, descriptions of the research areas of the five groups in the Division, selected research highlights, project descriptions, the Division staffing and funding levels for FY95-FY97, and a list of publications and presentations.
Physics Division progress report, January 1, 1991--December 31, 1991
International Nuclear Information System (INIS)
Shera, E.B.; Hollen, G.Y.
1992-06-01
This report provides selected accounts of significant progress in research and development achieved by Physics Division personnel during the period January 1, 1991, through December 31, 1991. It also provides a general description of the goals and interests of the Division, very brief descriptions of projects in the Division, and a list of publications produced during this period. The report represents the three main areas of experimental research and development in which the Physics Division serves the needs of Los Alamos National Laboratory and the nation in defense and basic sciences: (1) fundamental research in nuclear and particle physics, condensed-matter physics, and biophysics; (2) laser physics and applications, especially to high-density plasmas; (3) defense physics, including the development of diagnostic methods for weapons tests, weapons-related high energy-density physics, and other programs
Safeguards summary event list (SSEL), January 1, 1990--December 31, 1995
International Nuclear Information System (INIS)
1996-07-01
The Safeguards Summary Event List (SSEL), Vol. 2, Rev. 4, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the U.S. Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990, rough December 31, 1995. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of Bomb-related, Intrusion, Missing and/or Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms, Radiological Sabotage, Nonradiological Sabotage, and Miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels
Safeguards summary event list (SSEL), January 1, 1990--December 31, 1995
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-07-01
The Safeguards Summary Event List (SSEL), Vol. 2, Rev. 4, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the U.S. Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990, rough December 31, 1995. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of Bomb-related, Intrusion, Missing and/or Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms, Radiological Sabotage, Nonradiological Sabotage, and Miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels.
Mechanical Engineering Department technical abstracts for the period January-June 1985
International Nuclear Information System (INIS)
Woo, H.H.
1986-01-01
This document contains the abstracts from 116 reports produced by the Mechanical Engineering Department of the Lawrence Livermore National Laboratory during the period January - June, 1985. The Mechanical Engineering Department is reponsible for the design, analysis, fabrication, testing, and field installation of all mechanical components and systems required by Defence Systems, Lasers, Magnetic Fusion Energy, Physics, and Biomedical and Environmental Research. Similar support is provided to the Chemistry and Computation Departments. Keyword, author, and report-number indices are included
Performance Analysis of Occurrences January 1, 2011-December 31, 2011
Energy Technology Data Exchange (ETDEWEB)
Ludwig, M
2012-03-16
30 DOE sites that reported occurrences into ORPS during January 2011 through December 2011, 28 had effort hours available in CAIRS. Two sites had not submitted effort hours data to CAIRS as of the time data was pulled for this report. In those two cases, third quarter data was used as an estimate of fourth quarter data. The use of estimated data may introduce minor errors in the average, median, and Pearson calculations. Using the effort hours and the frequency of occurrences by site, a rate of occurrence frequency per 100 FTE workers was calculated. This rate is similar to the injury/illness frequency rate: the number of injury/illness cases per 100 FTE workers. To validate that this rate was appropriate to use, we compared the effort hours and the frequency of occurrences by site to determine if a relationship exists between the two, e.g. the more effort hours a site has, the more occurrences they tend to have. This hypothesis was tested using the Pearson Correlation Coefficient Test. The correlation coefficient measures the strength of the linear relationship between effort hours and occurrence frequency. The Pearson Correlation Coefficient Test will determine if the true correlation coefficient is equal to zero (no relationship exists), or if the correlation coefficient is not equal to zero (a relationship exists). Values approaching 1.00 show a more positive correlation. Simple linear regression was also used to display a trend line and to test if a one-way relationship exists between effort hours predicting the number of occurrences a site will have. Using the Pearson Correlation test, for the NNSA sites, effort hours and the number of occurrences are significantly and positively correlated with a correlation coefficient of 0.90, as was also seen in the previous report (correlation coefficient of 0.67). All DOE sites are positively correlated with a coefficient of 0.85. As the effort hours increase, so does the number of occurrences and vice versa. Based on the
Physics Division progress report, January 1, 1990--December 31, 1990
International Nuclear Information System (INIS)
Shera, E.B.; Hollen, G.Y.
1991-07-01
This report provides selected accounts of significant progress in research and development achieved by Physics Division personnel during the period January 1, 1990, through December 31, 1990. It also provides a general description of the goals and interests of the Division, very brief descriptions of projects in the Division, and a list of publications produced during this period. The report represents the three main areas of experimental research and development in which the Physics Division serves the needs of Los Alamos National Laboratory and the nation in defense and basic sciences: (1) fundamental research in nuclear and particle physics, condensed-matter physics, and biophysics; (2) laser physics and applications, especially to high-density plasmas; and (3) defense physics, including the development of diagnostic methods for weapons tests, weapons-related high energy-density physics, and programs supporting the Strategic Defense Initiative
International Nuclear Information System (INIS)
Basu, T.K.; Murty, G.S.
1988-01-01
This report sumarises the R and D in Seismology during the period from January 1986 to December 1987. Major topics of current study are (1) Forensic Seismology, (2) Seismicity and Seismic Risk estimates, (3) Reservoir induced seismicity and (4) Rockburst monitoring. Considerable effort is devoted to development of seismic data acquisition systems and theoretical aspects of seismology. (author)
Directory of Open Access Journals (Sweden)
ANIELA BĂLĂCESCU
2011-06-01
Full Text Available In the analysis of economic stability an important part is owned by consumer prices. The present study is devoted to an analysis of the evolution of CPI and inflation rate in the Rumanian economy. The analysis uses annual and monthly series for the period January 2000 - December 2010.
International Nuclear Information System (INIS)
Basu, T.K.; Bhakay-Tamhane, S.
1981-01-01
The highlights of the research and development (R and D) activities of the Neutron Physics Division of the Bhabha Atomic Research Centre, Bombay, during January - December 1980 are summarised. The R and D activities are in the fields of critical and subcritical fission systems, the plasma focus device, applied neutron physics, neutron and X-ray crystallography, materials physics and seismology. (M.G.B.)
Victory, Kerton R; Coronado, Fátima; Ifono, Sâa O; Soropogui, Therese; Dahl, Benjamin A
2015-04-17
On December 18, 2014, the Guinea Ministry of Health was notified by local public health authorities in Kissidougou, a prefecture in southeastern Guinea (pop. 284,000), that the number of cases of Ebola virus disease (Ebola) had increased from one case reported during December 8-14, 2014, to 62 cases reported during December 15-21. Kissidougou is one of the four Guinea prefectures (the others are Macenta, Gueckedou, and Conakry) where Ebola was first reported in West Africa in March 2014, and the mid-December increase was the largest documented by any prefecture in Guinea in a single week since the beginning of the epidemic. The Guinea Ministry of Health requested assistance from CDC and the World Health Organization to investigate the local outbreak, identify and isolate persons with suspected Ebola, assess transmission chains, and implement control measures. The investigation found that 85 confirmed Ebola cases were linked to one traditional funeral ceremony, including 62 (73%) cases reported during December 15-21. No additional cases related to this funeral ceremony were reported after January 10, 2015. After the outbreak was identified, rapid implementation of interventions limited additional Ebola virus transmission. Improved training for prompt reporting of cases, investigation, and contact tracing, and community acceptance of safe burial methods can reduce the risk for Ebola transmission in rural communities.
Holmes, Robert R.; Koenig, Todd A.; Rydlund, Jr., Paul H.; Heimann, David C.
2016-09-13
OverviewHeavy rainfall resulted in major flooding in the Meramec River Basin in eastern Missouri during late December 2015 through early January 2016. Cumulative rainfall from December 14 to 29, 2015, ranged from 7.6 to 12.3 inches at selected precipitation stations in the basin with flooding driven by the heaviest precipitation (3.9–9.7 inches) between December 27 and 29, 2015. Financial losses from flooding included damage to homes and other structures, damage to roads, and debris removal. Eight of 11 counties in the basin were declared a Federal Disaster Area.The U.S. Geological Survey (USGS), in cooperation with the U.S. Army Corps of Engineers and St. Louis Metropolitan Sewer District, operates multiple streamgages along the Meramec River and its primary tributaries including the Bourbeuse River and Big River. The period of record for streamflow at streamgages in the basin included in this report ranges from 24 to 102 years. Instrumentation in a streamgage shelter automatically makes observations of stage using a variety of methods (submersible pressure transducer, non-submersible pressure transducer, or non-contact radar). These observations are recorded autonomously at a predetermined programmed frequency (typically either 15 or 30 minutes) dependent on drainage-area size and concomitant flashiness of the stream. Although stage data are important, streamflow data are equally or more important for streamflow forecasting, water-quality constituent loads computation, flood-frequency analysis, and flood mitigation planning. Streamflows are computed from recorded stage data using an empirically determined relation between stage and streamflow termed a “rating.” Development and verification of the rating requires periodic onsite discrete measurements of streamflow throughout time and over the range of stages to define local hydraulic conditions.The purpose of this report is to examine characteristics of flooding that occurred in the Meramec River Basin in
National Research Council Canada - National Science Library
Burns, Casey
2000-01-01
The purpose of this thesis is to analyze protests of contract awards brought before the Comptroller General, General Accounting Office from January 1998 through December 1999 as a means to identify...
Ponnequin Wind Energy Project: Reference site avian study, January 1, 1998--December 31, 1998
Energy Technology Data Exchange (ETDEWEB)
Kerlinger, P.; Curry, R.; Ryder, R.
2000-04-05
This report summarizes the results of surveys completed during the period January 1, 1998, through December 31, 1998, at the Ponnequin Wind Energy Project in Weld County, Colorado. The surveys were conducted at two reference sites, and include a pre-construction avian abundance and use survey and raptor nesting, prey, and carcass surveys. The reference sites were situated immediately to the west of the project site in Weld County, Colorado, and 4.8 kilometers to the north of the site in Laramie County, Wyoming. The surveys were conducted along two 800-meter (m) main transects at each site with two 400-m (by 100-m) perpendicular transects. About 30 complete surveys were completed during the year, with a greater frequency of surveys in the late spring and early autumn. The surveys revealed mostly common species, with no endangered or threatened species on the sites. Small numbers of raptors were observed on or near the project and reference areas. During the winter, avian use and abundance was minimal. Prey species consisted primarily of thirteen-lined ground squirrels and northern pocket gophers. Two songbird carcasses were found. The results of these surveys, combined with data from several more months of surveys, will be compared to surveys conducted after construction of the wind farm.
Ponnequin Wind Energy Project: Reference site avian study, January 1, 1998--December 31, 1998
International Nuclear Information System (INIS)
Kerlinger, P.; Curry, R.; Ryder, R.
2000-01-01
This report summarizes the results of surveys completed during the period January 1, 1998, through December 31, 1998, at the Ponnequin Wind Energy Project in Weld County, Colorado. The surveys were conducted at two reference sites, and include a pre-construction avian abundance and use survey and raptor nesting, prey, and carcass surveys. The reference sites were situated immediately to the west of the project site in Weld County, Colorado, and 4.8 kilometers to the north of the site in Laramie County, Wyoming. The surveys were conducted along two 800-meter (m) main transects at each site with two 400-m (by 100-m) perpendicular transects. About 30 complete surveys were completed during the year, with a greater frequency of surveys in the late spring and early autumn. The surveys revealed mostly common species, with no endangered or threatened species on the sites. Small numbers of raptors were observed on or near the project and reference areas. During the winter, avian use and abundance was minimal. Prey species consisted primarily of thirteen-lined ground squirrels and northern pocket gophers. Two songbird carcasses were found. The results of these surveys, combined with data from several more months of surveys, will be compared to surveys conducted after construction of the wind farm
National Oceanic and Atmospheric Administration, Department of Commerce — Sea surface temperature data were collected in a world wide distribution from January 1, 1971 to December 31, 2000. Data were submitted by Japan Meteorological...
International Nuclear Information System (INIS)
Leighton, H.I.
1976-02-01
The January 1976 data for Solar--Geophysical Data, prompt reports for January 1976--December 1975, Part 1, include sections on alert period, daily solar indices, solar flares, solar radio waves, solar wind measurement, spacecraft observations, solar x radiation, coronal holes, and inferred IP magnetic field polarities. The December 1975 data include daily solar activity centers, sudden ionospheric disturbances, solar radio waves, cosmic rays, geomagnetic indices, and radio propagation indices
International Nuclear Information System (INIS)
Holland, L.M.; Stafford, C.G.; Bolen, S.K.
1981-09-01
Highlights of research progress accomplished in the Life Sciences Division during the year ending December 1980 are summarized. Reports from the following groups are included: Toxicology, Biophysics, Genetics; Environmental Pathology, Organic Chemistry, and Environmental Sciences. Individual abstracts have been prepared for 46 items for inclusion in the Energy Data Base
Geophysical investigations in the 100 Areas: Fiscal year 1991 through December 1993
Mitchell, T. H.
1994-09-01
The geophysical investigations identified in this document were conducted by the Westinghouse Hanford Company (WHC) Surface Geophysics Team, Geophysics Group, between October, 1991 and December, 1993. The investigations supported 100-Area activities for the Resource Conservation and Recovery Act of 1976 (RCRA) and the Comprehensive Environmental Response, Compensations and Liability Act of 1980 (CERCLA). The primary intent of this document is to provide a general map location and the associated document number for investigations that have been conducted as of December, 1993. The results of the individual investigations are not included here. The results of all of these investigations have been previously reported individually in WHC supporting documents. The investigations conducted during Fiscal Year (FY) 1992 are summarized in a single WHC document, WHC-SD-EN-TI-204, Rev. O. A brief summary of some of the successful applications of geophysics in the 100-Areas is included.
International Nuclear Information System (INIS)
Coffey, H.E.
1978-02-01
This prompt report provides data for January 1978 on alert period, daily solar indices, solar flares, solar radio waves, solar x-ray radiation, coronal holes, spacecraft observations, inferred IP magnetic field polarities, mean solar magnetic field and solar wind measurements. It also provides data for December 1977 on daily solar activity center, sudden ionospheric disturbances, solar radio waves, cosmic rays, geomagnetic indices, and radio propagation indices
Physics Department. Annual progress report 1 January - 31 December 1989
International Nuclear Information System (INIS)
Als-Nielsen, J.; Skov Pedersen, J.; Juul Rasmussen, J.; Lebech, B.
1990-02-01
Research in the Physics Department covers two main fields: condensed matter physics and plasma physics. The principal activites in these fields are presented in this Progress Report covering the period from 1 January to 31 December 1989. The condensed matter physics research is predominantly experimental utilising diffraction of neutrons and x-rays. The research topics range from studies of two- and three-dimensional structures, magnetic ordering, heavy fermions, phase transitions in model systems to studies of texture and recrystallization kinetics with a more applied nature. The discovery of the high Tc superconductors in 1986 has opened an important new research area, where neutron and x-ray diffraction are used to elucidate the basic mechanism responsible for the superconductivity and in the analysis of the solid state syntheses used in producing the materials. The plasma physics research is partly experimental and partly theoretical. The plasma physics programme is also of a wide scope ranging from fundamental studies of wave propagation, instabilities, solitons and turbulence in plasmas to refuelling a fusion reactor by deuterium-tritium pellets. (author) 4 tabs., 66 ills., 71 refs
2009-09-15
basketball (24 percent), weightlifting (19 percent), PT (18 percent), and football (14 percent). Injury Prevention Report No. 12-HF-0C7F-10, 1 Jan... INJURY PREVENTION REPORT NO. 12-HF-0C7F-10 U.S. ARMY DEPLOYMENT INJURY SURVEILLANCE SUMMARY CALENDAR YEAR 2008 1 JANUARY 2008–31...2008 – 31 December 2008 4. TITLE AND SUBTITLE U.S. Army Deployment Injury Surveillance Summary 2008 5a. CONTRACT NUMBER n/a 5b. GRANT NUMBER
Progress Toward Poliomyelitis Eradication - Nigeria, January-December 2017.
Bolu, Omotayo; Nnadi, Chimeremma; Damisa, Eunice; Braka, Fiona; Siddique, Anisur; Archer, W Roodly; Bammeke, Philip; Banda, Richard; Higgins, Jeffrey; Edukugo, Aboyowa; Nganda, Gatei Wa; Forbi, Joseph C; Liu, Hongmei; Gidado, Saheed; Soghaier, Mohammed; Franka, Richard; Waziri, Ndadilnasiya; Burns, Cara C; Vertefeuille, John; Wiesen, Eric; Adamu, Usman
2018-03-02
Nearly three decades after the World Health Assembly launched the Global Polio Eradication Initiative in 1988, four of the six World Health Organization (WHO) regions have been certified polio-free (1). Nigeria is one of three countries, including Pakistan and Afghanistan, where wild poliovirus (WPV) transmission has never been interrupted. In September 2015, after >1 year without any reported WPV cases, Nigeria was removed from WHO's list of countries with endemic WPV transmission (2); however, during August and September 2016, four type 1 WPV (WPV1) cases were reported from Borno State, a state in northeastern Nigeria experiencing a violent insurgency (3). The Nigerian government, in collaboration with partners, launched a large-scale coordinated response to the outbreak (3). This report describes progress in polio eradication activities in Nigeria during January-December 2017 and updates previous reports (3-5). No WPV cases have been reported in Nigeria since September 2016; the latest case had onset of paralysis on August 21, 2016 (3). However, polio surveillance has not been feasible in insurgent-controlled areas of Borno State. Implementation of new strategies has helped mitigate the challenges of reaching and vaccinating children living in security-compromised areas, and other strategies are planned. Despite these initiatives, however, approximately 130,000-210,000 (28%-45%) of the estimated 469,000 eligible children living in inaccessible areas in 2016 have not been vaccinated. Sustained efforts to optimize surveillance and improve immunization coverage, especially among children in inaccessible areas, are needed.
Spectroscopy Division progress report for January 1987 - December 1988
International Nuclear Information System (INIS)
Dixit, R.M.
1989-01-01
During the period January 1987 - December 1988, the Spectroscopy Division has carried out research and development in many areas of analytical spectroscopy, atomic spectra and spectra of diatomic and polyatomic molecules. The Division has acquired an ICP spectrometer and an excimer laser pumped dye laser during this period and they have been used very fruitfully for research and development. Research in high resolution atomic spectroscopy has continued to flourish. Beam foil spectroscopy and spectroscopy of low energy plasma focus sources have been put on a firm foundation. Setting up of new experimental systems for solid state spectral studies at liquid helium temperatures have been started. A good amount of theoretical work in forbidden transitions, has been carried out. Diode laser spectroscopy has been used for high precision intensity and frequency measurements. Service facilities like quality control analysis of nuclear materials and supply of optical components and thin film devices have performed with maximum efficiency. The electronics and instrumentation group has developed several facilities for various experimental set ups. Brief description of all these and other activities of the Division are given in the present progress report. A list of publications and a divisional staff chart are also given. (author). figs., tabs
International Nuclear Information System (INIS)
Gonzalez, D.A.
1986-09-01
This report documents the environmental surveillance program at the Nevada Test Site as conducted by the Department of Energy (DOE) onsite radiological safety contractor from January 1985 through December 1985. The results and evaluations of measurements of radioactivity in air and water, and of direct gamma radiation exposure rates are presented. Relevancy to DOE concentration guides (CG'S) is established. This report was formerly titled ''Environmental Surveillance Report for the Nevada Test Site.''
International Nuclear Information System (INIS)
Kline A, Paul; Heindel A, Jeff
1999-01-01
On November 20, 1991, the National Marine Fisheries Service listed Snake River sockeye salmon as endangered under the Endangered Species Act of 1973. In 1991, the Idaho Department of Fish and Game, the Shoshone-Bannock Tribes, and NMFS initiated efforts to conserve and rebuild populations in Idaho. Captive broodstock program activities conducted between January 1, 1998 and December 31, 1998, are presented in this report
Safeguards and security progress report, January-December 1983
Energy Technology Data Exchange (ETDEWEB)
Smith, D.B. (comp.)
1984-09-01
From January to December 1983, the Los Alamos Safeguards and Security Program was involved in the activities described in the first four parts of this report: Nuclear Facility Support, Security Development and Support, Safeguards Technology Development, and International Safeguards. Part 1 covers efforts of direct assistance to the Department of Energy (DOE) and Nuclear Regulatory Commission (NRC) licensee facilities. This assistance includes consultation on materials accounting problems, development of specialized techniques and instruments, and comprehensive participation in the design and implementation of advanced safeguards systems. In addition, a series of training courses in various aspects of safeguards makes the technology more accessible to those who must apply it. Part 2 treats activities aimed at the security of information and computer systems. Our focus this peiod was on continuing the activities of the Computer Security Center, which provides the basis for encouraging and disseminating this emerging technology, and on the development and demonstration of secure computer systems. Part 3 describes the broad development efforts essential to continuing improvements in the practice of safeguards. Although these projects are properly classified as developmental, they address recognized problems that commonly occur in operating facilities. Finally, Part 4 covers international safeguards activities, including both support to the International Atomic Energy Agency and bilateral exchanges. Enrichment plant safeguards, especially those concerning the Gas Centrifuge Enrichment Plant, required a significant portion of our resources. These efforts are beginning to provide substantial returns on our investment in technology transfer, not only in raising the level of safeguards effectiveness but also in our benefiting from field experiences in operating environments.
Safeguards and security progress report, January-December 1985
International Nuclear Information System (INIS)
1987-03-01
From January to December 1985, the Los Alamos Safeguards and Security Program was involved in the activities described in the first four parts of this report: Safeguards Operations, Security Development and Support, Safeguards Technology Development, and International Support. Part 1 covers efforts of direct assistance to the Department of Energy and Nuclear Regulatory Commission licensee facilities. This assistance includes consultation on materials accounting problems, development and demonstration of specialized techniques and instruments, and comprehensive participation in the design and evaluation of advanced safeguards systems. In addition, a series of training courses in various aspects of safeguards makes the technology more accessible to those who must apply it. Part 2 treats activities aimed at the security of information and computer systems. Our focus this period was on continuing the activities of the Center for Computer Security, which provides the basis for encouraging and disseminating this emerging technology, and on the development and demonstration of secure computer systems. Part 3 describes the broad development efforts essential to continuing improvements in the practice of safeguards. Although these projects are properly classified as developmental, they address recognized problems that commonly occur in operating facilities. Finally, Part 4 covers international safeguards activities, including both support to the International Atomic Energy Agency and bilateral exchanges. Enrichment plant safeguards and international safeguards for reprocessing plants required a significant portion of our resources. All of these efforts are beginning to provide substantial returns on our investment in technology transfer, not only in raising the level of safeguards effectiveness but also in our benefiting from field experiences in operating environments
Safeguards and security progress report, January-December 1985
Energy Technology Data Exchange (ETDEWEB)
1987-03-01
From January to December 1985, the Los Alamos Safeguards and Security Program was involved in the activities described in the first four parts of this report: Safeguards Operations, Security Development and Support, Safeguards Technology Development, and International Support. Part 1 covers efforts of direct assistance to the Department of Energy and Nuclear Regulatory Commission licensee facilities. This assistance includes consultation on materials accounting problems, development and demonstration of specialized techniques and instruments, and comprehensive participation in the design and evaluation of advanced safeguards systems. In addition, a series of training courses in various aspects of safeguards makes the technology more accessible to those who must apply it. Part 2 treats activities aimed at the security of information and computer systems. Our focus this period was on continuing the activities of the Center for Computer Security, which provides the basis for encouraging and disseminating this emerging technology, and on the development and demonstration of secure computer systems. Part 3 describes the broad development efforts essential to continuing improvements in the practice of safeguards. Although these projects are properly classified as developmental, they address recognized problems that commonly occur in operating facilities. Finally, Part 4 covers international safeguards activities, including both support to the International Atomic Energy Agency and bilateral exchanges. Enrichment plant safeguards and international safeguards for reprocessing plants required a significant portion of our resources. All of these efforts are beginning to provide substantial returns on our investment in technology transfer, not only in raising the level of safeguards effectiveness but also in our benefiting from field experiences in operating environments.
Safeguards and Security progress report, January--December 1989
Energy Technology Data Exchange (ETDEWEB)
Smith, D.B.; Jaramillo, G.R. (comps.)
1990-11-01
From January to December 1989, the Los Alamos Safeguards and Security Research and Development (R D) program carried out the activities described in the first four parts of this report: Science and Technology Base Development, Basic Systems Design, Onsite Test and Evaluation and Facility Support, and International Safeguards. For the most part, these activities were sponsored by the Department of Energy's Office of Safeguards and Security. Part 1 covers development of the basic technology essential to continuing improvements in the practice of safeguards and security. It includes our computer security R D and the activities of the DOE Center for Computer Security, which provides the basis for encouraging and disseminating this important technology. Part 2 treats activities aimed at developing methods for designing and evaluating safeguards systems, with special emphasis on the integration of the several subsystems into a real safeguards system. Part 3 describes efforts of direct assistance to the DOE and its contractors and includes consultation on materials control and accounting problems, development and demonstration of specialized techniques and instruments, and comprehensive participation in the design and demonstration of advanced safeguards systems. Part 3 also reports a series of training courses in various aspects of safeguards that makes the technology more accessible to those who must apply it. Finally, Part 4 covers international safeguards activities, including both support to the International Atomic Energy Agency and bilateral exchanges. Part 5 reports several safeguards-related activities that have sponsors other than the DOE/OSS. 87 refs., 52 figs.
Safeguards and security progress report, January-December 1983
International Nuclear Information System (INIS)
Smith, D.B.
1984-09-01
From January to December 1983, the Los Alamos Safeguards and Security Program was involved in the activities described in the first four parts of this report: Nuclear Facility Support, Security Development and Support, Safeguards Technology Development, and International Safeguards. Part 1 covers efforts of direct assistance to the Department of Energy (DOE) and Nuclear Regulatory Commission (NRC) licensee facilities. This assistance includes consultation on materials accounting problems, development of specialized techniques and instruments, and comprehensive participation in the design and implementation of advanced safeguards systems. In addition, a series of training courses in various aspects of safeguards makes the technology more accessible to those who must apply it. Part 2 treats activities aimed at the security of information and computer systems. Our focus this peiod was on continuing the activities of the Computer Security Center, which provides the basis for encouraging and disseminating this emerging technology, and on the development and demonstration of secure computer systems. Part 3 describes the broad development efforts essential to continuing improvements in the practice of safeguards. Although these projects are properly classified as developmental, they address recognized problems that commonly occur in operating facilities. Finally, Part 4 covers international safeguards activities, including both support to the International Atomic Energy Agency and bilateral exchanges. Enrichment plant safeguards, especially those concerning the Gas Centrifuge Enrichment Plant, required a significant portion of our resources. These efforts are beginning to provide substantial returns on our investment in technology transfer, not only in raising the level of safeguards effectiveness but also in our benefiting from field experiences in operating environments
Search for TeV gamma rays from SN1987A during December 1987 and January 1988
International Nuclear Information System (INIS)
Bond, I.A.; Conway, M.J.; Budding, E.
1988-04-01
Very high energy γ rays from the supernova SN1987A were searched for at the Black Birch Range in New Zealand during December 1987 and January 1988. The total data obtained during 42 hours of observation time give an upper bound on the flux at 95 % confidence level of 6.1 x 10 -12 cm -2 s -1 for γ rays with energies larger than 3 TeV. Data obtained on January 14 and 15 are found to have excess counts, above the background level, corresponding to a flux of (1.9 ± 0.5) x 10 -11 cm -2 s -1 . The energy emitted in TeV γ rays, by attributing this excess to γ rays from SN1987A, is calculated ∼ 10 43 erg assuming that the duration of the excess was 2 ∼ 3 days. PACS numbers: 97.60.Bw, 95.85.Qx. (author)
Clermont-Ferrand Corpuscular Physics Laboratory - LPCCF. Activity report January 2006-December 2007
International Nuclear Information System (INIS)
2008-01-01
The Clermont-Ferrand Corpuscular Physics Laboratory is a joint research unit of the Blaise Pascal University and the National Centre for Scientific Research (CNRS) which belongs to the French National Institute of Nuclear and particle physics (IN2P3). The main research topic, 'Particle physics' and 'Hadronic matter', represents about 3/4 of the laboratory activities and are carried out in the framework of big international cooperations. Other activities of LPCCF are pluri-disciplinary and are related to nuclear physics applications, like isotope dating, low radioactivities, low-dose biological radiation effects, biomaterials, medical imaging etc.. This report presents the activities of the laboratory from January 2006 to December 2007: 1 - Forewords; 2 - Theoretical physics; 3 - Particle physics; 4 - Hadronic matter; 5 - Interdisciplinary research; 6 - Technical and administrative services; 7 - Laboratory organisation and means; 8 - Teaching activity; 9 - Communication; 10 - Regional policy and valorisation; 11 - Scientific production 12 - Staff
Tennessee health studies agreement. Annual report for year 5, January 1 - December 31, 1996
International Nuclear Information System (INIS)
1997-05-01
This report summarizes the Oak Ridge Health Studies project for the period January 1, 1996, to December 31, 1996. Attention is focused on dose reconstruction which is comprised of seven separate tasks. They are: Task 1, investigation of radioiodine from radioactive lanthanum processing; Task 2, investigation of mercury releases from lithium enrichment; Task 3, investigation of releases of PCBs from Oak Ridge facilities; Task 4, investigation of releases of radionuclides from White Oak Creek to the Clinch River; Task 5, plan to perform a systematic document search; Task 6, investigation of the quality of historical uranium effluent monitoring of Oak Ridge facilities; and Task 7, additional screening of materials not evaluated in the dose reconstruction feasibility study
Tennessee health studies agreement. Annual report for year 5, January 1--December 31, 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-05-01
This report summarizes the Oak Ridge Health Studies project for the period January 1, 1996, to December 31, 1996. Attention is focused on dose reconstruction which is comprised of seven separate tasks. They are: Task 1, investigation of radioiodine from radioactive lanthanum processing; Task 2, investigation of mercury releases from lithium enrichment; Task 3, investigation of releases of PCBs from Oak Ridge facilities; Task 4, investigation of releases of radionuclides from White Oak Creek to the Clinch River; Task 5, plan to perform a systematic document search; Task 6, investigation of the quality of historical uranium effluent monitoring of Oak Ridge facilities; and Task 7, additional screening of materials not evaluated in the dose reconstruction feasibility study.
National Oceanic and Atmospheric Administration, Department of Commerce — Biological and chemical data were collected using net, buoy, and bottle casts from the GUS III and LONGHORN in the Gulf of Mexico from 01 January 1961 to 01 December...
DEFF Research Database (Denmark)
Krøjgaard, Louise Hjelmar; Krogfelt, K. A.; Albrechtsen, Hans-Jørgen
2011-01-01
During December 2008 to January 2009, two persons contracted Legionnaires' disease in a newly built block of flats in a suburb of Copenhagen in Denmark. Polymerase chain reaction and culture was used to diagnose Legionnaires' disease in this cluster. Isolates from both patients tested positive...... for Legionella pneumophila serogroup 1 subgroup Philadelphia sequence type 1 and the same strain was detected in hot water samples taken from the residential area indicating that the hot water supply system was the most likely source of infection. Legionella was not detected in the cold water. Two interventions...
Energy Technology Data Exchange (ETDEWEB)
Holland, L.M.; Stafford, C.G.; Bolen, S.K. (comps.)
1981-09-01
Highlights of research progress accomplished in the Life Sciences Division during the year ending December 1980 are summarized. Reports from the following groups are included: Toxicology, Biophysics, Genetics; Environmental Pathology, Organic Chemistry, and Environmental Sciences. Individual abstracts have been prepared for 46 items for inclusion in the Energy Data Base. (RJC)
National Oceanic and Atmospheric Administration, Department of Commerce — temperature profile and oxygen data were collected from multiple ships from January 4, 1899 to December 4, 1992. These data were collected using bottle in the...
Energy Technology Data Exchange (ETDEWEB)
None
1979-05-01
This 1978 Annual Abstracts represents the publishing experience over the past year of the three divisions and one group that make up the Environmental Sciences area of the Department of Energy and Environment. The abstracts are grouped according to the organization of the authors under the Atmospheric Sciences, Environmental Chemistry, and Oceanographic Sciences Division and the Land and Fresh Water Environmental Sciences Group. The range of interests and the interdisciplinary nature of the activities within Environmental Programs are demonstrated by these abstracts. Most of these activities relate in some way to the environmental effects or potential effects of energy generation. The major areas involved include: coastal meteorology; physical, biological, and chemical oceanography of the coastal shelf; analysis of marine, fresh water, and terrestrial ecosystems; effects of acid rain and other pollutants on aquatic and terrestrial systems; Multistate Power Production Pollution Study (MAP3S), including transport and transformation experiments, data management, and modeling and analysis; atmospheric diagnostics including the study of the chemistry of pollutants in plumes and ambient atmosphere; basic and applied studies of atmospheric aerosol generation, composition, and behavior; and development of atmospheric tracer systems and real-time instrumentation.
International Nuclear Information System (INIS)
1979-05-01
This 1978 Annual Abstracts represents the publishing experience over the past year of the three divisions and one group that make up the Environmental Sciences area of the Department of Energy and Environment. The abstracts are grouped according to the organization of the authors under the Atmospheric Sciences, Environmental Chemistry, and Oceanographic Sciences Division and the Land and Fresh Water Environmental Sciences Group. The range of interests and the interdisciplinary nature of the activities within Environmental Programs are demonstrated by these abstracts. Most of these activities relate in some way to the environmental effects or potential effects of energy generation. The major areas involved include: coastal meteorology; physical, biological, and chemical oceanography of the coastal shelf; analysis of marine, fresh water, and terrestrial ecosystems; effects of acid rain and other pollutants on aquatic and terrestrial systems; Multistate Power Production Pollution Study (MAP3S), including transport and transformation experiments, data management, and modeling and analysis; atmospheric diagnostics including the study of the chemistry of pollutants in plumes and ambient atmosphere; basic and applied studies of atmospheric aerosol generation, composition, and behavior; and development of atmospheric tracer systems and real-time instrumentation
National Oceanic and Atmospheric Administration, Department of Commerce — Physical data were collected from XBT casts from the Indian Ocean. Data were collected from 01 January 2001 to 31 December 2001. Data were submitted by the...
National Oceanic and Atmospheric Administration, Department of Commerce — Physical data were collected from XBT casts from the Indian Ocean. Data were collected from 01 January 2000 to 31 December 2000. Data were submitted by the...
National Oceanic and Atmospheric Administration, Department of Commerce — Physical data were collected from XBT casts from the Indian Ocean. Data were collected from 31 December 1993 to 07 January 1994. Data were submitted by the...
National Oceanic and Atmospheric Administration, Department of Commerce — Physical data were collected from XBT casts from the Indian Ocean. Data were collected from 01 January 2002 to 31 December 2002. Data were submitted by the...
Energy Technology Data Exchange (ETDEWEB)
McCone, John A.
1961-01-31
The document covers activities for the period January - December 1960. The report consists of two parts: Part One, The Atomic Energy Industry in 1960 and Related Activities; and Part Two, Major Activities in Atomic Energy Programs. Twenty-one appendices are also included.
Yucca Mountain Biological Resources Monitoring Program. Progress report, January 1994--December 1994
International Nuclear Information System (INIS)
1995-07-01
The US Department of Energy (DOE) is required by the Nuclear Waste Policy Act of 1982 (as amended in 1987) to study and characterize the suitability of Yucca Mountain as a potential geological repository for high-level nuclear waste. During site characterization, the DOE will conduct a variety of geotechnical, geochemical, geological, and hydrological studies to determine the suitability of Yucca Mountain as a potential repository. To ensure that site characterization activities do not adversely affect the environment at Yucca Mountain, a program has been implemented to monitor and mitigate potential impacts and ensure activities comply with applicable environmental regulations. This report describes the activities and accomplishments of EG and G Energy Measurements, Inc. (EG and G/EM) from January 1994 through December 1994 for six program areas within the Terrestrial Ecosystem component of the environmental program for the Yucca Mountain Site Characterization Project (YMP): Site Characterization Effects, Desert Tortoises (Gopherus agassizii), Habitat Reclamation, Monitoring and Mitigation, Radiological Monitoring, and Biological Support
Affirmative Action Plans, January 1, 1994--December 31, 1994. Revision
Energy Technology Data Exchange (ETDEWEB)
1994-02-16
This document is the Affirmative Action Plan for January 1, 1994 through December 31, 1994 for the Lawrence Berkeley Laboratory, University of California (``LBL`` or ``the Laboratory.``) This is an official document that will be presented upon request to the Office of Federal Contract Compliance Programs, US Department of Labor. The plan is prepared in accordance with the Executive Order 11246 and 41 CFR Section 60-1 et seq. covering equal employment opportunity and will be updated during the year, if appropriate. Analyses included in this volume as required by government regulations are based on statistical comparisons. All statistical comparisons involve the use of geographic areas and various sources of statistics. The geographic areas and sources of statistics used here are in compliance with the government regulations, as interpreted. The use of any geographic area or statistic does not indicate agreement that the geographic area is the most appropriate or that the statistic is the most relevant. The use of such geographic areas and statistics is intended to have no significance outside the context of this Affirmative Action Plan, although, of course, such statistics and geographic areas will be used in good faith with respect to this Affirmative Action Plan.
National Oceanic and Atmospheric Administration, Department of Commerce — Nutrients, salinity, temperature, and other data were collected from multiple ships from January 1, 1999 to December 31, 1999. Data were submitted by Messina...
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
The Report comprises abstracts of 59 communications presented during the 40. Polish Seminar on Nuclear Magnetic Resonance and Its Applications, held on December 3-4, 2007 in Cracow (PL). They cover a variety of research fields, including magnetic resonance imaging in vivo, applications of NMR spectroscopy to medical diagnosis, studies on molecular properties of different materials as well as quantum chemical calculations of NMR parameters.
International Nuclear Information System (INIS)
2007-01-01
The Report comprises abstracts of 59 communications presented during the 40. Polish Seminar on Nuclear Magnetic Resonance and Its Applications, held on December 3-4, 2007 in Cracow (PL). They cover a variety of research fields, including magnetic resonance imaging in vivo, applications of NMR spectroscopy to medical diagnosis, studies on molecular properties of different materials as well as quantum chemical calculations of NMR parameters
Tennessee health studies agreement. Annual report for year 4, January 1 - December 31, 1995
International Nuclear Information System (INIS)
1996-04-01
The Tennessee Department of Health (TDH) has completed the fourth full year of the Oak Ridge Health Studies Agreement grant. This report summarizes the accomplishments and concerns of the State for the period January 1, 1995, to December 31, 1995. The focus of work during the fourth grant year was the actual work on the dose reconstruction. The final work plan for Task 5, Plan to Perform a Systematic Document Search was received in November 1994. Final work plans for Task 1, Investigation of Radioiodine from Radioactive Lanthanum Processing; Task 2, Investigation of Mercury Releases from Lithium Enrichment; Task 3, Investigation of Releases of PCBs from Oak Ridge Facilities; and Task 4, Investigation of Releases of Radionuclides from White Oak Creek to the Clinch River, were received in February 1995. Final work plans for Task 6, Investigation of the Quality of Historical Uranium Effluent Monitoring at Oak Ridge Facilities; and Task 7, Additional Screening of Materials Not Evaluated in the Dose Reconstruction Feasibility Study, were received in April 1995. ChemRisk's 4th Quarterly Report, for October through December 1995, is included in Attachment 1. Attachment 2 contains a study which developed a quality improvement program for data imported to the Tennessee Cancer Reporting System and Birth Defects Verification Program
The December 2004-January 2005 floods in the Garden Route region of the Southern Cape, South Africa
Directory of Open Access Journals (Sweden)
Johan Tempelhoff
2009-04-01
Full Text Available The December 2004-January 2005 floods in the Garden Route region of the Southern Cape in South Africa have had a significant impact on local development and economic activities, tourism products andlocal institutions. This article aims to capture the dynamism between a number of related fields within the context of transdisciplinary research. Qualitative research methods were used to target a representative sample of the affected population. This article considers the history of the flooding events of December 2004/January 2005 along the Garden Route, as well as the manner in which emergency/disaster management personnel responded to the crisis. The effect of the floods on the tourism sector along the Garden Route was researched in general and the effects of the floods on tourists, local residents, and particularly communities in disadvantaged areas were specifically determined. The research reflects on the disaster risk management strategies that were in place at the time of the floods to determine what local authorities could have done to cope with the potential conditions of crisis. The research found that although some tourism products were severely affected, the 2004/2005 floods did not have a significant impact on the number of tourists frequenting the area. In terms of disaster risk management, concerns remain regarding the lack of the following factors: capacity, adequate early warning systems, proper infrastructure maintenance, local institutions, and an in-depth understanding of the disaster risk profile of the area.
Safeguards Summary Event List (SSEL), January 1, 1990--December 31, 1996, Vol. 2, Rev. 5
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-07-01
The Safeguards Summary Event List (SSEL), Vol. 2, Rev. 5, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990, through December 31, 1996. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of Bomb-related, Intrusion, Missing and/or Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms, Radiological Sabotage, Nonradiological Sabotage, and Miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels.
Safeguards Summary Event List (SSEL), January 1, 1990--December 31, 1996, Vol. 2, Rev. 5
International Nuclear Information System (INIS)
1997-07-01
The Safeguards Summary Event List (SSEL), Vol. 2, Rev. 5, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990, through December 31, 1996. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of Bomb-related, Intrusion, Missing and/or Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms, Radiological Sabotage, Nonradiological Sabotage, and Miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels
Energy situation. January 2004
International Nuclear Information System (INIS)
2004-02-01
This report makes a status of the French energy expenses, prices, production, consumption, demand, import and export since January 2001 and up to December 2003 or January 2004. Details are given separately for primary energy, solid mineral fuels, petroleum products, natural gas and electric power. (J.S.)
Physics Department annual progress report 1 January - 31 December 1983
International Nuclear Information System (INIS)
Als-Nielsen, J.; Lebech, B.
1984-03-01
Research in the Physics Department at Risoe National Laboratory covers three main fields: Condensed Matter Physics, Plasma Physics and Meteorology. The principal activities in these fields for the period from 1 January to 31 December 1983 are described. The condensed matters physics research is predominantly experimental utilising diffraction of neutrons and X-rays. The research topics range from studies of structure, excitations and phase transitions in model systems to studies of ion transport, texture and recrystallization kinetics with a more applied nature. The plasma physics research is partly experimental and partly theoretical. A study of pellet-plasma interaction is of applied nature and aimed at assessing the possibilities of refuelling a fusion reactor by shooting deuterium-tritium pellets into the plasma. A study of the fundamental physics of plasmas deals with investigations of wave propagation properties, instabilities, solitons, turbulence, etc. The research and applied work within meteorology lies within micrometeorology and the subjects range from surface energy balance studies, over studies of the general structure of atmospheric coherence and boundary layer response to change in surface elevation, to specific studies of turbulent dispersion and deposition of airborne material. As part of the applied work within meteorology and wind energy, the test station for small windmills tests and licences windmills for the Danish market and offers consulting assistance for the Danish windmill manufacturers. (Auth.)
Radiological and Environmental Research Division annual report, January-December 1981: ecology
International Nuclear Information System (INIS)
1982-07-01
Highlights of progress accomplished during the year ending December 1981 are presented. Some of the subjects discussed are: the effects of acid deposition on crop-soil systems; the effects of energy-related pollutants on crops, including field corn, which was found to be quite resistant to both O 3 and SO 2 ; the synergistic effects of SO 2 and NO/sub x/ on soybean productivity; the impact of acid rain on food crops and the dependence of these effects on the chemical composition of rain; the effects of acid rain on soil systems; 239 240 Pu, 241 Am, and 243 244 Am in a core from the Saquenay Fjord, Quebec; rate of removal of natural thorium isotopes from Lake Michigan water; influence of colloidal dissolved organic carbon on the sorption of plutonium on natural sediments; the behavior of americium in natural waters; and near-bottom currents and sediment resuspension in Lake Michigan. Separate abstracts have been prepared for 12 reports for inclusion in the Energy Data Base
International Nuclear Information System (INIS)
Manenti, Simone; Alí Santoro, María del Carmen; Cotogno, Giulio; Duchemin, Charlotte; Haddad, Ferid; Holzwarth, Uwe; Groppi, Flavia
2017-01-01
Deuteron-induced nuclear reactions for the generation of 103 Pd were investigated using the stacked-foil activation technique on rhodium targets at deuteron energies up to E d = 33 MeV. The excitation functions of the reactions 103 Rh(d,xn) 101,103 Pd, 103 Rh(d,x) 100g,cum,101m,g,102m,g Rh and 103 Rh(d,2p) 103 Ru have been measured, and the Thick-Target Yield for 103 Pd has been calculated.
Holmes, Robert R.; Watson, Kara M.; Harris, Thomas E.
2016-06-16
Flooding occurred in the central and southeastern United States during December 2015 and January 2016. The flooding was the result of more than 20 inches of rain falling in a 19 day period from December 12 to December 31, 2015. U.S. Geological Survey streamgages recorded 23 peaks of record during the subsequent flooding, with a total of 172 streamgages recording peaks that ranked in the top 5 all time for the period of record.
International Nuclear Information System (INIS)
Boutin, R. J.
1999-01-01
This annual summary report discusses the interim remedial actions at the 100-HR-3 and 100-KR-4 Operable Units (OUs) for February 1,1998, through December 31, 1998. This is the second annual summary report that has been submitted for these OUs; the first report was released in April 1998 (DOE-RL 1998). Ongoing annual summaries and performance evaluations of each of the pump-and-treat systems are required by the Remedial Design Report and Remedial Action Work Plan for the 100-HR-3 and 100-KR-4 Groundwater Operable Units' Interim Action (RDR/RAWP) (DOE-RL 1996)
National Oceanic and Atmospheric Administration, Department of Commerce — XBT data were collected from MULTIPLE PLATFORMS from a World-Wide distribution from 02 January 1990 to 31 December 1995. Data were submitted by the UK Hydrographic...
IMP annual report, 1988 (January-December)
International Nuclear Information System (INIS)
1990-06-01
The research activities of Institute of Modern Physics, Academia Sinica of China, during the year of 1988, was summarized in this annual report. A highlight of these activities during the year was the progress of HIRFL project. HIRFL was delivered successfully 50 MeV/A 12 C beam on december 12, 1988. The scientific paper contained in this annual report are concerning to the fundamental scientific research, mainly nuclear physics. The development on experimental technique and the research on application of nuclear techniques have been reported also. It divided into ten parts, more than ninety pieces of short notes were presented
Physics Department annual progress report 1 January - 31 December 1982
International Nuclear Information System (INIS)
1983-09-01
Research in the Physics Department at Risoe National Laboratory covers three main fields: condensed matter physics, plasma physics and meteorology. The report is a progress report describing the principal activities in these fields for the period from 1 January to 31 December 1982. The condensed matter physics research is predominantly experimental utilising diffraction of neutrons, X-rays, and synchrotron X-ray radiation. The research topics range from studies of structure, excitations and phase transitions in model systems to studies of ion transport, texture and recrystallization kinetics with a more applied nature. The plasma physics research is partly experimental and partly theoretical. A study of pellet-plasma interaction is of applied nature and aimed at assessing the possibilities of refuelling a fusion reactor by shooting deuterium-tritium pellets into the plasma. A study of the fundamental physics of plasmas deals with investigations of wave propagation properties, instabilities, solitons, turbulence, etc. The research and applied work within meteorology lies within micrometereology and the subjects range from surface energy balance studies, over studies of the general structure of atmospheric coherence and boundary layer response to change in surface elevation, to specific studies of turbulent dispersion and deposition of airborne material. As part of the applied work within meteorology and wind energy, the test station for small windmills tests and licences windmills for the Danish market and offers consulting assistance for the Danish windmill manufacturers. (Auth.)
Radiological and Environmental Research Division annual report, January-December 1981: ecology
Energy Technology Data Exchange (ETDEWEB)
1982-07-01
Highlights of progress accomplished during the year ending December 1981 are presented. Some of the subjects discussed are: the effects of acid deposition on crop-soil systems; the effects of energy-related pollutants on crops, including field corn, which was found to be quite resistant to both O/sub 3/ and SO/sub 2/; the synergistic effects of SO/sub 2/ and NO/sub x/ on soybean productivity; the impact of acid rain on food crops and the dependence of these effects on the chemical composition of rain; the effects of acid rain on soil systems; /sup 239/ /sup 240/Pu, /sup 241/Am, and /sup 243/ /sup 244/Am in a core from the Saquenay Fjord, Quebec; rate of removal of natural thorium isotopes from Lake Michigan water; influence of colloidal dissolved organic carbon on the sorption of plutonium on natural sediments; the behavior of americium in natural waters; and near-bottom currents and sediment resuspension in Lake Michigan. Separate abstracts have been prepared for 12 reports for inclusion in the Energy Data Base. (RJC)
International Nuclear Information System (INIS)
Coffey, H.E.
1990-02-01
Contents include: detailed index for 1989-1990; data for January 1990--solar-terrestrial environment, IUWDS alert periods (advance and worldwide), solar activity indices, solar flares, solar radio emission, Stanford mean solar magnetic field; data for December 1989--solar-active regions, sudden ionospheric disturbances, solar radio spectral observations, cosmic-ray measurements by neutron monitor, geomagnetic indices; late data--cosmic-ray measurements by neutron monitor, reprint of halftone-page Kitt Peak solar magnetic field synoptic chart November 1989
Spectroscopy Division progress report for January 1985-December 1986
International Nuclear Information System (INIS)
Bellary, V.P.; Balasubramanian, T.K.
1987-01-01
The present report describes the activities of the Spectroscopy Division during the period January 1985-December 1986. Besides meeting the analytical requirements connected with the nuclear energy programmes and the related research and development projects, the Division has continued its efforts to develop and set-up new techniques to improve the speed and efficiency of the analytical capabilities and carry out basic research on atomic and molecular systems of importance to the programmes of the research centre. In the first section of the report, two feature articles, one on Laser Magnetic Resonance Spectroscopy and the other on Nuclear Spins, Moments and Charge Radii of short-lived isotopes and isomers using Laser Spectroscopic Techniques are included. The second section deals with the characterisation of the materials using optical emission, X-ray fluorescence and X-ray excited optical luminescence techniques. Work connected with basic research on atomic and molecular systems is described in the third section. Work on atomic systems includes high resolution studies on rare-earth ions in free and condensed states and the evaluation of the nuclear properties of short-lived radioactive elements. Work on molecular systems includes theoretical aspects pertaining to rotational intensities in forbidden transitions of diatomic molecules, high resolution spectral studies of diatomic molecules and free radicals, laser spectroscopy of alkali dimers. The fourth and fifth sections deal with the work concerning the designing and fabrication of sophisticated optical equipments and electronic components and system required for the various research and development programmes in the Division. Members of the Division continued to participate in the teaching programmes, guiding research leading to M.Sc. and Ph.D. degrees, training in spectrochemical analysis and in symposia and conferences. These activities are described in the last section of the report. (author)
Investigation of palladium-103 production and IR07-103Pd brachytherapy seed preparation
International Nuclear Information System (INIS)
Saidi, Pooneh; Sadeghi, Mahdi; Enferadi, Milad; Aslani, Gholamreza
2011-01-01
Highlights: → We report the cyclotron production of 103-palladium via 103 Rh(p,n) 103 Pd reaction. → 103 Pd was absorbed on resin beads for brachytherapy seed preparation. → The optimum absorption of 103 Pd in resin was achieved at 0.5 M HCl. → Version 5 of MCNP code was employed to model a new 103 Pd brachytherapy seed. - Abstract: In this study, design and fabrication of 103 Pd brachytherapy seed was investigated. The excitation functions of 103 Rh(p,n) 103 Pd and 103 Rh(d,2n) 103 Pd reactions were calculated using EMPIRE (version 3.1 Rivoli), ALICE/ASH and TALYS-1.2 codes, the TENDL-2010 database and compared with the published data. Production of 103 Pd was done via 103 Rh(p,n) 103 Pd nuclear reaction. The target was bombarded with 18 MeV protons at 200 μA beam current for 15 h. After irradiation and radiochemical separation of the electroplated rhodium target, the optimum condition for absorption of 103 Pd into Amberlite (registered) IR-93 resin was achieved at 0.5 M HCl. Version 5 of the (MCNP) Monte Carlo radiation transport code was employed to calculate the dosimetric parameters around the 103 Pd brachytherapy seed. Finally the calculated results were compared with published results for other commercial sources.
Journal of Glenn T. Seaborg (1946--1958), January 1, 1951--December 31, 1951
International Nuclear Information System (INIS)
1990-07-01
This portion of the Glenn T. Seaborg journal concerns the 12-year period during which I served as Director of the Division of Nuclear Chemistry of the Radiation Laboratory (now the Lawrence Berkeley Laboratory). This portion of my journal consists of Volume 5 (January 1, 1951--December 31, 1951). The journal is based on my notebook entries; memos covering phone calls, appointments, and meetings; minutes of meetings; my appointment calendars and correspondence files; the Radiation Laboratory Chemistry Division personnel files and travel vouchers; laboratory notebooks of my scientific colleagues and cyclotron bombardment logs; some catalogs and materials from the Bancroft Library and the University Archives; back issues of the campus newspaper the Daily California and clippings from S.F. Bay Area newspapers found in my scrapbook, etc. Helen was able to provide me with some of her appointment calendars, which helped clarify family and social activities. Many of these resources provided clear and detailed material. Other notes made hastily and causally, using initials for people's names and rather cryptic abbreviations; however, when these were deciphered, they provided surprisingly complete information
Journal of Glenn T. Seaborg (1946--1958), January 1, 1952--December 31, 1952
International Nuclear Information System (INIS)
1990-07-01
This portion of the Glenn T. Seaborg journal concerns the 12-year period during which I served as Director of the Division of Nuclear Chemistry of the Radiation Laboratory (now the Lawrence Berkeley Laboratory). This portion of my journal consists of Volume 6 (January 1, 1952--December 31, 1952). The journal is based on my notebook entries; memos covering phone calls, appointments, and meetings; minutes of meetings; my appointment calendars and correspondence files; the Radiation Laboratory Chemistry Division personnel files and travel vouchers; laboratory notebooks of my scientific colleagues and cyclotron bombardment logs; some catalogs and materials from the Bancroft Library and the University Archives; back issues of the campus newspaper the Daily Californian and clippings from S.F. Bay Area newspapers found in my scrapbook, etc. Helen was able to provide me with some of her appointment calendars, which helped clarify family and social activities. Many of these resources provided clear and detailed material. Other notes were made hastily and casually, using initials for people's names and rather cryptic abbreviations; however, when these were deciphered, they provided surprisingly complete information
Journal of Glenn T. Seaborg (1946-1958), January 1, 1955--December 31, 1955
International Nuclear Information System (INIS)
Seaborg, G.T.
1990-07-01
This portion of the Glenn T. Seaborg journal concerns the 12-year period during which I served as Director of the Division of Nuclear Chemistry of the Radiation Laboratory (now the Lawrence Berkeley Laboratory). This portion of my journal consists of Volume 9 (January 1, 1955--December 31, 1955). The journal is based on my notebook entries; memos covering phone calls, appointments, and meetings, minutes of meetings; my appointment calendars and correspondence files; the Radiation Laboratory Chemistry Division personnel files and travel vouchers; laboratory notebooks of my scientific colleagues and cyclotron bombardment logs; some catalogs and materials from the Bancroft Library and the University Archives; back issues of the campus newspaper the Daily California and clippings from S.F. Bay Area newspapers found in my scrapbook, etc. Helen was able to provide me with some of her appointment calendars, which helped clarify family and social activities. Many of these resources provided clear and detailed material. Other notes made hastily and causally, using initials for people's names and rather cryptic abbreviations; however, when these were deciphered, they provided surprisingly complete information
Structural Aging Program technical progress for period, January 1, 1992--December 31, 1992
International Nuclear Information System (INIS)
Naus, D.J.; Oland, C.B.
1993-07-01
The Structural Aging (SAG) Program is conducted for the Nuclear Regulatory Commission (NRC) by the Oak Ridge National Laboratory (ORNL). The program has the overall objective of preparing an expandable handbook or report which will provide potential structural safety issues and acceptance criteria for use by the NRC in nuclear power plant evaluations of continued service. Initial focus of the program is on concrete and concrete-related materials which comprise safety-related (Category I) structures in light-water reactor facilities. The SAG Program is organized into four tasks: Task S.1 -- Program Management, Task S.2 -- Materials Property Data Base, Task S.3 -- Structural Component Assessment/Repair Technology, and Task S.4 -- Quantitative Methodology for Continued Service Determinations. In meeting the individual objectives of these tasks resources are drawn from ORNL with subcontract support from universities and other research laboratories. This report provides an overview of principal developments in each of the four program tasks from January 1, 1992 to December 31, 1992. Planned activities under each of these tasks are also presented
Annual progress report of the Department of Solid State Physics 1 January -31 December 1994
International Nuclear Information System (INIS)
Lindgaard, P.-A.; Bechgaard, K.; Clausen, K.N.; Feidenhans'l, R.; Johannsen, I.
1995-01-01
Research in the department is concerned with 'Materials with Distinct Physical and Chemical Properties'. The principal activities of the department in the period from 1 January to 31 December, 1994, are presented in this Progress Report. Neutron and x-ray diffraction techniques are used to study a wide variety of problems in condensed matter physics and include: two- and three-dimensional structures, magnetic ordering, heavy fermions, high T c superconductivity, phase transitions in model systems, precipitation phenomena, and nano-scale structures in various materials. The research in chemistry includes chemical synthesis and physico-chemical investigation of small molecules and polymers, with emphasis on polymers with new optical properties, block copolymers, surface modified polymers, and supramolecular structures. Related to these problems there is work going on in theory, Monte Carlo simulations, and methods of data analysis. (au) (3 tabs., 116 ills., 181 refs.)
International Nuclear Information System (INIS)
Adams, W.H.; Engle, J.R.; Harper, J.A.; Heotis, P.M.; Scott, W.A.
1986-01-01
March 1, 1984, was the 30th anniversary of the Bravo thermonuclear test that resulted in the accidental exposure of the populations of Rongelap and Utirik atolls to radioactive fallout. The chronicling of the medical events resulting from that exposure is continued in this report, which covers the period from January 1983 through December 1984. An updated listing of all relevant publications from the Medical Department Brookhaven National Laboratory, is presented in the Reference Section. Thirty years of observation continue to show no detectable increase in mortality in the exposed population as a result of that exposure. The survival curves of the high-exposure Rongelap group, the low-exposure Utirik population, and an unexposed group of Rongelap people matched by age and sex to the exposed Rongelap group in 1957 continue to be similar. 89 refs., 2 figs., 6 tabs
Solar radiation measurements at the network of six sites in the UK, January - December 2001
Energy Technology Data Exchange (ETDEWEB)
Driscoll, C.M.H.; Campbell, J.I.; Pearson, A.J.; Grainger, K.J.L.; Dean, S.F.; Clark, I.E
2002-04-01
A summary of the results from January to December 2001 of a survey of solar radiation levels at the UK network of six solar radiation measurement sites is presented. The network consists of three NRPB sites at Chilton, Leeds and (monitoring since 1988) and three Meteorological Office stations at Camborne, Kinloss and Lerwick (monitoring since 1993). Visible (400-770 nm), ultraviolet UVA radiation (320-400 nm) and erythemally weighted ultraviolet radiation UVR{sub eff} (280-400 nm) have been measured simultaneously using a three detector measurement system. Results are compared with calculated irradiances of ultraviolet radiation and published illuminance data, and with data for the measurement period from 1988 to 2000. Yearly reports have been produced for selected sites, giving the daily solar index (which is a measure of the sunburn potential for sensitive skin types) throughout the year. (author)
Solar radiation measurements at the network of six sites in the UK, January - December 2001
International Nuclear Information System (INIS)
Driscoll, C.M.H.; Campbell, J.I.; Pearson, A.J.; Grainger, K.J.L.; Dean, S.F.; Clark, I.E.
2002-01-01
A summary of the results from January to December 2001 of a survey of solar radiation levels at the UK network of six solar radiation measurement sites is presented. The network consists of three NRPB sites at Chilton, Leeds and (monitoring since 1988) and three Meteorological Office stations at Camborne, Kinloss and Lerwick (monitoring since 1993). Visible (400-770 nm), ultraviolet UVA radiation (320-400 nm) and erythemally weighted ultraviolet radiation UVR eff (280-400 nm) have been measured simultaneously using a three detector measurement system. Results are compared with calculated irradiances of ultraviolet radiation and published illuminance data, and with data for the measurement period from 1988 to 2000. Yearly reports have been produced for selected sites, giving the daily solar index (which is a measure of the sunburn potential for sensitive skin types) throughout the year. (author)
Energy Technology Data Exchange (ETDEWEB)
Adams, W.H.; Engle, J.R.; Harper, J.A.; Heotis, P.M.; Scott, W.A.
1986-01-01
March 1, 1984, was the 30th anniversary of the Bravo thermonuclear test that resulted in the accidental exposure of the populations of Rongelap and Utirik atolls to radioactive fallout. The chronicling of the medical events resulting from that exposure is continued in this report, which covers the period from January 1983 through December 1984. An updated listing of all relevant publications from the Medical Department Brookhaven National Laboratory, is presented in the Reference Section. Thirty years of observation continue to show no detectable increase in mortality in the exposed population as a result of that exposure. The survival curves of the high-exposure Rongelap group, the low-exposure Utirik population, and an unexposed group of Rongelap people matched by age and sex to the exposed Rongelap group in 1957 continue to be similar. 89 refs., 2 figs., 6 tabs.
International Nuclear Information System (INIS)
Packard, M.; Fuhrer, R.; Valakh, V.
2014-01-01
Purpose. To define factors associated with rectal bleeding in patients treated with IG-IMRT followed by Pd-103 seed implant. Methods and Materials. We retrospectively reviewed 61 prostate adenocarcinoma patients from 2002 to 2008. The majority (85.2%) were of NCCN intermediate risk category. All received IG-IMRT to the prostate and seminal vesicles followed by Pd-103 implant delivering a mean D90 of 100.7 Gy. Six patients received 45 Gy to the pelvic nodes and 10 received androgen deprivation. Results. Ten patients (16.4%) developed rectal bleeding: 4 were CTCAE v.3 grade 1, 5 were grade 2, and 1 was grade 3. By univariate analysis, age, stage, Gleason sum, PSA, hormonal therapy, pelvic radiation, postoperative prostate volume, D9, V100, individual source activity, total implanted activity per cm 3 , and duration of interval before implant did not impact rectal bleeding. Implant R100 was higher in patients with rectal bleeding: on average, 0.885 versus 0.396 cm 3 ,(Ρ =0.02) , odds ratio of 2.26 per .5 cm 3 (95% CI, 1.16–4.82). A trend for significance was seen for prostate V200 and total implanted activity. Conclusion. Higher implant R100 was associated with development of rectal bleeding in patients receiving IG-IMRT to 45 Gy followed by Pd-103 implant. Minimizing implant R100 may reduce the rate of rectal bleeding in similar patients.
National Oceanic and Atmospheric Administration, Department of Commerce — Toxic metals have been collected to be analyzed in laboratory in the Biscayne Bay - Florida, from 01 January 1995 to 31 December 1996. Data were submitted by the...
Energy Technology Data Exchange (ETDEWEB)
McCone, John A.
1961-01-31
This volume contains a name and subject index for the 1960 report of the United States Atomic Energy Commission to Congress. The full semiannual report covers the major unclassified activities of the Commission from January through December 1960.
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.
1963-01-31
This volume contains a name and subject index for the 1962 report of the United States Atomic Energy Commission to Congress. The full semiannual report covers the major unclassified activities of the Commission from January through December 1962.
Energy Technology Data Exchange (ETDEWEB)
McCone, John A.
1960-01-31
This volume contains a name and subject index for the 1959 report of the United States Atomic Energy Commission to Congress. The full semiannual report covers the major unclassified activities of the Commission from January through December 1959.
Annual progress report of the Department of Solid State Physics 1 January -31 December 1996
Energy Technology Data Exchange (ETDEWEB)
Joergensen, M; Bechgaard, K; Clausen, K N; Feidenhans` l, R; Johannsen, I
1997-01-01
Research in the department is concerned with `Materials with Distinct Physical and Chemical Properties`. The principal activities of the department in the period from 1 January to 31 December, 1996, are presented in this Progress Report. Neutron and x-ray diffraction techniques are used to study a wide variety of problems in condensed matter physics and include: two- and three-dimensional structures, magnetic ordering, heavy fermions, high T{sub c} superconductivity, phase transitions in model systems, precipitation phenomena, and nano-scale structures in various materials. The research in chemistry includes chemical synthesis and physico-chemical investigation of small molecules and polymers, with emphasis on polymers with new optical properties, block copolymers, surface modified polymers, and supramolecular structures. Related to these problems there is work going on in theory, Monte Carlo simulations, computer simulation of molecules and polymers and methods of data analysis. (au) 6 tabs., 144 ills., 197 refs.
Annual progress report of the Department of Solid State Physics 1 January - 31 December 1995
International Nuclear Information System (INIS)
Joergensen, M.; Bechgaard, K.; Clausen, K.N.; Feidenhans'l, R.; Johannsen, I.
1996-01-01
Research in the department is concerned with 'Materials with Distinct Physical and Chemical Properties'. The principal activities of the department in the period from 1 January to 31 December, 1995, are presented in this Progress Report. Neutron and x-ray diffraction techniques are used to study a wide variety of problems in condensed matter physics and include: two- and three-dimensional structures, magnetic ordering, heavy fermions, high T c superconductivity, phase transitions in model systems, precipitation phenomena, and nano-scale structures in various materials. The research in chemistry includes chemical synthesis and physico-chemical investigation of small molecules and polymers, with emphasis on polymers with new optical properties, block copolymers, surface modified polymers, and supramolecular structures. Related to these problems there is work going on in theory, Monte Carlo simulations, computer simulation of molecules and polymers and methods of data analysis. (au) 5 tabs., 135 ills., 163 refs
International Nuclear Information System (INIS)
Roy, Falguni
1984-01-01
The research and development activities of the Seismology Section of the Bhabha Atomic Research Centre (BARC) at Bombay are reported for the period January 1982-December 1983 in the form of summaries. The Section's activities are mainly directed towards detection of underground nuclear explosions. During the report period 64 signals out of about 12000 seismograms which were examined were identified as the signals due to underground nuclear explosions. The instrumentation work for Kolar rockburst research was almost completed under the collaboration programme of BARC with Bharat Gold Mines Ltd. Analytical methods have been developed for interpreting the frequency-magnitude relation of earthquake. These methods will be useful in the seismic estimation of risk in case only restricted data involving events of low magnitude are available. A list of publications of the staff-members of the Section during the report period is given. (M.G.B.)
Annual progress report of the Department of Solid State Physics 1 January - 31 December 1995
Energy Technology Data Exchange (ETDEWEB)
Joergensen, M; Bechgaard, K; Clausen, K N; Feidenhans` l, R; Johannsen, I [eds.
1996-01-01
Research in the department is concerned with `Materials with Distinct Physical and Chemical Properties`. The principal activities of the department in the period from 1 January to 31 December, 1995, are presented in this Progress Report. Neutron and x-ray diffraction techniques are used to study a wide variety of problems in condensed matter physics and include: two- and three-dimensional structures, magnetic ordering, heavy fermions, high T{sub c} superconductivity, phase transitions in model systems, precipitation phenomena, and nano-scale structures in various materials. The research in chemistry includes chemical synthesis and physico-chemical investigation of small molecules and polymers, with emphasis on polymers with new optical properties, block copolymers, surface modified polymers, and supramolecular structures. Related to these problems there is work going on in theory, Monte Carlo simulations, computer simulation of molecules and polymers and methods of data analysis. (au) 5 tabs., 135 ills., 163 refs.
Annual progress report of the Department of Solid State Physics 1 January -31 December 1996
International Nuclear Information System (INIS)
Joergensen, M.; Bechgaard, K.; Clausen, K.N.; Feidenhans'l, R.; Johannsen, I.
1997-01-01
Research in the department is concerned with 'Materials with Distinct Physical and Chemical Properties'. The principal activities of the department in the period from 1 January to 31 December, 1996, are presented in this Progress Report. Neutron and x-ray diffraction techniques are used to study a wide variety of problems in condensed matter physics and include: two- and three-dimensional structures, magnetic ordering, heavy fermions, high T c superconductivity, phase transitions in model systems, precipitation phenomena, and nano-scale structures in various materials. The research in chemistry includes chemical synthesis and physico-chemical investigation of small molecules and polymers, with emphasis on polymers with new optical properties, block copolymers, surface modified polymers, and supramolecular structures. Related to these problems there is work going on in theory, Monte Carlo simulations, computer simulation of molecules and polymers and methods of data analysis. (au) 6 tabs., 144 ills., 197 refs
Nuclear Physics Group progress report January - December 1982
International Nuclear Information System (INIS)
Coote, G.E.
1983-08-01
The work of the Nuclear Physics Group of the Institute of Nuclear Sciences during the period July-December 1981 is described. Installation of the EN-tandem electrostatic accelerator proceeded to the voltage test stage. Highlights of the research programme included nuclear microprobe studies of bone and teeth, and depth profiling of sodium in hydrated obsidian
National Oceanic and Atmospheric Administration, Department of Commerce — Phytoplankton, zooplankton, salinity, and temperature data were collected from multiple ships from January 1, 1913 to December 31, 1999. These data were collected...
International Nuclear Information System (INIS)
Daley, E.M.
1978-04-01
The Environmental Monitoring and Support Laboratory-Las Vegas, U.S. Environmental Protection Agency, maintains an experimental dairy herd and farm facility in Area 15 of the Nevada Test Site for the U.S. Energy Research and Development Administration. This status report covers the period from January 1, 1976, through December 31, 1976. Improvements, changes, and additions made to the facilities, production and reproduction statistics for individual cows and the herd, the veterinary medicine practices employed, and summaries of the metabolism studies that involved the dairy herd are covered in this report
Energy Technology Data Exchange (ETDEWEB)
Kszos, L.A. [ed.; Konetsky, B.K.; Peterson, M.J.; Petrie, R.B.; Ryon, M.G.; Smith, J.G.; Southworth, G.R.
1997-06-01
On September 24, 1987, the Commonwealth of Kentucky Natural Resources and Environmental Protection Cabinet issued an Agreed Order that required the development of a Biological Monitoring Program (BMP) for the Paducah Gaseous diffusion Plant (PGDP). The PGDP BMP was conducted by the University of Kentucky Between 1987 and 1992 and by staff of the Environmental Sciences Division (ESD) at Oak Ridge National Laboratory (ORNL) from 1991 to present. The goals of BMP are to (1) demonstrate that the effluent limitations established for PGDP protect and maintain the use of Little Bayou and Big Bayou creeks for growth and propagation of fish and other aquatic life, (2) characterize potential environmental impacts, and (3) document the effects of pollution abatement facilities on stream. The BMP for PGDP consists of three major tasks: (1) effluent toxicity monitoring, (2) bioaccumulation studies, and (3) ecological surveys of stream communities (i.e., benthic macroinvertebrates and fish). This report focuses on ESD activities occurring from January 1996 to December 1996, although activities conducted outside this time period are included as appropriate.
International Nuclear Information System (INIS)
Kszos, L.A.; Konetsky, B.K.; Peterson, M.J.; Petrie, R.B.; Ryon, M.G.; Smith, J.G.; Southworth, G.R.
1997-06-01
On September 24, 1987, the Commonwealth of Kentucky Natural Resources and Environmental Protection Cabinet issued an Agreed Order that required the development of a Biological Monitoring Program (BMP) for the Paducah Gaseous diffusion Plant (PGDP). The PGDP BMP was conducted by the University of Kentucky Between 1987 and 1992 and by staff of the Environmental Sciences Division (ESD) at Oak Ridge National Laboratory (ORNL) from 1991 to present. The goals of BMP are to (1) demonstrate that the effluent limitations established for PGDP protect and maintain the use of Little Bayou and Big Bayou creeks for growth and propagation of fish and other aquatic life, (2) characterize potential environmental impacts, and (3) document the effects of pollution abatement facilities on stream. The BMP for PGDP consists of three major tasks: (1) effluent toxicity monitoring, (2) bioaccumulation studies, and (3) ecological surveys of stream communities (i.e., benthic macroinvertebrates and fish). This report focuses on ESD activities occurring from January 1996 to December 1996, although activities conducted outside this time period are included as appropriate
Physics Division progress report, Special 50th anniversary issue, January 1, 1992--December 31, 1992
International Nuclear Information System (INIS)
Shera, E.B.; Hollen, G.Y.
1993-01-01
This special anniversary issue of the Physics Division progress report presents a series of articles that describe the missions and projects of the past and present Physics Division Leaders during their respective tenures. The report also includes selected accounts of significant progress in research and development achieved by Physics Division personnel during the period January 1, 1992, through December 31, 1992, a general description of the goals and interests of the Division, and a list of publications produced during this period. The report represents the three main areas of experimental research and development in which the Physics Division serves the needs of Los Alamos National Laboratory and the nation in defense and basic sciences: (1) fundamental research in nuclear and particle physics, condensed-matter physics, and biophysics; (2) laser physics and applications, especially to high-density plasmas; and (3) defense physics, including the development of diagnostic methods for weapons tests, weapons-related high energy-density physics, and other programs
RA Research reactor, Report for the period January-December 2002
International Nuclear Information System (INIS)
Pesic, M.; Sotic, O.; Nikolic, A.
2003-01-01
During 2002 activities at the RA research nuclear reactor were performed according to the action plan related to maintenance of this facility and Contract about financing the reactor for the period January-december 2002 signed in June 2002 with the Ministry of science, technologies and development of the Republic of Serbia. In July 2002. the the Government of Serbia has finally declared a decision about permanent shutdown of the RA reactor, initiation of reactor decommissioning process, and solving the problem of the spent fuel storage in the reactor building. These decisions demanded new organizational structure in the Institute for efficient completion of the mentioned programs. As previously, the main activities during the reporting period involved maintenance of the systems which must be operated permanently or occasionally and the systems and equipment of special importance for security of the facility. In addition to regular maintenance activities, a series of investment tasks were completed in the reactor building. Special activities were related to nuclear fuel inspection conducted by the IAEA. Significant cooperation with IAEA was achieved after September 2001, when Yugoslavia became again a member of the IAEA. During 2002 a number of significant activities were prepared and completed: transport of fresh highly enriched fuel to Russia; signing the contract with IAEA concerning work on future RA reactor decommissioning program; preliminary analysis and preparation for storage of spent nuclear fuel and future decommissioning. The contracts signed with the IAEA are in complete agreement with decisions of the Serbian government. It is indispensable to create a regulatory body on the government level which would provide needed conditions for completion of these complicated tasks and control performance. At this moment no such body exists and no financial support is provided although this is a condition for obtaining support from the IAEA or any other
Major publications in the critical care pharmacotherapy literature: January-December 2013.
Rech, Megan A; Day, Sarah A; Kast, Jenna M; Donahey, Elisabeth E; Pajoumand, Mehrnaz; Kram, Shawn J; Erdman, Michael J; Peitz, Gregory J; Allen, John M; Palmer, Allison; Kram, Bridgette; Harris, Serena A; Turck, Charles J
2015-02-01
Ten recently published articles with important implications for critical care pharmacotherapy are summarized. The Critical Care Pharmacotherapy Literature Update (CCPLU) group is a national assembly of experienced intensive care unit (ICU) pharmacists across the United States. Group members monitor 25 peer-reviewed journals on an ongoing basis to identify literature relevant to pharmacy practice in the critical care setting. After evaluation by CCPLU group members, selected articles are chosen for summarization and distribution to group members nationwide based on (1) applicability to critical care practice, (2) relevance to pharmacy practitioners, and (3) quality of evidence or research methodology. Hundreds of relevant articles were evaluated by the group during the period January-December 2013, of which 98 were summarized and disseminated nationally to CCPLU group members. Among those 98 publications, 10 deemed to be of particularly high utility to critical care practitioners were included in this review. The 10 articles address topics such as rapid lowering of blood pressure in patients with intracranial hemorrhage, adjunctive therapy to prevent renal injury due to acute heart failure, triple-drug therapy to improve neurologic outcomes after cardiac arrest, and continuous versus intermittent infusion of β-lactam antibiotics in severe sepsis. There were many important additions to the critical care pharmacotherapy literature in 2013, including an updated guideline on the management of myocardial infarction and reports on advances in research focused on improving outcomes in patients with stroke or cardiac arrest and preventing the spread of drug-resistant pathogens in the ICU. Copyright © 2015 by the American Society of Health-System Pharmacists, Inc. All rights reserved.
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profiles were collected from XBT casts from the HMAS MELBOURNE and other vessels in the Indian Ocean from 01 January 1991 to 31 December 2001. Data were...
Energy Technology Data Exchange (ETDEWEB)
Fondeur, F. F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2017-06-30
A trend summary of three Solvent Hold Tank (SHT) monthly samples; MCU-16-1488-1493 (December 2016), MCU-17-86-88 (January 2017), and MCU-17-119-121 (February 2017) are reported. Analyses indicate that the modifier (CS-7SB) and the extractant (MaxCalix) concentrations are at their nominal recommended levels (169,000 mg/L and 46,300 mg/L respectively). The suppressor (TiDG) level has decreased to a steady state level of 673 mg/L well above the minimum recommended level (479 mg/L). This analysis confirms the Isopar™ addition to the solvent in January 18, 2017. This analysis also indicates the solvent did not require further additions. Based on the current monthly sample, the levels of TiDG, Isopar™L, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time. Periodic characterization and trimming additions to the solvent are recommended. No impurities above the 1000 ppm level were found in this solvent by the Semi-Volatile Organic Analysis (SVOA). No impurities were observed in the Hydrogen Nuclear Magnetic Resonance (HNMR). Another impurity observed in the samples was mercury. Up to 38 ± 8 micrograms of mercury per mL of solvent was detected in these samples (the average of the CV-AA and XRF methods). The higher mercury concentration in the solvent (as determined in the last three monthly samples) is possibly due to the higher mercury concentration in Salt Batches 8 and 9 (Tank 49H) or mixing of previously undisturbed areas of high mercury concentration in Tank 49H. The gamma level (0.21E5 dpm/mL) measured in the February SHT sample was one order of magnitude lower than the gamma levels observed in the December and January SHT samples. The February gamma level is consistent with the solvent being idle (since January 10, 2017). The gamma levels observed in the December and January SHT samples were consistent with previous monthly measurements where the process operated normally. The laboratory will continue to monitor
International Nuclear Information System (INIS)
Borders, D.M.; Watts, J.A.; Clapp, R.B.; Frederick, B.J.; Gregory, S.M.; Moore, T.D.
1993-06-01
This report summarizes, for the 12-month period (January through December 1992), the available dynamic hydrologic data collected, primarily, on the White Oak Creek (WOC) watershed along with information collected on the surface flow systems which affect the quality or quantity of surface water. The collection of hydrologic data is one component of numerous, ongoing Oak Ridge National Laboratory (ORNL) environmental studies and monitoring programs and is intended to: characterize the quantity and quality of water in the flow system; assist with the planning and assessment of remedial action activities; and provide long-term availability of data and quality assurance
Manchester University: report: nuclear physics, January 1992-December 1993
International Nuclear Information System (INIS)
1994-01-01
This report describes the experimental research of the Manchester Nuclear Physics Group for the period January 1992 to January 1993. The chief areas are radioactive beams, improved techniques for analysis of multifold γ-coincidence data, and the development of improved heavy-ion detection systems. We are designing and building systems for measuring the radioactive beams and have been making measurements of the backgrounds to be encountered with and without beam at the measuring sites. Construction of the heavy-ion spectrometer HIPS is nearly complete, and it is intended to use it in conjunction with the TESSA array to observe γ rays in coincidence with deep-inelastic reaction products from the Jvaskyla cyclotron. Work is also proceeding on novel ways to use Ge detectors as γ-ray polarimeters and as position-sensitive devices. (author)
Energy situation. January 2008
International Nuclear Information System (INIS)
2008-02-01
This report makes a status of the French energy expenses, prices, production, consumption, demand, import and export since January 2005 and up to December 2007. Details are given separately for primary energy, solid mineral fuels, petroleum products, natural gas and electricity. (J.S.)
Matthew Packard; Vladimir Valakh; Russell Fuhrer
2014-01-01
Purpose. To define factors associated with rectal bleeding in patients treated with IG-IMRT followed by Pd-103 seed implant. Methods and Materials. We retrospectively reviewed 61 prostate adenocarcinoma patients from 2002 to 2008. The majority (85.2%) were of NCCN intermediate risk category. All received IG-IMRT to the prostate and seminal vesicles followed by Pd-103 implant delivering a mean D90 of 100.7 Gy. Six patients received 45 Gy to the pelvic nodes and 10 received androgen deprivation...
Energy Technology Data Exchange (ETDEWEB)
Kszos, L.A.; Peterson, M.J.; Ryon, M.G.; Smith, J.G.; Southworth, G.R.
1998-03-01
On September 24, 1987, the Commonwealth of Kentucky Natural Resources and Environmental Protection Cabinet issued an Agreed Order that required the development of a Biological Monitoring Program (BMP) for the Paducah Gaseous Diffusion Plant (PGDP). A plan for the biological monitoring of the receiving streams was implemented in 1987 and consisted of ecological surveys, toxicity monitoring of effluents and receiving streams, evaluation of bioaccumulation of trace contaminants in biota, and supplemental chemical characterization of effluents. Beginning in fall 1991, the Environmental Sciences Division (ESD) at Oak Ridge National Laboratory added data collection and report preparation to its responsibilities for the PGDP BMP. The BMP has been continued because it has proven to be extremely valuable in (1) identifying those effluents with the potential for adversely affecting instream fauna, (2) assessing the ecological health of receiving streams, and (3) guiding plans for remediation and protecting human health. The BMP for PGDP consists of three major tasks: (1) effluent toxicity monitoring, (2) bioaccumulation studies, and (3) ecological surveys of benthic macroinvertebrate communities and fish. With the exception of the benthic macroinvertebrate community surveys, this report focuses on activities from January to December 1997.
International Nuclear Information System (INIS)
Harvey, M.
1996-05-01
This document is a Progress Report for the Physical and Environmental Sciences, Physics Division, for the period 1995 January 1 to December 31, at the Chalk River nuclear Labs. The condensed matter science group continued to operate a multi-faceted program involving collaborative basic and applied research with external scientists in the fields of materials science, physics, chemistry and biology. The Applied Neutron Diffraction for Industry (And) program gained strength with ever wider applications for the nuclear, aerospace, and manufacturing programs. Steps continued towards making neutron scattering facilities at NRU reactor more user friendly. The neutrino physics group, as part of the Sudbury Neutrino Observatory (SNO) Institute, collaborating with scientists from Canada, USA and UK. The accelerator physics group spent considerable effort working with materials and fuels scientists to show the value of accelerators as an out-reactor source of radiation. Specific research activities have included the demonstration of laser plasma deposition of diamond coating, which has potential application for high-wear components in reactors, and the study for a Free Electron Laser upgrade for the IMPELA accelerator. As a result of funding reduction all programs of the Division were dissolved as of 1997 March 31
Energy Technology Data Exchange (ETDEWEB)
Harvey, M. (ed.)
1996-05-01
This document is a Progress Report for the Physical and Environmental Sciences, Physics Division, for the period 1995 January 1 to December 31, at the Chalk River nuclear Labs. The condensed matter science group continued to operate a multi-faceted program involving collaborative basic and applied research with external scientists in the fields of materials science, physics, chemistry and biology. The Applied Neutron Diffraction for Industry (And) program gained strength with ever wider applications for the nuclear, aerospace, and manufacturing programs. Steps continued towards making neutron scattering facilities at NRU reactor more user friendly. The neutrino physics group, as part of the Sudbury Neutrino Observatory (SNO) Institute, collaborating with scientists from Canada, USA and UK. The accelerator physics group spent considerable effort working with materials and fuels scientists to show the value of accelerators as an out-reactor source of radiation. Specific research activities have included the demonstration of laser plasma deposition of diamond coating, which has potential application for high-wear components in reactors, and the study for a Free Electron Laser upgrade for the IMPELA accelerator. As a result of funding reduction all programs of the Division were dissolved as of 1997 March 31.
International Nuclear Information System (INIS)
Kszos, L.A.; Peterson, M.J.; Ryon, M.G.; Smith, J.G.; Southworth, G.R.
1998-03-01
On September 24, 1987, the Commonwealth of Kentucky Natural Resources and Environmental Protection Cabinet issued an Agreed Order that required the development of a Biological Monitoring Program (BMP) for the Paducah Gaseous Diffusion Plant (PGDP). A plan for the biological monitoring of the receiving streams was implemented in 1987 and consisted of ecological surveys, toxicity monitoring of effluents and receiving streams, evaluation of bioaccumulation of trace contaminants in biota, and supplemental chemical characterization of effluents. Beginning in fall 1991, the Environmental Sciences Division (ESD) at Oak Ridge National Laboratory added data collection and report preparation to its responsibilities for the PGDP BMP. The BMP has been continued because it has proven to be extremely valuable in (1) identifying those effluents with the potential for adversely affecting instream fauna, (2) assessing the ecological health of receiving streams, and (3) guiding plans for remediation and protecting human health. The BMP for PGDP consists of three major tasks: (1) effluent toxicity monitoring, (2) bioaccumulation studies, and (3) ecological surveys of benthic macroinvertebrate communities and fish. With the exception of the benthic macroinvertebrate community surveys, this report focuses on activities from January to December 1997
Separation of rhodium-103m from ruthenium-103 by solvent extraction
International Nuclear Information System (INIS)
Chiu, J.H.; Landolt, R.R.; Kessler, W.V.
1978-01-01
The results for eight replications of the solvent extraction and purification procedures were /sup 103m/Rh yield, 100.9 +- 2.1% and 103 Ru contamination, 0.0%. The use of sodium hypochlorite as the oxidizing agent eliminated the need for fuming with 1:1 H 2 SO 4 to eliminate chlorides as was required when ceric sulfate was used as the oxidizing agent. The optimum pH for extraction of RuO 4 into CCl 4 was determined to be in the range 6.5 to 7.5. A boiling procedure was used to purify the extracted aqueous solution of /sup 103m/Rh
A Photometric Study of Three Eclipsing Binary Stars (Poster abstract)
Ryan, A.
2016-12-01
(Abstract only) As part of a program to study eclipsing binary stars that exhibit the O'Connell Effect (OCE) we are observing a selection of binary stars in a long term study. The OCE is a difference in maximum light across the ligthcurve possibly cause by starspots. We observed for 7 nights at McDonald Observatory using the 30-inch telescope in July 2015, and used the same telescope remotely for a total of 20 additional nights in August, October, December, and January. We will present lightcurves for three stars from this study, characterize the OCE for these stars, and present our model results for the physical parameters of the star making up each of these systems.
Deng, Xueliang; Cao, Weihua; Huo, Yanfeng; Yang, Guanying; Yu, Caixia; He, Dongyan; Deng, Weitao; Fu, Wei; Ding, Heming; Zhai, Jing; Cheng, Long; Zhao, Xuhui
2018-03-01
A severe, prolonged and harmful regional heavy air pollution episode occurred in eastern China from December 2016 to January 2017. In this paper, the pollutant characteristics and the meteorological formation mechanism of this pollution event, including climate anomalies, surface weather conditions, planetary boundary layer structure and large-scale circulation features, were analysed based on observational pollution data, surface meteorological data, sounding data and ERA-Interim reanalysis data. The results are as follows. (1) Five pollution stages were identified in eastern China. The two most severe episodes occurred from December 27, 2016 to January 4, 2017 and from January 8 to 12 2017. During these two pollution episodes, fine mode particles were major contributors, and hourly PM2.5 concentrations often exceeded 150 μg/m3, reaching a maximum of 333 μg/m3 at Fuyang station. Gaseous pollutants were transformed into secondary aerosols through heterogeneous reactions on the surface of PM2.5. (2) Compared with the same period over the years 2000-2016, 2017 presented meteorological field climate anomalies in conjunction with unfavourable surface conditions (weak winds, high relative humidity, fewer hours of sunshine, high cloud cover) and adverse atmospheric circulation (weak East Asian winter monsoon and an abnormal geopotential height of 500 hPa), which caused poorer visibility in 2017 than in the other analysed years. (3) During the development of heavy pollution event, unfavourable surface weather conditions, including poorer visibility, weaker pressure, higher relative humidity, lower wind speed with unfavourable wind direction and less precipitation suppressed the horizontal diffusion ability of air pollutants. Furthermore, the unfavourable structure of the atmospheric boundary layer was the key cause of the rapid PM2.5 increase. The deep, strong temperature inversion layer and weak vertical wind velocity could have suppressed vertical motion and enhanced
H-Division annual report of research activities, December 1, 1947-- December 1, 1948
Energy Technology Data Exchange (ETDEWEB)
NONE
1949-04-19
This volume constitutes part 2 of the H-Division, Los Alamos National Laboratory, Annual Report of Research Activities for December 1, 1947 to December 1, 1948. Full reports of ten projects involving exposure of man or rodents to various forms of radiation are described. The individual reports are separately indexed and abstracted for the database.
Analysis of scientific output by spine surgeons from Japan: January 2000 to December 2013.
Kawaguchi, Yoshiharu; Guarise da Silva, Pedro; Quadros, Francine Wurzius; Merlin, Luiz Henrique; Radaelli, Lucas; Guyot, Juan Pablo; Dozza, Diego; Martins, Délio; Scheverin, Nicolas; Riew, Daniel K; Kimura, Tomoatsu; Falavigna, Asdrubal
2016-01-01
Over the last decade, the growing body of work on spine pathology has led to developments and refinements in the areas of basic science, diagnosis and treatment of a variety of spine conditions. Scientific publications have a global impact on the international scientific community as they share vital information that can be applied by physicians worldwide to solve their everyday medical problems. The historical background of scientific publication in journals in Japan on the subject of spine is unclear. We performed a literature search for publications by Japanese spine surgeons regarding spine or spinal cord topics using an online database: Pubmed.gov (http://www.ncbi.nlm.nih.gov/pubmed/). The results were stored and analyzed at the Laboratory of Clinical Studies and Basic Models of Spinal Disorders of the University of Caxias do Sul. Results were limited to articles published from January 2000 to December 2013. The search terms used were "Japan" AND ("spine" OR "spinal diseases" OR "spinal cord" OR "spinal cord diseases" OR "vertebroplasty" OR "arthrodesis" OR "discectomy" OR "foraminotomy" OR "laminectomy" OR "denervation" OR "back injuries"). Japanese spine surgeons were defined as spine surgeons from orthopedic or neurosurgical specialties where the publication was affiliated with Japanese services. A total of 16,140 articles were identified by the Medline search. Most of the articles were excluded based on information provided in the title and abstract as they were not related to spine surgery. This study comprised 1768 articles published in the Medline database by Japanese spine surgeons from 2000 to 2013. The number of publications rose in a linear fashion, with the number of papers published increasing by 5.4 per year (p = 0.038). In recent years the publications were increasingly performed in conjunction with the neurosurgery and orthopedics specialties. This study showed a clear increase in publications (on Medline) by Japanese spine surgeons over the
Energy Technology Data Exchange (ETDEWEB)
Johansson, Per-Olof (Artesia Grundvattenkonsult (Sweden)); Juston, John (Juston Konsult (Sweden))
2011-06-15
This document reports the monitoring of water levels, electrical conductivities, temperatures and discharges at four brook discharge gauging stations, and the monitoring of water electrical conductivity at the outlet of Lake Bolundsfjaerden in the Forsmark area. The report presents data from 1 January through 31 December 2010 and is a continuation of reporting from Johansson and Juston (2007, 2009, 2011), which covered the periods from 1 April 2004 through 31 March 2007, 1 April 2007 through 31 December 2008, and 1 January through 31 December 2009, respectively. Long-throated flumes equipped with automatically recording devices were used for the discharge measurements. Every c. 14 days the water depths at the upstream edge of the flumes were measured manually by a ruler as a check. Electrical conductivity and temperature were automatically recorded and these parameters were also measured manually every c. 14 days with the site investigation field devices. SKB's Hydro Monitoring System (HMS) was used to collect and store all data. From HMS quality assured data were transferred to SKB's primary database Sicada. Measurements of levels, electrical conductivities and temperatures were made every 10 minutes (every 30 minutes for electrical conductivity at the outlet of Lake Bolundsfjaerden). For the calculation of discharge, quality assured water level data from the flumes were used. The calculation procedure included consolidation of the time series to hourly averages, screening of data for removal of short-term spikes, noise and other data that were judged erroneous. After the calculations were performed, the results were delivered to Sicada. The amplitudes of water level variations during this reporting period were 0.41-0.55 m and the mean electrical conductivities varied between 23 and 39 mS/m at the four discharge stations. However, due to mal-function of measuring devices for electrical conductivity, data were missing for relatively long time periods. Due
International Nuclear Information System (INIS)
Vuong Huu Tan
1997-03-01
This report contains information on activities of nuclear data and applied physics at the Nuclear Research Institute, Dalat, Vietnam for the period January 1st-December 31st 1996. The specific topics covered are the following: Development of filtered neutron beams. Investigation of average characteristics of nuclei in the unresolved enrgy region, Nuclear structure, Nuclear data for applications, Neutron beam utilization for applications, Nuclear analytical techniques and sedimentology
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1990 to December 31, 1990. Data were submitted by Institut Francais De Recherche...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1991 to December 31, 1991. Data were submitted by the Institut Francais De...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1998 to December 31, 1998. Data were submitted by the Institut Francais De...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1997 to December 31, 1997. Data were submitted by the Institut Francais De...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1994 to December 31, 1994. Data were submitted by Institut Francais De Recherche...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1993 to December 31, 1993. Data were submitted by Institut Francais De Recherche...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1999 to December 31, 1999. Data were submitted by the Institut Francais De...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, salinity, and nutrients profiles were collected from bottle and CTD casts from the OCEANIA from 01 January 1928 to 31 December 1999. Data were collected...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1992 to December 31, 1992. Data were submitted by Institut Francais De Recherche...
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected from the SEA-LAND DEFENDER from January 1, 1995 to December 31, 1995. Data were submitted by Institut Francais De Recherche...
National Oceanic and Atmospheric Administration, Department of Commerce — CTD and bottle data were collected from the ANDROMEDA and other platforms from a world-wide distribution from 01 January 1923 to 31 December 1999. Data were...
National Oceanic and Atmospheric Administration, Department of Commerce — CTD and bottle data were collected from AEGIR and other platforms in the North Atlantic Ocean from 01 January 2000 to 31 December 2000. CTD parameters include...
Annual progress report of the Department of Solid State Physics 1 January - 31 December 1993
International Nuclear Information System (INIS)
Skov Pedersen, J.; Almdal, K.; Feidenhans'l, R.; Clausen, K.N.; Bechgaard, K.
1994-01-01
Research in the department is concerned with ''Materials with Distinct Physical and Chemical Properties''. The principal activities of the department in the period from 1 January, to 31 December, 1993, are presented in this Progress Report. Neutrons and X-ray diffraction techniques are used to study a wide variety of problems in condensed matter physics and include: two- and three-dimensional structures, magnetic ordering, heavy fermions, high T c superconductivity, phase transitions in model systems, precipitation phenomena, and nanoscale structures in various materials. The research in chemistry includes chemical synthesis and physico-chemical investigations of small molecules and polymers, with emphasis on polymers with new optical properties, block copolymers, surface modified polymers, and supramolecular structures. This report is organized in 13 categories with the following headings: Theory, Monte Carlo simulations, and methods of data analysis. Magnetic structures, magnetic phase transitions, and spin dynamics. High T c superconductivity. Structures and structural phase transitions. Inclusions and precipitates in alloys and metals. Interaction of particles and photons with surfaces. Surfaces, interfaces, and amorphous structures. Langmuir films. Polymers. Molecular science. Microemulsions and biological systems. Instrument developments. Other activities. (au) (4 tabs., 109 ills., 168 refs.)
Annual progress report of the Department of Solid State Physics 1. January - 31 December 1992
International Nuclear Information System (INIS)
Skov Pedersen, J.; Lebech, B.; Lindgaard, P.-A.
1993-01-01
Research in the department is in the field of condensed matter physics. The principal activities of the department in the period from 1 january, to 31 December, 1992, are presented in this Progress Report. The department's research is predominantly experimental - utilising diffraction of neutrons and X-rays - and includes studies of two- and three-dimensional structures, magnetic ordering, heavy fermions, high T c superconductivity, phase transitions in model systems, precipitation phenomena, and nano-scale structures in various materials. The major interest of the department is in basic research but projects of a more applied nature are often up, prompted by the applicability of the developed techniques and expertise. For clarity, the contributions to this report are organized into 12 categories with the following headings: Theory, Monte Carlo simulations, and methods for data analysis. Magnetic structures, magnetic phase transitions,and spin dynamics. High T c superconductivity. Structures and structural phase transitions. Inclusions and precipitates in alloys and metals. Interaction of particles and photons with surfaces. Surfaces, interfaces, and amorphous structures. Langmuir films. Polymers. Microemulsions and biological systems. Instrumental developments. Other activities. (au) (1 tab., 101 ills., 165 refs.)
International Nuclear Information System (INIS)
Schery, S.D.; Wasiolek, P.T.
1998-01-01
This is the final report for DOE Grant DE-FG03-94ER6178, covering a performance period of 1 January 1994 through 31 December 1997. The DOE award amount for this period was $547,495. The objective of the project as stated in its proposal was open-quotes to improve our understanding of the physical processes controlling the concentration of radon, thoron, and their progeny in the atmospheric environment.close quotes The original project was directed at developing underlying science that would help with evaluation of the health hazard from indoor radon in the United States and implementation of corrective measures that might be employed to reduce the health hazard. As priorities within the Office of Health and Environment (OHER) changed, and the radon research program was phased out, emphasis of the project was shifted somewhat to be also relevant to other interests of the OHER, namely global pollution and climate change and pollution resulting from energy production. This final report is brief, since by reference it can direct the reader to the comprehensive research publications that have been generated by the project. In section 2, we summarize the main accomplishments of the project and reference the primary publications. There were seven students who received support from the project and their names are listed in section 3. One of these students (Fred Yarger, Ph.D. candidate) continues to work on research initiated through this project. No post-docs received support from the project, although one of the co-principal investigators (Dr. Piotr Wasiolek) received the majority of his salary from the project. The project also provided part-time support for a laboratory manager (Dr. Maryla Wasiolek). Section 4 lists chronologically the reports and publications resulting from the project (references 1 through 12), and the Appendix provides abstracts of major publications and reports
Energy Technology Data Exchange (ETDEWEB)
1982-09-01
This bibliography lists publications (831 abstracts) from the Pacific Northwest Laboratory's Department of Energy sponsored research and development programs from January 1978 through July of 1982. The abstracts are grouped in subject categories, as shown in the table of contents. Entries in the subject index also facilitate access by subject, e.g., High-Level Radioactive Wastes. Three indexes, each preceded by a brief description, are provided: personal author, subject, and report number. Cited are research reports, journal articles, books, patents, theses, and conference papers. Excluded are technical progress reports. Since 1978 the Nuclear Waste Management Quarterly Progress Report has been published under the series number PNL-3000. Beginning in 1982, this publication has been issued semiannually, under the series number PNL-4250. This bibliography is the successor to two others, BNWL-2201 (covering the years 1965-1976) and PNL-4050 (1975-1978). It is intended to provide a useful reference to literature in waste management written or compiled by PNL staff.
Report on the Watershed Monitoring Program at the Paducah Site January-December 1998
Energy Technology Data Exchange (ETDEWEB)
Kszos, L.A.; Peterson, M.J.; Ryon, M.G.; Southworth, G.R.
1999-03-01
Watershed Monitoring of Big Bayou and Little Bayou creeks has been conducted since 1987. The monitoring was conducted by the University of Kentucky between 1987 and 1991 and by staff of the Environmental Sciences Division (ESD) at Oak Ridge National Laboratory (ORNL) from 1991 to present. The goals of monitoring are to (1) demonstrate that the effluent limitations established for DOE protect and maintain the use of Little Bayour and Big Bayou creeks for frowth and propagation of fish and other aquatic life, (2) characterize potential environmental impacts, and (3) document the effects of pollution abatement facilities on stream biota. The watershed (biological) monitoring discussed in this report was conducted under DOE Order 5400.1, General Environmental Protection Program. Future monitoring will be conducted as required by the Kentucky Pollutant Discharge Elimination System (KPDES) permit issued to the Department of Energy (DOE) in March 1998. A draft Watershed Monitoring Program plan was approved by the Kentucky Division of Water and will be finalized in 1999. The DOE permit also requires toxicity monitoring of one continuous outfall and of three intermittent outfalls on a quarterly basis. The Watershed Monitoring Program for the Paducah Site during calendar year 1998 consisted of three major tasks: (1) effluent toxicity monitoring, (2) bioaccumulation studies, and (3) ecological surveys of fish communities. This report focuses on ESD activities occurring from january 1998 to December 1998, although activities conducted outside this time period are included as appropriate.
Arnold, Terri L.; Bexfield, Laura M.; Musgrove, MaryLynn; Lindsey, Bruce D.; Stackelberg, Paul E.; Barlow, Jeannie R.; Desimone, Leslie A.; Kulongoski, Justin T.; Kingsbury, James A.; Ayotte, Joseph D.; Fleming, Brandon J.; Belitz, Kenneth
2017-10-05
Groundwater-quality data were collected from 559 wells as part of the National Water-Quality Assessment Project of the U.S. Geological Survey National Water-Quality Program from January through December 2014. The data were collected from four types of well networks: principal aquifer study networks, which are used to assess the quality of groundwater used for public water supply; land-use study networks, which are used to assess land-use effects on shallow groundwater quality; major aquifer study networks, which are used to assess the quality of groundwater used for domestic supply; and enhanced trends networks, which are used to evaluate the time scales during which groundwater quality changes. Groundwater samples were analyzed for a large number of water-quality indicators and constituents, including major ions, nutrients, trace elements, volatile organic compounds, pesticides, radionuclides, and some constituents of special interest (arsenic speciation, chromium [VI] and perchlorate). These groundwater-quality data, along with data from quality-control samples, are tabulated in this report and in an associated data release.
National Oceanic and Atmospheric Administration, Department of Commerce — Physical data were collected using XBT profiles in the Indian Ocean from January 04, 2011 to December 29, 2011. Data were collected and submitted by the Australian...
Torikai, J.D.
1996-01-01
This report contains hydrologic and climatic data that describe the status of ground-water resources at U.S. Navy Support Facility, Diego Garcia. Data presented are from January 1993 through December 1995, although the report focuses on hydrologic events from October through December 1995 (fourth quarter of 1995). Cumulative rainfall for October through December 1995 was about 41 inches, which is 32 percent more than the mean cumulative rainfall of about 31 inches for October through December. The period October through December is within the annual wet season. Mean cumulative rainfall is calculated for the fixed base period 1951-90. Ground-water withdrawal during October through December 1995 averaged 931,000 gallons per day. Withdrawal for the same 3 months in 1994 averaged 902,900 gallons per day. Patterns of withdrawal during the fourth quarter of 1995 did not change significantly since 1993 at all five ground-water production areas. At the end of December 1995, the chloride concentration of the composite water supply was 60 milligrams per liter, well below the 250 milligrams per liter secondary drinking-water standard established by the U.S. Environmental Protection Agency. Chloride concentrations of the composite water supply from October through December 1995 ranged between 28 and 67 milligrams per liter. Chloride concentration of ground water in monitoring wells at Cantonment and Air Operations continued to decrease during the fourth quarter of 1995, with water from the deepest monitoring wells decreasing in chloride concentration by as much as 2,000 milligrams per liter. This trend follows increases in chloride concentration during the first half of 1995. A fuel leak at Air Operations caused the shutdown of ten wells in May 1991. Four of the wells resumed pumping for water-supply purposes in April 1992. The remaining six wells are being used to hydraulically divert fuel migration away from water-supply wells by recirculating about 150,000 gallons of water
Jamaiah, I; Rohela, M; Roshalina, R; Undan, R C
2004-12-01
The records of 284 snake bite cases presenting to the Kangar District Hospital, Perlis, west Malaysia, from January 1999 till December 2000 were carefully reviewed. Data on prevalence and types of snake bites, were recorded. The majority of the cases were among Malays (60.2%), followed by Chinese (16.9%), Indians (13%), and others which include Thai nationals, army personnel from Sabah and Sarawak, and foreign tourists (9.8%). A higher incidence was found in males (60.2%) and most cases were seen in the age group of 10-19 years (33%). Snake bites were more common between 2 PM and 9 PM (47.6%) and from 7 AM to 2 PM (33.4%). The snakes were positively identified in 68 cases, of which 50 were common cobras (Naja naja) (73%), 16 were Malayan pit vipers (Agkistrodon rhodostoma) (24%) and two were sea-snakes (3%).
Ground-water monitoring at the Hanford Site, January-December 1984
Energy Technology Data Exchange (ETDEWEB)
Cline, C.S.; Rieger, J.T.; Raymond, J.R.
1985-09-01
This program is designed to evaluate existing and potential pathways of exposure to radioactivity and hazardous chemicals from site operations. This document contains an evaluation of data collected during CY 1984. During 1984, 339 monitoring wells were sampled at various times for radioactive and nonradioactive constituents. Two of these constituents, specifically, tritium and nitrate, have been selected for detailed discussion in this report. Tritium and nitrate in the primary plumes originating from the 200 Areas continue to move generally eastward toward the Columbia River in the direction of ground-water flow. The movement within these plumes is indicated by changes in trends within the analytical data from the monitoring wells. No discernible impact on ground water has yet been observed from the start-up of the PUREX plant in December 1983. The shape of the present tritium plume is similar to those described in previous ground-water monitoring reports, although slight changes on the outer edges have been noted. Radiological impacts from two potential pathways for radionuclide transport in ground water to the environment are discussed in this report. The pathways are: (1) human consumption of ground water from onsite wells, and (2) seepage of ground water into the Columbia River. Concentrations of tritium in spring samples that were collected and analyzed in 1983, and in wells sampled adjacent to the Columbia River in 1984 confirmed that constituents in the ground water are entering the river via springs and subsurface flow. The primary areas where radionuclides enter the Columbia River via ground-water flow are the 100-N and 300 Areas and the shoreline adjacent to the Hanford Townsite. 44 refs., 25 figs., 11 tabs.
Measles outbreak--California, December 2014-February 2015.
Zipprich, Jennifer; Winter, Kathleen; Hacker, Jill; Xia, Dongxiang; Watt, James; Harriman, Kathleen
2015-02-20
On January 5, 2015, the California Department of Public Health (CDPH) was notified about a suspected measles case. The patient was a hospitalized, unvaccinated child, aged 11 years with rash onset on December 28. The only notable travel history during the exposure period was a visit to one of two adjacent Disney theme parks located in Orange County, California. On the same day, CDPH received reports of four additional suspected measles cases in California residents and two in Utah residents, all of whom reported visiting one or both Disney theme parks during December 17-20. By January 7,seven California measles cases had been confirmed, and CDPH issued a press release and an Epidemic Information Exchange (Epi-X) notification to other states regarding this outbreak. Measles transmission is ongoing.
National Oceanic and Atmospheric Administration, Department of Commerce — CTD, bottle, and other data were collected from the CORNIDE DE SAAVEDRA and other platforms from a world-wide distribution from 01 January 1914 to 31 December 1999....
Torikai, J.D.
1995-01-01
This report contains hydrologic and climatic data that describe the status of ground-water resources at U.S. Navy Support Facility, Diego Garcia. Data presented are from January 1992 through December 1994. This report concentrates on data from October through December 1994, and references previous data from 1992 through 1994. Cumulative rainfall for October through December 1994 was 55 inches which is higher than the mean cumulative rainfall of about 31 inches for the same 3 months. Total rainfall for 1994 was 131 inches which is 24 percent higher than the mean annual rainfall of 106 inches. In com- parison, total rainfall in 1992 and 1993 were 93 inches and 95 inches, respectively. Ground-water withdrawal during October through December 1994 averaged 903,000 gallons per day, while the annual withdrawal in 1994 was 942,700 gallons per day. Annual withdrawals in 1992 and 1993 averaged 935,900 gallons per day and 953,800 gallons per day, respectively. At the end of December 1994, the chloride concentration of the composite water supply was 28 milligrams per liter, well below the 250 milligrams per liter secondary drinking-water standard established by the U.S. Environmental Protection Agency. Chloride concentrations of the composite water supply from October through December 1994 ranged between 28 and 86 milligrams per liter. Chloride concentration of ground water in monitoring wells at Cantonment and Air Operations decreased in November and December, and seems to have leveled off by the end of the year. Although chloride concen- trations have decreased during the fourth quarter of 1994, there has been a general trend of increasing chloride concentrations in the deeper monitoring wells since the 1992 dry season, which began in March 1992. A fuel leak at Air Operations caused the shutdown of ten wells in May 1991. Four of the wells resumed pumping for water-supply purposes in April 1992. The remaining six wells are being used to hydraulically contain and divert fuel
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains transect data from two research cruises to the Ross Sea, Antarctica, aboard the RV Nathaniel B. Palmer (NBP) in December 2004 to January 2005...
International Nuclear Information System (INIS)
Laurito Torres, Paula
2014-01-01
The cure rate of patients treated with chemotherapy under the condition of locally advanced rectal adenocarcinoma is characterized in the Hospital San Juan de Dios between January 2008 and December 2010. Factors related to this treatment are described. Clinical records of 36 patients who received neoadjuvant treatment are studied. The data are collected, on staging studies; treatment toxicity; preservation of anal sphincter; downstaging; equipment and doses of radiotherapy; surgical resectability; complications of treatment; chemotherapy regimens; survival and free period of recurrence. The curative index of the patients investigated is similar to the publications of international studies. Some particularities of the treatment can be improved to obtain better results [es
Towards 100Sn with GASP + Si-ball + Recoil Mass Spectrometer: High-spin states of 105Sn and 103In
International Nuclear Information System (INIS)
De Angelis, G.; Farnea, E.; Gadea, A.; Sferrazza, M.; Ackermann, D.; Bazzacco, D.; Bednarczyk, P.; Bizzeti, P.G.; Bizzeti Sona, A.M.; Brandolini, F.; Burch, R.; Buscemi, A.; De Acuna, D.; De Poli, M.; Fahlander, C.; Li, Y.; Lipoglavsek, M.; Lunardi, S.; Makishima, A.; Menegazzo, R.; Mueller, L.; Napoli, D.; Ogawa, M.; Pavan, P.; Rossi-Alvarez, C.; Scarlassara, F.; Segato, G.F.; Seweryniak, D.; Soramel, F.; Spolaore, P.; Zanon, R.
1995-01-01
Very proton rich nuclei in the A∼100 region have been investigated using the GASP array coupled with the Recoil Mass Spectrometer (RMS) and the GASP Si-ball. High-spin states of 105 Sn and 103 In nuclei formed with the reaction 58 Ni+ 50 Cr at 210MeV have been investigated up to similar 10 and 7MeV of excitation energy respectively. We have confirmed the known excited states for both nuclei and extended to higher spin the level scheme. The experimental level schemes are compared with shell model calculations. ((orig.))
International Nuclear Information System (INIS)
Borders, D.M.; Ziegler, K.S.; Reece, D.K.; Watts, J.A.; Frederick, B.J.; McCalla, W.L.; Pridmore, D.J.
1995-08-01
This report summarizes, for the 12-month period January through December 1994, the available dynamic hydrologic data collected on the White Oak Creek (WOC) watershed as well as information collected on surface flow systems in the surrounding vicinity that may affect the quality or quantity of surface water in the watershed. The collection of hydrologic data is one component of numerous, ongoing Oak Ridge National Laboratory (ORNL) environmental studies and monitoring programs and is intended to characterize the quantity and quality of water in the surface flow system, assist with the planning and assessment of remedial action activities, provide long-term availability of data and quality assurance of these data, and support long-term measures of contaminant fluxes at a spatial scale to provide a comprehensive picture of watershed performance that is commensurate with future remedial actions
Huster, Karin M.J.; Patterson, Njogu; Schilperoord, Marian; Spiegel, Paul
2014-01-01
Introduction: There are nearly 3 million Syrian refugees, with more than 1 million in Lebanon. We combined quantitative and qualitative methods to determine cesarean section (CS) rates among Syrian refugees accessing care through United Nations High Commissioner for Refugees (UNHCR)-contracted hospitals in Lebanon and possible driving factors. Methods: We analyzed hospital admission data from UNHCR’s main partners from December 2012/January 1, 2013, to June 30, 2013. We collected qualitative data in a subset of hospitals through semi-structured informant interviews. Results: Deliveries accounted for almost 50 percent of hospitalizations. The average CS rate was 35 percent of 6,366 deliveries. Women expressed strong preference for female providers. Clinicians observed that refugees had high incidence of birth and health complications diagnosed at delivery time that often required emergent CS. Discussion: CS rates are high among Syrian refugee women in Lebanon. Limited access and utilization of antenatal care, privatized health care, and male obstetrical providers may be important drivers that need to be addressed. PMID:25191143
Huster, Karin M J; Patterson, Njogu; Schilperoord, Marian; Spiegel, Paul
2014-09-01
There are nearly 3 million Syrian refugees, with more than 1 million in Lebanon. We combined quantitative and qualitative methods to determine cesarean section (CS) rates among Syrian refugees accessing care through United Nations High Commissioner for Refugees (UNHCR)-contracted hospitals in Lebanon and possible driving factors. We analyzed hospital admission data from UNHCR's main partners from December 2012/January 1, 2013, to June 30, 2013. We collected qualitative data in a subset of hospitals through semi-structured informant interviews. Deliveries accounted for almost 50 percent of hospitalizations. The average CS rate was 35 percent of 6,366 deliveries. Women expressed strong preference for female providers. Clinicians observed that refugees had high incidence of birth and health complications diagnosed at delivery time that often required emergent CS. CS rates are high among Syrian refugee women in Lebanon. Limited access and utilization of antenatal care, privatized health care, and male obstetrical providers may be important drivers that need to be addressed.
International Nuclear Information System (INIS)
Morales Navarro, Karla Andrea
2013-01-01
The reproducibility of the histological diagnosis of cervix specimens processed by the Pathology Service of the San Juan de Dios Hospital from January to December 2010 was determined. When operational failures were detected, possible improvement processes were proposed, guided by the study's findings. A moderate concordance for the Bethesda System and poor to moderate for the classification of Cervical Intraepithelial Neoplasia, was obtained after analyzing the diagnoses issued by the observers when comparing the pairs of pathologists. The concordance was moderate when comparing each pathologist with the standard for both classifications. The correlation was excellent when comparing the Classification Cervical Intraepithelial Neoplasia versus the Bethesda System. The categories with highest concordance were high-grade intraepithelial lesion and cervical intraepithelial neoplasia 3 and minor agreement were low-grade intraepithelial lesion and cervical intraepithelial neoplasia 2. The results agree and in some cases the results exceed the reproduction noted in the literature world medical [es
Feng, Guolin; Zou, Meng; Qiao, Shaobo; Zhi, Rong; Gong, Zhiqiang
2018-03-01
This study investigates the changing relationship between the December North Atlantic Oscillation (NAO) and the following February East Asian trough (EAT) throughout the past 60 years. We found that the relationship between the December NAO and the following February EAT is significantly enhanced after the late 1980s compared with the period before the late 1980s. The changing relationship mainly results from the enhanced relationship between the December NAO and the following February North Atlantic mid-latitudes' sea surface temperature (SST) anomalies (NAMA) during the same period. During the period after the late 1980s, the persistent positive (negative) NAO pattern from December to the following January contributes to a positive (negative) NAMA, which reaches its maximum magnitude in the following February and excites an anomalous wave train along the North Atlantic and northern Eurasia, and significantly impacts the EAT. During the period before the late 1980s, the positive (negative) NAO pattern during December cannot persist into the following January, and the related positive (negative) NAMA is insignificant during the following February, causing the response of the simultaneous EAT to be insignificant as well. Moreover, there exists a significant impact of the December NAO on the December-January NAMA after the late 1980s, while the December-January NAMA is relatively less affected by the December NAO before the late 1980s. As a result, the simultaneous response of the atmospheric circulation anomalies to the December-January NAMA are evident before the late 1980s, and the positive (negative) NAMA can excite an anomalous wave train along the North Atlantic and northern Eurasia and significantly deepen (shallow) the downstream EAT. By contrast, after involving a feature of atmosphere forcing of SST, the simultaneous feedback of the December-January NAMA on EAT is significantly decreased after the 1980s.
Abstracts from the Fourteenth Rambam Research Day, December 7, 2017
Shraga Blazer (Editor); Ehud Klein (Editor)
2018-01-01
This Supplement of Rambam Maimonides Medical Journal presents the abstracts from the Fourteenth Annual Rambam Research Day. These abstracts represent the newest basic and clinical research coming out of Rambam Health Care Campus—research that is the oxygen for education and development of tomorrow’s generation of physicians. Hence, the research presented on Rambam Research Day is the foundation for understanding patient needs and improving treatment modalities. Bringing research from the benc...
Environmentally assisted cracking in light water reactors - annual report, January-December 2001
International Nuclear Information System (INIS)
Chopra, O. K.; Chung, H. M.; Clark, R. W.; Gruber, E. E; Hiller, R. W.; Shack, W. J.; Soppet, W. K.; Strain, R. V.
2003-01-01
This report summarizes work performed by Argonne National Laboratory on fatigue and environmentally assisted cracking (EAC) in light water reactors (LWRs) from January to December 2001. Topics that have been investigated include (a) environmental effects on fatigue S-N behavior of austenitic stainless steels (SSs), (b) irradiation-assisted stress corrosion cracking (IASCC) of austenitic SSs, and (c) EAC of Alloy 600. The effects of key material and loading variables, such as strain amplitude, strain rate, temperature, dissolved oxygen (DO) level in water, and material heat treatment, on the fatigue lives of wrought and cast austenitic SSs in air and LWR environments have been evaluated. The mechanism of fatigue crack initiation in austenitic SSs in LWR environments has also been examined. The results indicate that the presence of a surface oxide film or difference in the characteristics of the oxide film has no effect on fatigue crack initiation in austenitic SSs in LWR environments. Slow-strain-rate tensile tests and post-test fractographic analyses were conducted on several model SS alloys irradiated to ∼2 x 10 21 n · cm -2 (E > 1 MeV) (∼3 dpa) in He at 289 C in the Halden reactor. The results were used to determine the influence of alloying and impurity elements on the susceptibility of these steels to IASCC. Corrosion fatigue tests were conducted on nonirradiated austenitic SSs in high-purity water at 289 C to establish the test procedure and conditions that will be used for the tests on irradiated materials. A comprehensive irradiation experiment was initiated to obtain many tensile and disk specimens irradiated under simulated pressurized water reactor conditions at ∼325 C to 5, 10, 20, and 40 dpa. Crack growth tests were completed on 30% cold-worked Alloy 600 in high-purity water under various environmental and loading conditions. The results are compared with data obtained earlier on several heats of Alloy 600 tested in high-DO water under several
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature and depth data were collected using bathythermography (BT/XBT) from the Atlantic and Indian Ocean from January 1, 1941 to December 31, 1963. Data were...
7 CFR 61.103 - Determination of quality index.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Determination of quality index. 61.103 Section 61.103... quality index. The quality index of cottonseed shall be an index of purity and soundness, and shall be... index of 100. (b) Below prime quality cottonseed. The quality index of cottonseed that, by analysis...
Energy situation. January 2008; Conjoncture energetique. Janvier 2008
Energy Technology Data Exchange (ETDEWEB)
NONE
2008-02-15
This report makes a status of the French energy expenses, prices, production, consumption, demand, import and export since January 2005 and up to December 2007. Details are given separately for primary energy, solid mineral fuels, petroleum products, natural gas and electricity. (J.S.)
Programme of Seminars September to December 2003
2003-01-01
Dates Jours/ Days Places Disponibles*/ Places Available* Séminaires bilingues/Bilingual seminars Gestion de la qualité/Quality Management 10, 11, 12 November 3 oui Managing a CERN unit - to be a Manager/ Gérer une unité au CERN - Etre Manager (Module 3) 11, 12 November 2 non Gestion des risques /Risk Management 11, 12 December 2 oui Seminars in English Communicating effectively in your team 19, 20 November 2 yes Performance Appraisal Training MAPS 26, 27, 28 November 3 yes Managing by Project 3, 4 December 3 no Making Presentations 1, 2 December & 12 January 2004 3 yes Performance Appraisal Training MAPS 8, 9, 10 December 3 no Séminaires en Français Formation à l'entretien d'appréciation MAPS 26, 27, 28 novembre 3 non Formation à l'entretien d'appréciation MAPS 8, 9, 10 décembre 3 oui Animer ou participer à une ré...
National Oceanic and Atmospheric Administration, Department of Commerce — Physical, meteorological, and other data were collected from FIXED PLATFORMS in the TOGA Area - Pacific (30 N to 30 S) from 01 January 1988 to 31 December 1988. Data...
Tank 241-B-103 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
The Defense Nuclear Facilities Safety Board (DNFSB) has advised the US Department of Energy (DOE) to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The data quality objective (DQO) process was chosen as a tool to be used to identify sampling and analytical needs for the resolution of safety issues. As a result, a revision in the Federal Facility Agreement and Consent Order (Tri-Party Agreement or TPA) milestone M-44-00 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process... Development of TCPs by the DQO process is intended to allow users (e.g., Hanford Facility user groups, regulators) to ensure their needs will be met and that resources are devoted to gaining only necessary information.'' This document satisfies that requirement for Tank 241-B-103 (B-103) sampling activities. Tank B-103 was placed on the Organic Watch List in January 1991 due to review of TRAC data that predicts a TOC content of 3.3 dry weight percent. The tank was classified as an assumed leaker of approximately 30,280 liters (8,000 gallons) in 1978 and declared inactive. Tank B-103 is passively ventilated with interim stabilization and intrusion prevention measures completed in 1985
International Nuclear Information System (INIS)
1992-04-01
This report is a summary of the US Department of Energy's (DOE) cultural resource investigations for the Uranium Mill Tailings Remedial Action (UMTRA) Project sites in Colorado. This report is intended to fulfill the DOE's obligation for an annual report as stated in the Programmatic Memorandum of Agreement executed between the DOE, the Advisory Council on Historic Preservation, and the Colorado State Historic Preservation Officer in December 1984. Summaries of the cultural resource surveys and identified resources are provided for the UMTRA Project sites in the vicinities of Durango, Grand Junction, Gunnison, Maybell, Naturita, Rifle, and Slick Rock. This report covers all UMTRA Project cultural resource activities in Colorado from January through December 1991
Abstraction and climate change in Europe
Laize, Cedric
2014-01-01
Invited oral presentation at the British Hydrological Society National meeting on "Hydroecology and water abstraction: science, practice and licence reform", Birmingham, 18 December 2013. Link below: full paper in River Research and Applications (Laize et al., 2014)
International Nuclear Information System (INIS)
Bartos, B.; Kowalska, E.; Bilewicz, A.; Skarnemark, G.
2009-01-01
103m Rh is a very promising radionuclide for Auger electron therapy due to its very low photon/electron ratio. The goal of the present work was the elaboration a method for production of large quantities of 103m Rh for generator system. It was found that the combination of solvent extraction with evaporation of 103 RuO 4 followed by decomposition of H 5 IO 6 makes it possible to produce 103m Rh of high radionuclidic and chemical purity. (author)
International Nuclear Information System (INIS)
Borders, D.M.; Frederick, B.J.; Watts, J.A.
1994-10-01
This report summarizes, for the 12-month period (January through December 1993), the available dynamic hydrologic data collected, primarily, on the White Oak Creek (WOC) watershed along with information collected on the surface flow systems which affect the quality or quantity of surface water. Identification of spatial and temporal trends in hydrologic parameters and mechanisms that affect the movement of contaminants supports the development of interim corrective measures and remedial restoration alternatives. In addition, hydrologic monitoring supports long-term assessment of the effectiveness of remedial actions in limiting the transport of contaminants across Waste Area Grouping (WAG) boundaries and ultimately to the off-site environment. For these reasons, it is of paramount importance to the Environmental Restoration Program (ERP) to collect and report hydrologic data, an activity that contributes to the Site Investigations (SI) component of the ERP. This report provides and describes sources of hydrologic data for Environmental Restoration activities that use monitoring data to quantify and assess the impact from releases of contaminants from ORNL WAGs
Generator separation of 103Ru//sup 103m/Rh
International Nuclear Information System (INIS)
Epperson, C.E.
1975-01-01
A generator for producing carrier-free Rh-103m was developed using a liquid extraction technique. Initially, Ru-103 chloride was converted to the sulfate by moderate fuming for 80 minutes in 1:1 sulfuric acid. The Ru-103 was then brought to its highest oxidation state with 0.2 N ceric sulfate. Ru-103 tetroxide was removed from an aqueous equilibrium solution of Ru-103/Rh-103m by three one-minute extractions into CCl 4 . The Rh-103m daughter was not extracted under these conditions. Yields of Rh-103m exceeded 90 percent theoretical. The Ru-103 removed by CCl 4 could be recovered by two hours of back-extraction into 2 M sulfuric acid containing 5 mg of sodium sulfite. A cyclic extraction system was made possible by employing sulfate media. Equilibrium Ru-103 could be repeatedly extracted and recovered, thereby producing a ''generator'' system for the production of Rh-103m. Ru-103 chloride can be converted to the sulfate and then stored for at least 38 days prior to extraction. By performing the fuming step whenever convenient, the time required to perform an extraction separation was reduced to 15 minutes. Prior treatment of glassware surfaces with dilute sulfuric acid prevented Ru-103 glass adsorption losses and made glassware much easier to decontaminate. Off-the-shelf reagent-grade CCl 4 could be used without further purification. Efforts to separate Rh-103m from Ru-103 by chromatography techniques were unsuccessful
National Oceanic and Atmospheric Administration, Department of Commerce — CTD data were collected in the Arabian Sea from the MANGEN and other platforms from 10 January 1992 to 28 December 1994. Data include profiles of temperature,...
International Nuclear Information System (INIS)
Loria Mendez, Mildred
2011-01-01
The epidemiological and radiological characteristics are described in patients with gastric cancer studied by gastroduodenal series in the Servicio de Radiologia of the Hospital San Juan de Dios, during the period January to December 2009. The cumulative incidence is estimated in patients with gastric cancer. The study population is identified according to sex, age and provenance. Radiographic findings and stage of the gastric cancer patients are described [es
International Nuclear Information System (INIS)
1987-12-01
This bibliography contains citations concerning corn starch processing. The physical and chemical properties, and nutritive value of corn starch and corn starch products are considered. Studies of gamma-irradiated corn starch are included. (This updated bibliography contains 397 citations, 123 of which are new entries to the previous edition.)
Institute of Scientific and Technical Information of China (English)
2017-01-01
Supplementary Short Board: Orderly Cultivate Housing Leasing Market WANG Guangtao (Former Minister of Ministry of Construction) Abstract: In December 2016, Central Economic Work Conference proposed that to promote the steady and healthy development of the real estate market, it should adhere to the “house is used to live, not used to speculate” position. At present, the development of housing leasing market in China is lagging behind. It is urgent to improve the housing conditions of large cities and promote the urbanization of small and medium-sized cities. Therefore, it is imperative to innovate and supplement the short board to accelerate the development of housing leasing market.
Environmentally assisted cracking in light water reactors annual report January - December 2005.
Energy Technology Data Exchange (ETDEWEB)
Alexandreanu, B.; Chen, Y.; Chopra, O. K.; Chung, H. M.; Gruber, E. E.; Shack, W. J.; Soppet, W. K.
2007-08-31
This report summarizes work performed from January to December 2005 by Argonne National Laboratory on fatigue and environmentally assisted cracking in light water reactors (LWRs). Existing statistical models for estimating the fatigue life of carbon and low-alloy steels and austenitic stainless steels (SSs) as a function of material, loading, and environmental conditions were updated. Also, the ASME Code fatigue adjustment factors of 2 on stress and 20 on life were critically reviewed to assess the possible conservatism in the current choice of the margins. An approach, based on an environmental fatigue correction factor, for incorporating the effects of LWR environments into ASME Section III fatigue evaluations is discussed. The susceptibility of austenitic stainless steels and their welds to irradiation-assisted stress corrosion cracking (IASCC) is being evaluated as a function of the fluence level, water chemistry, material chemistry, and fabrication history. For this task, crack growth rate (CGR) tests and slow strain rate tensile (SSRT) tests are being conducted on various austenitic SSs irradiated in the Halden boiling water reactor. The SSRT tests are currently focused on investigating the effects of the grain boundary engineering process on the IASCC of the austenitic SSs. The CGR tests were conducted on Type 316 SSs irradiated to 0.45-3.0 dpa, and on sensitized Type 304 SS and SS weld heat-affected-zone material irradiated to 2.16 dpa. The CGR tests on materials irradiated to 2.16 dpa were followed by a fracture toughness test in a water environment. The effects of material composition, irradiation, and water chemistry on growth rates are discussed. The susceptibility of austenitic SS core internals to IASCC and void swelling is also being evaluated for pressurized water reactors. Both SSRT tests and microstructural examinations are being conducted on specimens irradiated in the BOR-60 reactor in Russia to doses up to 20 dpa. Crack growth rate data
International Nuclear Information System (INIS)
Gonzalez, D.A.
1987-09-01
This report documents the environmental surveillance program at the Nevada Test Site as conducted by the Department of Energy (DOE) onsite radiological safety contractor from January 1986 through December 1986. It presents results and evaluations of radioactivity measurements in air and water, and of direct gamma radiation exposure rates. It establishes relevant correlations between the data recorded and DOE concentration guides (CG's). External gamma exposure levels and radioactivity in air and water on the Nevada Test Site were low compared to DOE guidelines. The highest average gross beta concentration in air was 0.005% of the DOE concentration guide (CG). The highest average Pu-239 concentration was 7.7% of the standard. The highest average tritium concentration was 0.39% of the standard. Kr-85 concentrations increased slightly from CY-1985 to CY-1986. Xe-133 remained nondetectable with some exceptions. The highest average gross beta concentration in potable water remained within the applicable standard for drinking water. The highest average Pu-239 concentration from contaminated waters was 0.0005% of the concentration guide. The highest average tritium concentration in noncontaminated water was 6% of the level for drinking water required by the National Interim Primary Drinking Water Regulation. The amounts of tritium-bearing effluent released to contaminated waste ponds was calculated and reported to DOE Headquarters. Gamma radiation measurements were roughly the same in CY-1986 relative to the previous year. All surveillance results from the Radioactive Waste Management Site (RWMS) indicate that no detectable releases of radioactive materials occurred in that network in 1986. 29 refs., 14 figs., 23 tabs
Energy Technology Data Exchange (ETDEWEB)
1980-01-01
Work performed on the High Temperature Turbine Technology Program, Phase II - Technology Test and Support Studies during the period from January 1, 1979 through December 31, 1979 is summarized. Objectives of the program elements as well as technical progress and problems encountered during this Phase II annual reporting period are presented. Progress on design, fabrication and checkout of test facilities and test rigs is described. LP turbine cascade tests were concluded. 350 hours of testing were conducted on the LP rig engine first with clean distillate fuel and then with fly ash particulates injected into the hot gas stream. Design and fabrication of the turbine spool technology rig components are described. TSTR 60/sup 0/ sector combustor rig fabrication and testing are reviewed. Progress in the design and fabrication of TSTR cascade rig components for operation on both distillate fuel and low Btu gas is described. The new coal-derived gaseous fuel synthesizing facility is reviewed. Results and future plans for the supporting metallurgical programs are discussed.
Medium energy measurements of N-N parameters: Progress report, January 1, 1988--December 31, 1988
International Nuclear Information System (INIS)
Riley, P.J.
1988-01-01
We report here progress made for the period January 1, 1988, to December 31, 1988, for the Department of Energy Three-year Grant No. DE-FG05-88ER40446, first year. A major part of the work has been and will continue to be associated with research done at the Nucleon Physics Laboratory (NPL) at the Los Alamos Meson Physics Facility (LAMPF). The aim of the experimental program is the determination of the nucleon-nucleon amplitudes at medium energies. The required data include both elastic and inelastic experiments, and in addition the measurement of polarization and polarization transfer parameters. The measurements can be broadly categorized into those of proton-proton elastic scattering, which probe the isospin-1 elastic channel, neutron-proton elastic scattering, which allow measurements of isospin-0 amplitudes, proton-proton inelastic scattering, and neutron-proton inelastic scattering. We are nearing completion of a long-range series of p-p elastic scattering measurements, and believe that the required goals have been achieved. During the past few years we have emphasized proton-proton inelastic scattering measurements, and believe that the determination of the I = 1 inelastic phase shifts is progressing well. The I = 0 amplitudes, both elastic, and inelastic, are still poorly determined, at best. These measurements require a much more intense polarized neutron beam than is yet available, and therefore have needed the high-intensity optically pumped polarized ion source, due to come on-line during late 1989. During the past year our work emphasized p-p elastic differential scattering cross-section measurements in the energy range 500--800 MeV at LAMPF. The measurements aimed for an absolute accuracy of 1%, and we believe that this was achieved. We also have been involved in what we believe is the first partial wave analysis of pp → npπ + data
Prediction of palladium-103 production using the Monte Carlo code MCNPX
International Nuclear Information System (INIS)
Mahmodi, Mahbobeh; Sadeghi, Mahdi; Tenreiro, Claudio
2013-01-01
Highlights: ► The production of 103 Pd activity in 15 h of irradiation at 200 μA was calculated to be 685 mCi. ► MCNPX was used to calculate the energy distribution of the proton flux on the Rh target. ► The activity based on the MCNPX was calculated to be 674.58 mCi. - Abstract: The radionuclide 103 Pd (T 1/2 = 16.991 d; decays almost exclusively by EC to 103m Rh, T 1/2 = 56.114 min) has been of great interest in prostate and eye cancer therapy due to its suitable half-life and decay characteristics. 103 Pd has been produced by proton irradiation of a 103 Rh target through the 103 Rh(p,n) 103 Pd reaction. In this paper, the Monte Carlo simulation code (MCNPX) was used to calculate the energy distribution of the proton flux on the Rh target. The activity based on the MCNPX was calculated to be 674.58 mCi. Good agreement between the theoretical and the experimental data of the 103 Pd activity and the activity estimation based on MCNPX calculation was observed. This study demonstrated that MCNPX provides a suitable tool for the simulation of radionuclide production using proton irradiation
Amchitka Radiobiological Program progress report, January 1979-December 1979
International Nuclear Information System (INIS)
Thornberg, L.D.; Sibley, T.H.; Nakatani, R.E.
1980-07-01
The objective of the Amchitka Radiobiological Program for the period 1970-1979 was to determine the extent of radionuclide contamination from world-wide atmospheric fallout and from the detonation of three underground nuclear blasts on Amchitka Island. The objective is achieved, by the collection and radiological analyses of biological and environmental samples and by background radiation measurements. Leakage of radionuclides from the underground sites of the Amchitka nuclear detonations would be suspected if the contamination was significntly greater than would be expected from world fallout. An account of the program from July 1970 to December 1978 has been given in nine previous reports from the Laboratory of Radiation Ecology to the Nevada Operations Office of the US Department of Energy. This report is an account of the program for calendar year 1979. The results of analyses of the samples collected in 1979 lead to the same conclusions as in previous years; i.e., there is no evidence that the radionuclide contamination at Amchitka Island is greater than would be expected from world fallout except for a slight contamination of the Long Shot Mud Pits with tritium
Half-life and intensities of photons of 103Pd isotope
International Nuclear Information System (INIS)
Popov, Yu.S.; Zakharova, L.V.; Kupriyanov, V.N.; Andreev, O.I.; Pakhomov, A.N.; Vakhetov, F.Z.
2001-01-01
Half-life and intensities of photons forming during 103 Pd isotope decay are determined by the methods of semiconductor x-ray and γ-spectrometry. 103 Pd is applied in nuclear medicine for preparation of 103m Rh isomer (T 1/2 =56 min) being used in irradiation of prostate neoplasms. Half-life of 103 Pd isotope is 16±0.6 days, relative intensities of x-ray and γ-photons are: K α /Kβ=5.1±0.4; 358 keV - 100 rel.units; 295 keV - 12.3±0.4 rel.units; 497 keV - 17.6±0.6 rel.units. Errors are represented for confidence probability 95 % [ru
Nuclear medicine 2009. Abstracts; NuklearMedizin 2009. Vortraege
Energy Technology Data Exchange (ETDEWEB)
NONE
2009-07-01
The journal contains the abstracts of 188 lectures and the abstracts of 103 poster contributions concerning the following topics: systemic therapy; oncology: PET/therapy; physics: device technology; oncology: PET/new pharmaceuticals; neurology: receptors; motion correction methods; oncology: PET/FDG; cardiology; malign thyroid tumors; neuroendocrine tumors; radiochemistry {sup 1}8F, oncology: pre-clinic PET; neurology-oncology-activation; physics: quantification; various topics; radiochemistry: radioactive metals; benign thyroid tumors; therapeutical studies; neurology: neurodegeneration; oncology: SPECT/planar scintigraphy; local therapy; inflammation; dosimetry - radiation protection; radiochemistry: halogens.
Remembering the 100,000 lives campaign
Directory of Open Access Journals (Sweden)
Robbins RA
2016-06-01
Full Text Available No abstract available. Article truncated after 150 words. Earlier this week the Institute for Healthcare Improvement (IHI emailed its weekly bulletin celebrating that it has been ten years since the end of the 100,000 Lives Campaign (Appendix 1. This was the campaign, according to the bulletin, that put IHI on the map. The Campaign started at the IHI National Forum in December 2004, when IHI's president, Don Berwick, announced that IHI would work together with nearly three-quarters of the US hospitals to reduce needless deaths by 100,000 over 18 months. A phrase borrowed from political campaigns became IHI's cri de coeur: “Some is not a number. Soon is not a time.” The Campaign relied on six key interventions: Rapid Response Teams; Improved Care for Acute Myocardial Infarction; Medication Reconciliation; Preventing Central Line Infections; Preventing Surgical Site Infections; Preventing Ventilator-Associated Pnemonia [sic]. According to the bulletin, the Campaign’s impact rippled across the organization and the world. IHI listed some ...
Jhung, Michael A; Nelson, Deborah I
2015-02-06
During December 15, 2014-January 16, 2015, the U.S. Department of Agriculture received 14 reports of birds infected with Asian-origin, highly pathogenic avian influenza A (HPAI) (H5N2), (H5N8), and (H5N1) viruses. These reports represent the first reported infections with these viruses in U.S. wild or domestic birds. Although these viruses are not known to have caused disease in humans, their appearance in North America might increase the likelihood of human infection in the United States. Human infection with other avian influenza viruses, such as HPAI (H5N1) and (H5N6) viruses and (H7N9) virus, has been associated with severe, sometimes fatal, disease, usually following contact with poultry.
International Nuclear Information System (INIS)
1996-01-01
On 5 January 1996, the Director General received a communication dated 4 January 1996 from the Permanent Mission of Australia transmitting a Statement of 28 December 1995 by the Acting Prime Minister of Australia on ''The Fifth French Nuclear Test''
Het einde van de open-cv per 1 januari 2011?
van de Streek, J.L.
2010-01-01
Het wetsvoorstel tot 'Vaststelling van Titel 7.13 BW (vennootschap)' is sinds 25 januari 2005 aanhangig bij de Eerste kamer. Op de valreep van 2009, te weten 15 december 2009, is ook de voorgestelde invoeringswet Titel 7.13 BW beland in de Eerste Kamer. Hoewel de voorgestelde invoeringswet in eerste
CHIS – New insurance cards and phone numbers valid from 1 January 2015
HR Department
2014-01-01
New health insurance cards will be posted to CHIS members by mid-December. The new cards are valid from 1 January 2015 and will no longer indicate an end date. You may use the card as long as you are member; if lost, a new card will be delivered on request. From 1 January 2015, please use the telephone numbers printed on your new insurance card: +41 (0)22 718 63 00 for UNIQA’s Head Office, available during office hours +41 (0)22 819 44 77 for UNIQA medical assistance and telemedicine, available 24/7 +1 844 477 0777 in the event of hospitalisation in the USA, available 24/7 Further information on the new services (UNIQA assistance and telemedicine) is available in the CHIS Bulletin 39, which you will receive at your home address during the second half of December. Please note that from 1 January 2015: You should not call the emergency number 24/24 on your old insurance card, as this service will be discontinued. You no longer need to obtain a separate insurance card from Meds...
R-ES-ONANCE--I -D-ec-ember-19-9-6
Indian Academy of Sciences (India)
Conventional. Energy, Environmental Energetics, Environmental Biotechnology, Environmental. Engineering, Environmental Chemistry, Environmental Management, and Environmental. Ethics. Abstracts (200 words) are welcome before December 15,96.
International Nuclear Information System (INIS)
BECHTEL NEVADA
2005-01-01
This Post-Closure Inspection Report provides an analysis and summary of inspections for Corrective Action Unit (CAU) 92, Area 6 Decon Pond Facility, Nevada Test Site, Nevada. CAU 92 was closed in accordance with the Resource Conservation and Recovery Act (RCRA) Part B Operational Permit (Nevada Division of Environmental Protection, 1995) and the Federal Facility Agreement and Consent Order of 1996 on May 11, 1999. CAU 92 consists of two Corrective Action Sites (CASs): CAS 06-04-01, Decon Pad oil/Water Separator; and CAS 06-05-02, Decontamination Pond (RCRA). Both CASs have use restrictions; however, only CAS 06-05-02, Decontamination Pond (RCRA), requires post-closure inspections. CAS 06-04-01, Decon Pad Oil/Water Separator, is located inside the fence at the Building 6-605 compound. This report covers the annual period January 2004 through December 2004
DOE-NABIR PI Workshop: Abstracts January 31-February 2, 2000
Energy Technology Data Exchange (ETDEWEB)
Pratt, Mary (ed.)
2000-01-01
The mission of the NABIR program is to provide the scientific understanding needed to use natural processes and to develop new methods to accelerate those processes for the bioremediation of contaminated soils, sediments and groundwater at U.S. Department of Energy (DOE) facilities. The program is implemented through seven interrelated scientific research elements (Assessment, Bacterial Transport, Biogeochemical Dynamics, Bimolecular Science and Engineering, Biotransformation and Biodegradation, Community Dynamics/Microbial Ecology and System Engineering, Integration, Prediction and Optimization); and through an element called Bioremediation and its Societal Implications and Concerns (BASIC), which addresses societal issues and concerns of stakeholders through communication and collaboration among all relevant groups, including community leaders and representatives, engineers, scientists, lawyers, etc. The initial emphasis of NABIR program research is on the bioremediation of metals and radionuclides in the subsurface below the root zone, including both thick vadose and saturated zones. The material presented at this year's workshop focuses on research funded in FY 1998-2000 by DOE's Office of Science through its Office of Biological and Environmental Research. Sixty-eight projects have been funded in the scientific program elements, and two have been funded in the BASIC program. Abstracts of these programs are summarized in this booklet, along with abstracts of other DOE programs related to research in the NABIR program.
BEATRIX-2 Program third annual report, January 1990--December 1990
International Nuclear Information System (INIS)
Slagle, O.D.; Hollenberg, G.W.
1991-10-01
The BEATRIX-2 experiment is an International Energy Agency (IEA) sponsored collaborative experiment between Japan, Canada, and the United States. The purpose of the experiment is to evaluate the performance of ceramic solid breeder materials in a fast neutron environment. To do this, an in-situ tritium recovery experiment is being conducted in the Fast Flux Test Facility (FFTF), located on the Hanford site near Richland, Washington, and operated by Westinghouse Hanford Company (WHC). The Pacific Northwest Laboratory (PNL), Richland, Washington, together with the Japan Atomic Energy Research Institute (JAERI) and Atomic Energy of Canada Limited (AECL) are responsible for conducting the experiment. This work is divided into two phases: Phase 1 was irradiated from January 1990 until March 1991 in Cycle 11 of FFTF, while Phase 2 will be irradiated in Cycle 12, which began in June 1991 and is scheduled to continue until approximately October of 1991 for 300 effective full power days (EFPD)
Directory of Open Access Journals (Sweden)
Ristović Milan
2006-01-01
Full Text Available The revolt that members and supporters of the leftist movement EAM-ELAS staged in Athens in early December 1944 against the Greek royal and British forces ushered into the second "round" of the civil war in Greece. The developments in the neighborhood draw much attention in Yugoslavia, where the war of liberation was in its final phases in parallel with the elimination of political rivals to the new government in which communists played a central role. This attention was not only a result of ideological solidarity, it also had to do with the "Macedonian Question", i.e. the position of Slavic Macedonian minority in northern Greece, an issue that had aroused a debate between Greek and Yugoslav communists in 1944. Difficulties in relations between the Yugoslav partisan leadership and the British, pressure from London, the passivity of the Soviet Union as regards the developments in Athens, a stalemate on the Srem Front, fights with the remaining collaborationist forces, compelled Yugoslavia to take a reserved position and avoid direct involvement in Greece. Appeals of Greek communists for aid in military supplies, promised on the eve of the revolt, failed to provoke a tangible response of the Yugoslav leadership. Once the revolt was crushed by the British and a truce between the EAM-ELAS and the royal government signed a wave of migration to Yugoslavia ensued of the borderland civilian Slavic Macedonian population but also of several thousand radical Greek leftists unwilling to accept the Varkiza agreement.
International Nuclear Information System (INIS)
2002-01-01
Since December 1999, passive monitors have been in use to support the Air Quality Monitoring Program begun that year. It currently includes 33 passive stations throughout the zone, which measure nitrogen dioxide, sulphur dioxide and ozone. There are also four continuous monitoring stations, two stations operated by Parkland Airshed Management Zone (PAMZ) (Caroline and portable), one operated by Alberta Environment at Red Deer, as well as one station operated by West Central Airshed Society at Hightower Ridge. In 2000 and 2001, the portable station was operated at seven locations within the zone. There were four objectives to this study: (1) provide a summary of the PAMZ air quality monitoring data for the period January 2000 to December 2001, (2) provide an interpretation of that data with regard to emission sources and PAMZ's high priority issues, (3) provide an assessment of the PAMZ Air Quality Monitoring Program performance with respect to the primary objective of the program, and (4) make recommendations on improving or expanding the Air Quality Program. It was found that the ambient concentrations of the different compounds and parameters were below the guidelines established by the Alberta Ambient Air Quality Guidelines (AAAQG) and Canada-wide Standards, with some exceptions which were listed. Ozone concentrations proved to be higher in the Foothills, rather than in an east-west pattern, and lower in the vicinity of transportation corridors (Highway 2). Nitrogen dioxide concentrations were also high in the transportation corridor. The eastern half of the zone was exposed to higher concentrations of sulphur dioxide due to the more dense population and the presence of industries and major highways. Most of the terms of reference of the Technical Working Group appear to be met by the PAMZ Air Quality Monitoring Program. Some recommendations were included in the report, such as the addition of a fifth continuous Air Quality Monitoring station that is portable
Directory of Open Access Journals (Sweden)
Joaquín Hortal
2012-12-01
Full Text Available Proceedings of the Sixth biennial conference of the International Biogeography Society, an international and interdisciplinary society contributing to the advancement of all studies of the geography of nature. Held at Miami, Florida, USA, 9 – 13 January 2013.Abstracts include:(i the Opening, MacArthur & Wilson Award and Alfred Russel Award Plenary Lectures;(ii four symposia entitled "Island Biogeography: New Syntheses", "Beyond Bergmann: New perspectives on the biogeography of traits", "The Convergence of Conservation Paleontology and Biogeography" and "Predicting species and biodiversity in a warmer world: are we doing a good job?";(iii oral presentations from contributed papers on Phylogeography, Marine Biogeography, Biogeography of the Anthropocene, Hot Topics in biogeography, Island Biogeography, Neotropical Biogeography, Global Change Biogeography, Historical and Paleo-biogeography, Conservation Biogeography and Global-Scale Biogeography; and(iv contributions presented as posters on Phylogeography, Geospatial techniques and land cover, Biodiversity gradients and macroecology, Biogeography of traits, Island Biogeography, Neotropical Biogeography, Conservation Biogeography, Disturbance and Disease Biogeography, Climate Change Biogeography and Historical and Paleo-Biogeography.
Final Technical Status Report as of January 2000
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-01-12
This project was completed in January 1996 after a panel of four Licensing Executive Society members met in Boston (December 1995) to discuss the requirements for, incentive of and barriers to licensing horn independent inventors and small businesses. Three team members from Mohawk Research Corporation reviewed and analyzed the discussion notes to reach a series of recommendations which are contained in a report which was submitted in February under separate cover. This completes this project.
L'Anse Warden Electric Company Boiler Number One Emission Test Report – December 2016
L’Anse Warden Electric Company (LWEC) submitted results from an emission test on the Boiler No. 1 stack. Stack air emission testing was conducted in December 2016, and the report became available in January 2017
A possible in vivo generator 103Pd/103mRh-Recoil considerations
International Nuclear Information System (INIS)
Rooyen, Johann van; Szucs, Zoltan; Rijn Zeevaart, Jan
2008-01-01
The use of Auger emitters as potential radiopharmaceuticals is increasingly investigated. One such radionuclide of interest is 103m Rh. This can be produced from 103 Ru or from 103 Pd in an in vivo generator. A potential problem with this concept is the recoil of the 103m Rh out of the carrier molecule and even out of the target cell. In order to determine whether this would happen in the 103 Pd/ 103m Rh case calculations were done to prove that this does not happen. From theoretical considerations it seems that the 103 Pd/ 103m Rh in vivo generator system would be possible
Business report on the 14th financial year from January 1 to December 31, 1977
International Nuclear Information System (INIS)
1978-03-01
Within this annual report, the director's report deals with technical and economic aspects and with personnel problems. The annual settlement statement is explained, and economic balance is given for December 31, 1977, and the profit-loss calculation is given. (UA) [de
Physics Division annual report, 1 January-31 December 1984
Energy Technology Data Exchange (ETDEWEB)
1985-10-01
A brief overview of each of the several areas of research is given with a list of resulting publications. Areas of research include electron-positron annihilation, neutrino interactions, neutrinoless double beta decay of /sup 100/Mo, double beta decay of /sup 76/Ge, antiproton-proton interactions, right-handed gauge boson effects, muon decay asymmetry parameter measurements, supernovae detection, Nemesis search, and detector development. Areas of theoretical research include electroweak interactions, strong interactions, nonperturbative dynamics, supersymmetry, and cosmology and particle physics. 34 figs. (WRF)
Physics Division annual report, 1 January-31 December 1984
International Nuclear Information System (INIS)
1985-10-01
A brief overview of each of the several areas of research is given with a list of resulting publications. Areas of research include electron-positron annihilation, neutrino interactions, neutrinoless double beta decay of 100 Mo, double beta decay of 76 Ge, antiproton-proton interactions, right-handed gauge boson effects, muon decay asymmetry parameter measurements, supernovae detection, Nemesis search, and detector development. Areas of theoretical research include electroweak interactions, strong interactions, nonperturbative dynamics, supersymmetry, and cosmology and particle physics. 34 figs
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 25; Issue 3-4. Volume 25, Issue 3-4. September-December 2004, pages 103-223. pp 103-113. TreePM Method for Two-Dimensional Cosmological Simulations · Suryadeep Ray · More Details Abstract Fulltext PDF. We describe the two-dimensional TreePM ...
Directory of Open Access Journals (Sweden)
Storey Donald F
2012-10-01
Full Text Available Abstract Background Antimicrobial stewardship has been promoted as a key strategy for coping with the problems of antimicrobial resistance and Clostridium difficile. Despite the current call for stewardship in community hospitals, including smaller community hospitals, practical examples of stewardship programs are scarce in the reported literature. The purpose of the current report is to describe the implementation of an antimicrobial stewardship program on the medical-surgical service of a 100-bed community hospital employing a core strategy of post-prescriptive audit with intervention and feedback. Methods For one hour twice weekly, an infectious diseases physician and a clinical pharmacist audited medical records of inpatients receiving systemic antimicrobial therapy and made non-binding, written recommendations that were subsequently scored for implementation. Defined daily doses (DDDs; World Health Organization Center for Drug Statistics Methodology and acquisition costs per admission and per patient-day were calculated monthly for all administered antimicrobial agents. Results The antimicrobial stewardship team (AST made one or more recommendations for 313 of 367 audits during a 16-month intervention period (September 2009 – December 2010. Physicians implemented recommendation(s from each of 234 (75% audits, including from 85 of 115 for which discontinuation of all antimicrobial therapy was recommended. In comparison to an 8-month baseline period (January 2009 – August 2009, there was a 22% decrease in defined daily doses per 100 admissions (P = .006 and a 16% reduction per 1000 patient-days (P = .013. There was a 32% reduction in antimicrobial acquisition cost per admission (P = .013 and a 25% acquisition cost reduction per patient-day (P = .022. Conclusions An effective antimicrobial stewardship program was implemented with limited resources on the medical-surgical service of a 100-bed community hospital.
International Nuclear Information System (INIS)
Coffey, H.E.
1979-08-01
This comprehensive report provides data for February 1979 on active regions, synoptic solar maps, solar radio emission, energetic solar particles and plasma, and solar x-ray radiation. It also provides synoptic charts and abbreviated calendar record for January 1979. The miscellaneous data include solar radio emission, cosmic rays-April and May 1979, Solar flares-January 1979, and regional flare index - December 1978
International Nuclear Information System (INIS)
1978-02-01
Net electrical energy generated in 1977 was 2,922,683.7 MWH with the generator on line 6,959.8 hours. Information is presented concerning operations, power generation, shutdowns, maintenance, changes, tests, experiments, occupational personnel radiation exposures, and primary coolant chemistry. Data on radioactive effluent releases, meteorology, environmental monitoring, and potential radiation doses to individuals for July 7, 1977 to December 31, 1977 are also included
International Nuclear Information System (INIS)
Arzumanov, A.; Berger, V.; Borissenko, A.; Gorodisskaya, N.; Ilmatov, I.; Knyazev, A.; Koptev, V.; Lyssukhin, S.; Platov, A.; Sychikov, G.; Zheltov, D.
2004-01-01
The objectives of the present work are to increase thermal stability of cyclotron targets for production of Tl-201 isotope, increase Tl-203 regeneration rate at radiochemical reprocessing of the targets and develop production technology for radiochemical sources based on Rd-103 isotope. Electrochemical coating of copper substrate with Tl increased the beam current at target irradiation from 100 μA to 125 μA. Further increase of the beam current results in sharp decrease of target stability time at irradiation to 15 min at beam current 150 μA. Thermal calculations and tests at the electron-beam stand predict satisfactory stability at such currents. The discrepancy with the irradiation results has not been explained. More accurate specification of regimes for Tl-203 electrochemical recovery from irradiated targets and better matching of the electrolyte composition made it possible to increase the recovery rate up to 99.5%. Before the present Project, the INP had no experience in production of radioactive sources based on Pd-103. Thermo-diffusion extraction of Pd-103 from irradiated rhodium foil has been chosen as a technology-defining method. The process assures good extraction rate and high purity of extracted isotope. Production of Pd-103 sources based on this technology is much simpler compared to the same based on electrochemical processes. (author)
A Note on Natural Extensions in Abstract Algebraic Logic
Czech Academy of Sciences Publication Activity Database
Cintula, Petr; Noguera, Carles
2015-01-01
Roč. 103, č. 4 (2015), s. 815-823 ISSN 0039-3215 R&D Projects: GA ČR(CZ) GA13-14654S EU Projects: European Commission(XE) 247584 - MATOMUVI Institutional support: RVO:67985807 ; RVO:67985556 Keywords : abstract algebraic logic * consequence relations * natural extensions * transfer theorems Subject RIV: BA - General Mathematics Impact factor: 0.724, year: 2015
International Nuclear Information System (INIS)
Li Sandi, Silvia
2014-01-01
Nosocomial infections have become more important to the health system by the high costs of these, but are little data available about them in recent years. The clinical utility of the determination of serum galactomannan (GMS) in patients with high risk of contracting the infection by Aspergillus spp, was assessed, between January 2009 and December 2012 at the Hospital San Juan de Dios. Several existing studies in the scientific literature have already evaluated the clinical usefulness, specific data have been inexistent for Costa Rica or for Central America and the Caribbean; so it is important to have known whether the conduct of the test has been similar to the other populations or have specific variations [es
Energy Technology Data Exchange (ETDEWEB)
Johansson, Per-Olof (Artesia Grundvattenkonsult (Sweden)); Juston, John (Juston Konsult (Sweden))
2011-03-15
This document reports the monitoring of water levels, electrical conductivities, temperatures and discharges at four brook discharge gauging stations, and the monitoring of water electrical conductivity at the outlet of Lake Bolundsfjaerden in the Forsmark area. The report presents data from 1 January through 31 December 2009 and is a continuation of reporting from Johansson and Juston (2007, 2009), which covered the periods from 1 April 2004 through 31 March 2007 and 1 April 2007 through 31 December 2008, respectively. Long-throated flumes equipped with automatically recording devices were used for the discharge measurements. Every c. 14 days the water depths at the upstream edge of the flumes were measured manually by a ruler as a check. Electrical conductivity and temperature were automatically recorded and these parameters were also measured manually every c. 14 days with the site investigation field devices. SKB's Hydro Monitoring System (HMS) was used to collect and store all data. From HMS quality assured data were transferred to SKB's primary database Sicada. Measurements of levels, electrical conductivities and temperatures were made every 10 minutes (every 30 minutes for electrical conductivity at the outlet of Lake Bolundsfjaerden). For the calculation of discharge, quality assured water level data from the flumes were used. The calculation procedure included consolidation of the time series to hourly averages, screening of data for removal of short-term spikes, noise and other data that were judged erroneous. After the calculations were performed, the results were delivered to Sicada. The amplitudes of water level variations during this reporting period were 0.26-0.33 m at the four stations. The mean electrical conductivities varied between 26 and 41 mS/m at the four discharge stations. The electrical conductivity at the outlet of Lake Bolundsfjaerden varied between 53 and 188 mS/m during the period with the higher values at the end of the
Report on the work of the Institute of Nuclear Sciences 27 January - December 1976
International Nuclear Information System (INIS)
1977-10-01
The work of the New Zealand Institute of Nuclear Sciences during the period January-June 1975 is summarized under the following headings: A) Nuclear Physics; B) Radiation Research; C) Isotope Geochemistry - Stable Isotopes; D) Radiocarbon Dating and Fallout; E) Radioisotope Applications; F) Instrumentation. Appendices on current research projects, staff publications and library holdings are included. (D.C.R.)
Waste management research abstracts no. 13. Information on research in progress
Energy Technology Data Exchange (ETDEWEB)
NONE
1982-05-01
The 222 research abstracts contained in this issue have been collected during recent months ending 15 January 1982. The abstracts reflect research currently in progress in the field of radioactive waste management: environmental impacts, site selection, decontamination and decommissioning, environmental restoration and legal aspects of radioactive waste management. The abstracts have been printed in the language and in the form of submittal and without any changes other than minor editorial ones.
Waste management research abstracts no. 13. Information on research in progress
International Nuclear Information System (INIS)
1982-05-01
The 222 research abstracts contained in this issue have been collected during recent months ending 15 January 1982. The abstracts reflect research currently in progress in the field of radioactive waste management: environmental impacts, site selection, decontamination and decommissioning, environmental restoration and legal aspects of radioactive waste management. The abstracts have been printed in the language and in the form of submittal and without any changes other than minor editorial ones
75 FR 3232 - Northern Natural Gas Company; Notice of Request Under Blanket Authorization
2010-01-20
... Natural Gas Company; Notice of Request Under Blanket Authorization January 8, 2010. Take notice that on December 30, 2009, Northern Natural Gas Company (Northern), 1111 South 103rd Street, Omaha, Nebraska 68124...'s regulations under the Natural Gas Act for authorization to increase its maximum storage capacity...
Progress at LAMPF, Clinton P. Anderson Meson Physics Facility, January-December 1984
International Nuclear Information System (INIS)
Allred, J.C.
1985-04-01
Progress at LAMPF is the annual progress report of the MP Division of the Los Alamos National Laboratory. The report includes brief reports on research done at LAMPF by researchers from other institutions and Los Alamos divisions. Abstracts of separate sections of the report were prepared separately for the data base
Séminaire de physique corpusculaire | 19 December
2012-01-01
Active and Sterile Neutrinos in Cosmology by Prof. Julien Lesgourges, EPFL (Lausanne) Wednesday 19 December 2012 at 11:15 Science III, Auditoire 1S081 30, quai Ernest-Ansermet, 1211 Genève 4 Abstract: Review of status and prospects for constraining the neutrino sector using cosmological observables, with an emphasis on cosmic microwave background and large scale structure data. More information here.
International Nuclear Information System (INIS)
1989-01-01
This bibliography contains citations concerning the migration of food-packaging materials into foods. Plastic, glass, cardboard, metal, and ceramic containers are discussed. Techniques for analyzing packaging contamination are included. (Contains 90 citations fully indexed and including a title list.)
International Nuclear Information System (INIS)
Skinner, G.B.; Lifshitz, A.; Wood, D.R.; Chiang, C.C.
1978-01-01
This is a second annual progress report on this project. The period covered by the first report (June through December, 1976) was devoted to building and testing a shock tube and an optical system to be used to measure H and D atom concentrations. During 1977 this apparatus was completed and used. The performance of our microwave discharge lamps was characterized by numerous high-resolution spectroscopic profiles, so that the shapes of the Lyman-alpha lines produced under various operating conditions are now quite well-known. Measurements of H or D atom concentrations in shock-heated mixtures of D 2 -N 2 O-Ar, D 2 -O 2 -Ar and H 2 -O 2 -Ar have been made. During the balance of the contract year (January 1 through May 31, 1978) measurements of H or D atom concentrations in shock-heated mixtures of CD 4 -Ar, C 8 H 18 (2,2,3,3, tetramethyl butane)-Ar, C 8 H 18 -CH 4 -Ar, C 3 H 8 -Ar and C 3 H 8 -CH 4 -Ar will be made, and kinetic data on reactions of H and D atoms deduced from the experimental results
Calvert Cliffs Nuclear Power Plant, Units 1 and 2. Annual operating report: January--December 1976
International Nuclear Information System (INIS)
1977-01-01
Unit 1 successfully completed its first core cycle with unit availability of 95.2 percent. Saltwater leakage into the condenser continues to be a problem. Unit 2 achieved initial criticality November 30 and was initially paralleled to the Baltimore system on December 7. Information is presented concerning operations, specifications, maintenance, shutdowns and power reduction, and personnel exposures
This is an author index for RAND Economics Department publications issued between January 1, 1960 and December 31, 1965, and available in the open...As a reference aid, the names of all authors are given alphabetically in the Author List immediately preceding the Author Index .
International Nuclear Information System (INIS)
Capron, J.M.
2008-01-01
The 100-F-44:2 waste site is a steel pipeline that was discovered in a junction box during confirmatory sampling of the 100-F-26:4 pipeline from December 2004 through January 2005. The 100-F-44:2 pipeline feeds into the 100-F-26:4 subsite vitrified clay pipe (VCP) process sewer pipeline from the 108-F Biology Laboratory at the junction box. In accordance with this evaluation, the confirmatory sampling results support a reclassification of this site to No Action. The current site conditions achieve the remedial action objectives and the corresponding remedial action goals established in the Remaining Sites ROD. The results of confirmatory sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River
International Nuclear Information System (INIS)
Glanzman, V.M.
1980-01-01
This bibliography presents reports released to the public between January 1, 1979, and December 31, 1979, by personnel of the US Geological Survey. Reports include information on underground nuclear testing and waste management projects at the NTS (Nevada Test Site) and radioactive waste projects at the WIPP (Waste Isolation Pilot Plant) site, New Mexico. Reports on Project Dribble, Tatum Dome, Mississippi, previously prepared as administrative reports and released to the public as 474-series reports during 1979 are also included in this bibliography
Sukatendel, K.; Hasibuan, C. L.; Pasaribu, H. P.; Sihite, H.; Ardyansah, E.; Situmorang, M. F.
2018-03-01
In 2010, Indonesia was ranked fifth in the world for the number of premature birth. Prematurity is a multifactorial problem. Preterm Labor (PTL) can occur spontaneously without a clear cause. Preventing PTL, its associated risk factors must be recognized first. To analyze risk factors associated with the incidence of PTL. It is a cross sectional study using secondary data obtained from medical records in Haji Adam Malik general hospital, Pirngadi general hospital and satellite hospitals in Medan from January 2014 to December 2016. Data were analyzed using chi-square method and logistic regression test. 148 cases for each group of preterm labor and obtained term laborin this study. Using the logistic regression test, three factors with astrong association to the incidence of identifiedpreterm labor. Antenatal Care frequency (OR 2,326; CI 95%), leucorrhea (OR 6,291; 95%), and premature rupture of membrane (OR 9,755; CI 95%). In conclusion, antenatal care frequency, leucorrhea, and history of premature rupture of themembrane may increase the incidence of Preterm Labor (PTL).
Yucca Mountain Site characterization project bibliography, January--June 1991
International Nuclear Information System (INIS)
1992-06-01
Following a reorganization of the Office of Civilian Radioactive Waste Management in 1990, the Yucca Mountain Project was renamed Yucca Mountain Site Characterization Project. The title of this bibliography was also changed to Yucca Mountain Site Characterization Project Bibliography. Prior to August 5, 1988, this project was called the Nevada Nuclear Waste Storage Investigations. This bibliography contains information on this ongoing project that was added to the Department of Energy's Science and Technology Database from January 1, 1990, through December 31, 1991
Radioactive waste processing and disposal: a bibliography. Part 1. Abstracts; Part 2. Indexes
International Nuclear Information System (INIS)
McLaren, L.H.
1985-03-01
This compilation contains 4567 citations to foreign and domestic research reports, journal articles, patents, conference proceedings, and books dealing with radioactive waste management. These citations were added to the DOE Energy Data Base from January 1983 through December 1983. Five indexes are included: Corporate Author, Personal Author, Subject, Contract Number, and Report Number
Hyperactivity and Dust Composition of Comet 103P/Hartley 2 During the EPOXI Encounter
Harker, David E.; Woodward, Charles E.; Kelley, Michael S. P.; Wooden, Diane H.
2018-05-01
Short-period comet 103P/Hartley 2 (103P) was the flyby target of the Deep Impact eXtended Investigation on 2010 November 4 UT. This comet has a small hyperactive nucleus, i.e., it has a high water production rate for its surface area. The underlying cause of the hyperactivity is unknown; the relative abundances of volatiles in the coma of 103P are not unusual. However, the dust properties of this comet have not been fully explored. We present four epochs of mid-infrared spectra and images of comet 103P observed from Gemini-South +T-ReCS on 2010 November 5, 7, 21 and December 13 UT, near and after the spacecraft encounter. Comet 103P exhibited a weak 10 μm emission feature ≃1.14 ± 0.01 above the underlying local 10 μm continuum. Thermal dust grain modeling of the spectra shows the grain composition (mineralogy) was dominated by amorphous carbon and amorphous pyroxene with evidence for Mg-rich crystalline olivine. The grain size has a peak grain radius range of a peak ∼ 0.5–0.9 μm. On average, the crystalline silicate mass fraction is ≃0.24, fairly typical of other short-period comets. In contrast, the silicate-to-carbon ratio of ≃0.48–0.64 is lower compared to other short-period comets, which indicates that the flux measured in the 10 μm region of 103P was dominated by amorphous carbon grains. We conclude that the hyperactivity in comet 103P is not revealing dust properties similar to the small grains seen with the Deep Impact experiment on comet 9P/Tempel 1 or from comet C/1995 O1 (Hale–Bopp).
International Nuclear Information System (INIS)
Lopez Mena, Stephanie
2015-01-01
Percentage of pathologic complete response is determined in patients with rectal cancer, treated with neoadjuvant chemotherapy and radiotherapy, in the Servicio de Radioterapia from Hospital Mexico, in the period between January 2009 and December 2013. Tumor histology is determined. The distance of the tumor is identified with respect to the anal margin. The correlation between the TNM staging and the response received in this type of neoadjuvant therapy is described. Radiotherapy dose used in each case is described. Different schemes of chemotherapy used are characterized. The acute side effects most common are determined in the study population [es
Beta-decay of {sup 103}In: evidence for the Gamow-Teller resonance near {sup 100}Sn
Energy Technology Data Exchange (ETDEWEB)
Karny, M. [Warsaw Univ. (Poland). Inst. of Experimental Physics; Batist, L.; Brown, B.A. [and others
1998-04-01
The {beta} decay of the neutron-deficient isotope {sup 103}In was investigated by using total absorption {gamma}-ray spectrometry on mass-separated sources. The measurement reveals a high-lying resonance of the {beta}-decay strength in striking disagreement with high-resolution {gamma}-ray data. The result is discussed in comparison with shell-model predictions. (orig.)
22 CFR 208.100 - What does this part do?
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What does this part do? 208.100 Section 208.100 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION...., p. 235) and 31 U.S.C. 6101 note (Section 2455, Public Law 103-355, 108 Stat. 3327). ...
Narasimman, S; Nallusamy, M; Hassan, S
2013-01-01
Oesophageal atresia (EA) and tracheoesophageal fistula (TEF) is one of the congenital anomaly occurring in the newborns with the incidence of 1 in 2500 births seen worldwide. A retrospective review of newborns admitted to Hospital Sultanah Bahiyah (HSB) from 1st January 2000 to 31st December 2009 was done. The objective was to look at the influence of birth weight, time of surgical intervention, presence of other congenital anomaly and presence of preoperative pneumonia to the immediate outcome (mortality) of the surgery. There were 47 patients with oesophageal atresia, out of which 26 (55%) were males and 21 (45%) females. The distribution of patients by race were 34 Malays (72%), 9 Chinese (19%) and 4 Indians (9%). The birth weight of the babies range from 0.8 kg to 4.0 kg and there was a significant association with the outcome of the surgery (p< 0.05). Most of the babies (20) were operated within 24 hours of presentation but there was no significant association to the outcome. 23 (49%) of them were born with congenital malformation and there was a significant association with the outcome of the surgery (p<0.05). Based on the chest roentgenogram, 20 (43%) of them had pneumonia with significant association with the outcome (p<0.05). The mortality rate is 23% and the causes of death were pneumonia (36%), renal failure (18%), cardiac malformation (18%) and multiple congenital malformations (28%). The outcome of EA and TEF is determined mainly by birth weight, congenital malformations and presence of preoperative pneumonia in HSB.
International Nuclear Information System (INIS)
Mamadaliev, N.; Levin, V.I.; Malinin, A.B.
1978-01-01
103 Pd separated from metal rhodium irradiated with deuterons has been used without a carrier for sup( 03m)Rh generator The generator of sup(103m)Rh is a column 6mm in diameter filled with an anionite in Cl - form (Dowex-2,8,200-400 mesh) with an adsorbed parent isotope of 103 Pd. As a result of its decay, a 103 Rh daughter isotope is accumulated, which can be washed out from the generator from time to time with a corresponding solution. To prepare the generator, 0.5g of the resin with an adsorbed 103 Pd is charged into the column containing 1g of the same resin. Washing out with 2N HCl yields more than 90% of sup(103m)Rh with a radionuclide purity of more than 99.99%
MANAGEMENT BOARD MEETING OF 13 JANUARY 2000
2000-01-01
For information'Y2K' Follow-up ReportThe CERN Y2K co-ordinator, S. Jarp (IT Division), reported that CERN had not encountered any significant problems with the Y2K bug at the turn of the century, although a couple of real Y2K problems had occurred, which had been quickly resolved. That outcome had been possible thanks to a programme of concerted action over several months discussed and agreed by the Management Board in February 1999, which had included a complete shutdown of the Computer Centre as the cheapest, safe stand most efficient option. Following the closure of systems on 30 December to avoid the potential risks associated with operations spanning 1999 and 2000, user services had been successfully brought back up on 2 January with only a few minor hitches, ready for the re-opening of the Laboratory on 3 January. He stressed that, in spite of claims by the world's press that Y2K dangers had been greatly exaggerated, the efforts made had been fully justified since, without them, the Organisation would h...
International Nuclear Information System (INIS)
2015-01-01
The Biotechnology and Nuclear Agriculture Research Institute (BNARI) of the Ghana Atomic Energy Commission (GAEC) exists carry out research and development activities on safe applications of biotechnology and nuclear science and transfer these technologies to end-users for increased agricultural production, health, industrial and economic development for poverty alleviation in Ghana. The 2015 Annual Report covers the organisational structure; various research activities and abstracts of publications. Also listed are training courses and seminars organised during the reporting year.
DEFF Research Database (Denmark)
Heegaard, Steffen; Jensen, O.A.; Prause, J.U.
2000-01-01
ophthalmology, A103, conjunctiva, gp100, HMB-45, malignant melanoma, MART-1, melan-A, S100, uvea......ophthalmology, A103, conjunctiva, gp100, HMB-45, malignant melanoma, MART-1, melan-A, S100, uvea...
Influenza A virus NS1 gene mutations F103L and M106I increase replication and virulence
Directory of Open Access Journals (Sweden)
Ping Jihui
2011-01-01
Full Text Available Abstract Background To understand the evolutionary steps required for a virus to become virulent in a new host, a human influenza A virus (IAV, A/Hong Kong/1/68(H3N2 (HK-wt, was adapted to increased virulence in the mouse. Among eleven mutations selected in the NS1 gene, two mutations F103L and M106I had been previously detected in the highly virulent human H5N1 isolate, A/HK/156/97, suggesting a role for these mutations in virulence in mice and humans. Results To determine the selective advantage of these mutations, reverse genetics was used to rescue viruses containing each of the NS1 mouse adapted mutations into viruses possessing the HK-wt NS1 gene on the A/PR/8/34 genetic backbone. Both F103L and M106I NS1 mutations significantly enhanced growth in vitro (mouse and canine cells and in vivo (BALB/c mouse lungs as well as enhanced virulence in the mouse. Only the M106I NS1 mutation enhanced growth in human cells. Furthermore, these NS1 mutations enhanced early viral protein synthesis in MDCK cells and showed an increased ability to replicate in mouse interferon β (IFN-β pre-treated mouse cells relative to rPR8-HK-NS-wt NS1. The double mutant, rPR8-HK-NS-F103L + M106I, demonstrated growth attenuation late in infection due to increased IFN-β induction in mouse cells. We then generated a rPR8 virus possessing the A/HK/156/97 NS gene that possesses 103L + 106I, and then rescued the L103F + I106M mutant. The 103L + 106I mutations increased virulence by >10 fold in BALB/c mice. We also inserted the avian A/Ck/Beijing/1/95 NS1 gene (the source lineage of the A/HK/156/97 NS1 gene that possesses 103L + 106I, onto the A/WSN/33 backbone and then generated the L103F + I106M mutant. None of the H5N1 and H9N2 NS containing viruses resulted in increased IFN-β induction. The rWSN-A/Ck/Beijing/1/95-NS1 gene possessing 103L and 106I demonstrated 100 fold enhanced growth and >10 fold enhanced virulence that was associated with increased tropism for lung
S100B proteins in febrile seizures
DEFF Research Database (Denmark)
Mikkonen, Kirsi; Pekkala, Niina; Pokka, Tytti
2011-01-01
S100B protein concentrations correlate with the severity and outcome of brain damage after brain injuries, and have been shown to be markers of blood-brain barrier damage. In children elevated S100B values are seen as a marker of damage to astrocytes even after mild head injuries. S100B proteins...... may also give an indication of an ongoing pathological process in the brain with respect to febrile seizures (FS) and the likelihood of their recurrence. To evaluate this, we measured S100B protein concentrations in serum and cerebrospinal fluid from 103 children after their first FS. 33 children...
Bilateral tubal ligation in a rural hospital in the Niger Delta, Nigeria ...
African Journals Online (AJOL)
Background and Objective: To document bilateral tubal ligation (BTL) rate and highlight the need to improve on the rates. Materials and Methods: A retrospective review of BTLs done in a five-year period from January 2000 to December 2004 constituted the study group. Results: There were a total of 103 BTLs, 58 were ...
Adjustments to financial benefits and contributions with effect from 1 January 2012
2012-01-01
In accordance with recommendations made by the Finance Committee and decisions taken by Council in December 2010, June and December 2011, certain financial benefits and contributions impacting salaries and stipends have been adjusted with effect from 1 January 2012. 1) Five-yearly review 2010 (decisions taken by Council in December 2010) In line with the second phase of Council decisions, increases of 1% and 2% have been applied to basic salaries in Career Path D and Career Paths E to G respectively1); In addition, Health Insurance Scheme contribution rates have been modified (from 4.27%) to 4.41% for the member and (from 6.59%) to 6.86% for the Organization. 2) Package of measures towards restoring full funding of the Pension Fund (decisions taken by Council in June 2011) In accordance with Council decisions, the Organization’s contribution rate for new members of the Fund as of 1.1.2012 is 17%. The provisions for current members remain unchanged. 3)&nb...
International Nuclear Information System (INIS)
Belyavenko, V.S.; Borozenets, G.P.; Vishnevskij, I.N.; Zheltonozhskij, V.A.
1986-01-01
103 Pd decay in different chemical states has been investigated. The change of the partial half-life period equal to 0.67±0.15% has been detected. The γ-spectrum has been measured to a high precision. The new data have been obtained on population probabilities of 103 Rh excited states and the total energy of decay for 103 Pd has been determined to a high precision (543.0±0.8). The values of log ft have been determined
2010-07-01
... commencing commercial operation during the period from January 1, 1993, through December 31, 1995. 73.18 Section 73.18 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) SULFUR DIOXIDE ALLOWANCE SYSTEM Allowance Allocations § 73.18 Submittal procedures for units...
National Physics Conference. Paper Abstracts
International Nuclear Information System (INIS)
Marinela Dumitriu, Editorial Coordination.
1995-01-01
This book contains the abstracts of the proceedings of the annual Romanian Physics Conference organized by Romanian Physics Society. The conference was held on November 30 to December 2, 1995 in the city of Baia Mare. It was organized in the following nine sections: 1 - Astrophysics, Particle Physics, Nuclear Physics, Molecular and Atomic Physics; 2 - Plasma Physics; 3 - Biophysics; 4 - Technical Physics; 5 - Theoretical Physics; 6 -The Physics of Energy; 7 - The Physics of Environment 8 - Solid State Physics; 9 - Optical and Quantum Electronics. The full texts can be obtained on request from the Romanian Physical Society or directly from authors
Absolute calibration of the Rh-103(n,n')Rh-103m reaction rate
International Nuclear Information System (INIS)
Taylor, W.H.; Murphy, M.F.; March, M.R.
1979-05-01
The uncertainties in determining the absolute values of the Rh-103(n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to approximately +-5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the IAEA. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)
International Nuclear Information System (INIS)
2000-01-01
The research abstracts contained in this issue have been collected during recent months and cover the period between January 1 and June 30, 2000. The abstracts reflect research currently in progress in the field of radioactive waste management. This issue contains 297 abstracts that present ongoing work in 33 countries and an international organization
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-07-01
The research abstracts contained in this issue have been collected during recent months and cover the period between January 1 and June 30, 2000. The abstracts reflect research currently in progress in the field of radioactive waste management. This issue contains 297 abstracts that present ongoing work in 33 countries and an international organization.
International Nuclear Information System (INIS)
Zamora Lopez, Rafael Angel
2012-01-01
Ultrasound is evaluated as a method of diagnosis for intra-articular pathologies of knee, widely used as a means to rule out injuries to the institutional level. The advantages of ultrasound are mentioned: low cost, availability and is a noninvasive method. In order to implement this study has been to create a question about the real utility of ultrasound in the Hospital Mexico, as further support for the correct diagnosis of knee pathology. A search of clinical records of patients was conducted in the orthopedics and traumatology service with diagnosis of gonalgia, to which was conducted a preoperative ultrasound and, subsequently, have been operated at the Hospital by arthroscopy, during the period 1 January 2010 to December 31, 2010. Subsequently, a comprehensive review of the operative notes was performed, ultrasound reports and records, for the purpose of making an analysis and compare the results of both procedures. This paper has clearly demonstrated poor training in musculoskeletal system of the ultrasound operators. A poor correlation was determined between the arthroscopic results against ultrasound. The need to create care protocols to patients with intra-articular pathology of knee was evidenced. (author) [es
Environmental Regulatory Update Table, January/February 1992
Energy Technology Data Exchange (ETDEWEB)
Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.
1992-03-01
The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated bi-monthly with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action. This table is for January/February 1992.
Absolute calibration of the Rh-103 (n, n') Rh-103m reaction rate
International Nuclear Information System (INIS)
Taylor, W.H.; Murphy, M.F.; March, M.R.
1979-05-01
The uncertainties in determining the absolute values of the Rh-103 (n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to ∼±5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the I.A.E.A. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)
Health physics research abstracts no. 11
International Nuclear Information System (INIS)
1984-07-01
The present issue No. 11 of Health Physics Research Abstracts is the continuation of a series of Bulletins published by the Agency since 1967. They collect reports from Member States on Health Physics research in progress or just completed. The main aim in issuing such reports is to draw attention to work that is about to be published and to enable interested scientists to obtain further information through direct correspondence with the investigators. The attention of users of this publication is drawn to the fact that abstracts of published documents on Health Physics are published eventually in INIS Atomindex, which is one of the output products of the Agency's International Nuclear Information System. The present issue contains 235 reports received up to December 1983 from the following Member States. In parentheses the country's ISO code and number of reports are given
Studies of nuclear processes. Progress report, 1 January 1977--31 December 1977
International Nuclear Information System (INIS)
1977-01-01
Research during this period is summarized in a number of brief reports (most less than one page in length); some of these are in fact the abstracts of published work. It may reasonably be assumed that completed work will be presented in appropriate reports and journals. Topics included in this report are the following: proton-induced nuclear interactions; deuteron-induced nuclear interactions; polarized source upgrading; developments in equipment and technique; nuclear and atomic theory investigations; atomic effects in nuclear bombardment; summary of related activities; and lists of publications, personnel, etc
Microscale Ocean Biophysics, Aspen Center for Physics: January 11-16 2015
2017-04-19
dissolved organic matter persist in the deep ocean: Is the solution dilution ?” 8.45 – Kwangmin Son...AUTHORS 7. PERFORMING ORGANIZATION NAMES AND ADDRESSES 15. SUBJECT TERMS b. ABSTRACT 2. REPORT TYPE 17. LIMITATION OF ABSTRACT 15. NUMBER OF PAGES...Microscale Ocean Biophysics, Aspen Center for Physics, January 11-16, 2015 Microscopic organisms control ocean processes at global scales. However
Energy Technology Data Exchange (ETDEWEB)
Dean, Gordon
1954-01-31
The first fifteen semiannual reports of the United States Atomic Energy Commission to Congress cover the major unclassified activities of the Commission from January 1947 through December 1953. This cumulative name and subject index provides a guide to the information published in these reports.
International Nuclear Information System (INIS)
2000-12-01
Programme and abstracts of the 1st international congress of the South African Radiobiology Society, held in conjunction with the South African Association of Physicists in Medicine and Biology and the University of Stellenbosch, from 10-13 December 2000. This publication contain the abstracts of the forty-four papers and posters that were presented
International Nuclear Information System (INIS)
Rivard, M.J.; Butler, W.M.; Merrick, G.S.; Devlin, P.M.; Hayes, J.K.; Hearn, R.A.; Lief, E.P.; Meigooni, A.S.; Williamson, J.F.
2008-01-01
Purpose - In 2004, the American Association of Physicists in Medicine (AAPM) issued a report outlining recommended 125 I and 103 Pd datasets for consistency in calculating brachytherapy dose distributions. In 2005, to aid evaluating the clinical impact of implementing these datasets, the AAPM assessed the historical dependence of how prescribed doses differed from administered doses for 125 I and 103 Pd for permanent implantation of the prostate. Consequently, the American Brachytherapy Society (ABS) considered the nature of these changes towards issuing recommended dose prescriptions for 125 I and 103 Pd interstitial brachytherapy implants for mono-therapy and standard boosts. Methods and materials - An investigation was performed of the 2005 AAPM analysis to determine changes in administered dose while affixing prescribed dose using 2004 AAPM 125 I and 103 Pd brachytherapy dosimetry datasets for prostate implants. For 125 I and 103 Pd, administered dose would change by +1.4% and +4.2%, respectively. The biological and societal impact of changing prescribed dose was considered. Results - Based on the need for clinical constancy and in recognition of overall uncertainties, the ABS recommends immediate implementation of the 2004 AAPM consensus brachytherapy dosimetry datasets and no changes to 125 I and 103 Pd dose prescriptions at this time. Conclusions - Radiation oncologists should continue to prescribe mono-therapy doses of 145 Gy and 125 Gy for 125 I and 105 Pd, respectively, and standard boost doses of 100-110 Gy and 90-100 Gy for 125 I and 103 Pd, respectively. (authors)
STANDING CONCERTATION COMMITTEE ORDINARY MEETINGS IN NOVEMBER & DECEMBER 2003
2003-01-01
Original: English La version française de cet article paraîtra dans le prochain Bulletin hebdomadaire. These meetings were devoted to the main topics summarised below. 1-Follow-up of the meetings of TREF in October and the Finance Committee in November, and preparation for the Committee meetings in December The Chairman reported that the Management's proposals to adjust, on 1 January 2004, the salaries by 1.1%, on the basis of the calculated salary index, and the pensions by 0.7%, corresponding to the Geneva cost-of-living index, had received the support of TREF and would now be proposed by the Finance Committee for approval by Council in December. TREF had taken note of a factual status report regarding the first phase of recruitment of Local Staff and looked forward to a final report on overall implementation in June next year. TREF also gave its support to the Management's proposed modification to the Progressive Retirement Programme. Subject to some amendments and clarifications m...
Testud, F; Lambert-Chhum, R; Bellemin, B; Descotes, J
2001-12-01
Many women of childbearing age are occupationally exposed to chemicals and concerned with the ensuing risk when pregnant. To present the results of a prospective follow-up study of 100 pregnant women and to discuss them after a brief overview of the published data on this topic. Since January 1996 the Lyon Poison Center has been conducting a prospective follow-up of all request concerning pregnant women occupationally exposed to chemicals. A thorough evaluation of the hazards of the handled products and of the actual exposure at the workplace is done for each patient. A toxicological advice is given and the outcome of the pregnancy is followed-up. One hundred pregnant women were included between January 1996 and December 2000. Based on the nature of the handled products, two groups have been identified: the first included 73 women exposed to organic solvents and the second 27 women exposed to miscellaneous. When the exposure was considered potentially hazardous for the pregnancy, either withdrawal from the workstation (19 cases), avoidance of certain activities (9 cases) or improvement of individual protective measures (29 cases) was recommended. In 43% of the cases, the occupational exposure was not considered hazardous to the outcome of the pregnancy. No increase of adverse outcome was identified: 4 miscarriages and 96 living births were observed, with 2 major malformations and 1 minor malformation. Occupational exposure to chemicals was not found to affect adversely the outcome of these 100 pregnancies.
Measurement of 103mRh produced by the 103Rh(γ,γ')103mRh reaction with liquid scintillation counting
International Nuclear Information System (INIS)
Sekine, T.; Yoshihara, Kenji; Pavlicsek, I.; Lakosi, L.; Veres, A.
1989-01-01
A liquid scintillation counting technique was applied to measure the isotope 103m Rh (half life = 56.12 min) which is difficult to detect because its γ-ray is of low energy and low emission probability. Tris-(2,4-pentanedionato)rhodium(III) (Rh(acac) 3 ) was irradiated with bremsstrahlung of accelerated 3.2 MeV electrons by LINAC. The method has given a reliable calibration curve for the determination of 103m Rh radioactivity below Rh(acac) 3 concentrations of 2 mM. The integrated cross section of 103 Rh(γ,γ') 103m Rh determined by this method was found to be 6.8±3.4 μb MeV at 3.2 MeV. (author) 8 refs.; 5 figs
Recoil effect on β-decaying in vivo generators, interpreted for 103Pd/103mRh
International Nuclear Information System (INIS)
Szucs, Zoltan; Rooyen, Johann van; Zeevaart, Jan Rijn
2009-01-01
The use of Auger emitters as potential radiopharmaceuticals is being increasingly investigated. One of the radionuclides of interest is 103m Rh, which can be produced from 103 Ru or 103 Pd in an in vivo generator. A potential problem, however, is the recoil of the 103m Rh out of the carrier molecule and even out of the target cell. In order to determine the likelihood of this happening in the 103 Pd/ 103m Rh, case calculations were made to prove that this does not happen. The equations were generalised for all radionuclides with an atomic mass of 10-240 as a tool for determining the recoil threshold of any β-emitting radionuclide.
New determination of the half-lives of 57Co, 103Ru, sup(103m)Rh, 103Pd, and 109Cd
International Nuclear Information System (INIS)
Vaninbroukx, R.; Grosse, G.; Zehner, W.
1981-01-01
The half-lives of five radionuclides were redetermined by photon-counting techniques using NaI(Tl)- and Si(Li) detectors. The results are: 57 Co: (271.90 +- 0.09)d, 103 Ru: (39.260 +- 0.020)d, sup(103m)Rh: (56.114 +- 0.020)m, 103 Pd: (16.991 +- 0.019)d, and 109 Cd: (461.90 +- 0.30)d. The quoted uncertainties, corresponding to a lσ level, take into account random and systematic uncertainties. (author)
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The 32 titles discuss a variety of topics, including the following: (1) the elderly audience for religious broadcasting; (2) response to television advertising of directly marketed products; (3) the effectiveness of documentary film…
Lemacks, Jennifer; Wells, Brittny A; Ilich, Jasminka Z; Ralston, Penny A
2013-06-20
The incidence of preventable chronic diseases is disproportionally high among African Americans and could be reduced through diet and physical activity interventions. Our objective was to systematically review the literature on clinical outcomes of diet and physical activity interventions conducted among adult African American populations in the United States. We used the Preferred Reporting Items for Systematic Review and Meta Analysis construct in our review. We searched Medline (PubMed and Ovid), Cochrane, and DARE databases and restricted our search to articles published in English from January 2000 through December 2011. We included studies of educational interventions with clinically relevant outcomes and excluded studies that dealt with nonadult populations or populations with pre-existing catabolic or other complicated disorders, that did not focus on African Americans, that provided no quantitative baseline or follow-up data, or that included no diet or physical activity education or intervention. We report retention and attendance rates, study setting, program sustainability, behavior theory, and education components. Nineteen studies were eligible for closer analysis. These studies described interventions for improving diet or physical activity as indicators of health promotion and disease prevention and that reported significant improvement in clinical outcomes. Our review suggests that nutrition and physical activity educational interventions can be successful in improving clinically relevant outcomes among African Americans in the United States. Further research is needed to study the cost and sustainability of lifestyle interventions. Further studies should also include serum biochemical parameters to substantiate more specifically the effect of interventions on preventing chronic disease and reducing its incidence and prevalence.
Metallurgy department progress report for the period 1 January to 31 December 1976
International Nuclear Information System (INIS)
1977-03-01
The activities of the Metallurgy Department at Riso during 1976 are described. The work is presented in four chapters: General Materials Research, Technology and Materials Development, Fuel Elements, and Non-Destructive Testing. Furthermore, a survey is given of the department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1976 is included
Metallurgy department progress report for the period 1 January to 31 December 1982
International Nuclear Information System (INIS)
1983-07-01
The activities of the Metallurgy Department at Risoe during 1982 are described. The work is presented in three chapters: General Materials Research, Technology and Materials Deveopment, Fuel Elements. Furthermore, a survey is given of the department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1982 is included. (author)
Metallurgy department progress report for the period 1 January to 31 December 1983
International Nuclear Information System (INIS)
1984-06-01
The activities of the Metallurgy Department at Risoe during 1983 are described. The work is presented in three chapters: General Materials Research, Technology and Materials Development, and Fuel Elements. Furthermore, a survey is given of the Department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1983 is included. (author)
Metallurgy Department progress report for the period 1 January to 31 December 1984
International Nuclear Information System (INIS)
1985-04-01
The activities of the Metallurgy Department at Risoe during 1984 are described. The work is presented in three chapters: General Materials Research, Technology and Materials Development, and Fuel Elements. A survey is given of the Department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1984 is included. (author)
Metallurgy department progress report for the period 1 January to 31 December 1980
International Nuclear Information System (INIS)
1981-07-01
The activities of the Metallurgy Department at Risoe during 1980 are described. The work is presented in four chapters: General Materials Research, Technology and Materials Development, Fuel Elements, Non-Destructive Testing. Furthermore, a survey is given of the department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1980 is included. (Author)
Metallurgy department progress report for the period 1 January to 31 December 1981
International Nuclear Information System (INIS)
1982-07-01
The activities of the Metallurgy Department at Risoe during 1981 are described. The work is presented in three chapters: General Materials Research, Technology and Materials Development, Fuel Elements. Furthermore, a survey is given of the department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1981 is included. (author)
Subsequent publication of oral and maxillofacial surgery meeting abstracts.
Rodriguez, Joseph L; Laskin, Daniel M
2012-05-01
Previous studies in various medical specialties have shown that fewer than 50% of abstracts presented at meetings are subsequently published. The purpose of the present study was to determine the publication rate of abstracts presented at the annual meetings of the American Association of Oral and Maxillofacial Surgeons. The titles and authors of the abstracts from all oral abstract session presentations and posters by American contributors were collected from the Final Programs of the American Association of Oral and Maxillofacial Surgeons annual meetings for 2006 to 2009. A PubMed search for published articles through December 2010 was then performed using the authors' names, abstract titles, and key words. A total of 311 abstract presentations were done at the 4 annual meetings. Of these, only 85 (24%) were subsequently published. No difference was found between abstracts from oral or poster presentations. Most of the articles were published in the Journal of Oral and Maxillofacial Surgery. Because of deficiencies that can occur in abstracts and the need to disseminate the information they contain, it is important to take the appropriate measures to ensure that full articles are subsequently published. Copyright © 2012 American Association of Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.
January 2017 Arizona thoracic society notes
Directory of Open Access Journals (Sweden)
Wesselius LJ
2017-02-01
Full Text Available No abstract available. Article truncated after 150 words. The January 2017 Arizona Thoracic Society meeting was held on Wednesday, January 25, 2017 at the HonorHealth Rehabilitation Hospital beginning at 6:30 PM. This was a dinner meeting (prime rib with case presentations. There was a good attendance representing the pulmonary, critical care, sleep, and radiology communities. There was a discussion of supporting the Tobacco 21 bill which has been introduced into the Arizona State Legislature. There was unanimous support for this bill. Another bill to allow school nurses to administer an albuterol inhaler without a doctor’s prescription was also discussed but the members wanted more information. The new CDC Ventilator-Associated Events (VAE criteria were also discussed. Before endorsing or opposing the this as a measure, the members wished more information. It was decided that a decision on both would be postponed until discussed at the next meeting. Three cases were presented: 1. Dr. Lewis Wesselius from the Mayo Clinic …
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The 36 titles deal with a variety of topics, including the following: (1) content diversity in local television news; (2) advertising influences on consumers' use of evidence; (3) organized labor and the mass media; (4) feminist film…
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The 55 titles deal with a variety of topics, including the following: (1) the prime time access rule; (2) media education; (3) magazine and children's advertising; (4) Irish national and Third World cinema; (5) international radio…
Engineering Physics and Mathematics Division progress report for period ending December 31, 1994
International Nuclear Information System (INIS)
Sincovec, R.F.
1995-07-01
This report provides a record of the research activities of the Engineering Physics and Mathematics Division for the period January 1, 1993, through December 31, 1994. This report is the final archival record of the EPM Division. On October 1, 1994, ORELA was transferred to Physics Division and on January 1, 1995, the Engineering Physics and Mathematics Division and the Computer Applications Division reorganized to form the Computer Science and Mathematics Division and the Computational Physics and Engineering Division. Earlier reports in this series are identified on the previous pages, along with the progress reports describing ORNL's research in the mathematical sciences prior to 1984 when those activities moved into the Engineering Physics and Mathematics Division
Engineering Physics and Mathematics Division progress report for period ending December 31, 1994
Energy Technology Data Exchange (ETDEWEB)
Sincovec, R.F.
1995-07-01
This report provides a record of the research activities of the Engineering Physics and Mathematics Division for the period January 1, 1993, through December 31, 1994. This report is the final archival record of the EPM Division. On October 1, 1994, ORELA was transferred to Physics Division and on January 1, 1995, the Engineering Physics and Mathematics Division and the Computer Applications Division reorganized to form the Computer Science and Mathematics Division and the Computational Physics and Engineering Division. Earlier reports in this series are identified on the previous pages, along with the progress reports describing ORNL`s research in the mathematical sciences prior to 1984 when those activities moved into the Engineering Physics and Mathematics Division.
Dosimetric study of permanent prostate brachytherapy utilizing 131Cs, 125I and 103Pd seeds
International Nuclear Information System (INIS)
Yang Ruijie; Wang Junjie; Zhang Hongzhi
2009-01-01
Objective: To compare the dosimetric differences of permanent prostate brachytherapy utilizing 131 Cs, 125 I and 103 Pd seeds. Methods: Twenty-five patients with T 1 -T 2 c prostate cancer who had previously implanted with 125 I seeds were randomly selected in our study. The patients were re-planned with 131 Cs, 125 I and 103 Pd seeds by using the Prowess Brachytherapy 3.1 planning system to the prescription doses of 115 Gy, 145 Gy and 125 Gy, respectively. The seed strengths were 1.8 U,0.5 U and 1.8 U, respectively. The prostate, prostatic urethra and anterior wall of the rectum were contoured on trans-rectal ultrasound images. PTV was outlined based on the prostate volume with no margin applied. The attempted planning goals were that V 100 (the percentage volume of the prostate receiving at least 100% of the prescription doses)= 95%, D 90 (the minimum percentage dose covering 90% of the prostate volume) ≥100%, and prostatic urethra UD 10 (the maximum percentage dose receiving by 10% of the contoured urethra) ≤150%. For the plan comparison, we also computed prostate V 150 , prostatic urethra UV 120 , rectum RV 100 , and the number of implanted seeds and needles. The significance of the differences was tested using one way analysis of variance. Results: The average V 200 in the 103 Pd, 125 I and 131 Cs plans were 28.7%, 20.9% and 19.6% (F=42.50, P=0.000); the average V 150 were 51.9%, 42.1% and 39.4% (F=26.15, P=0.000); the average UV 120 were 26.9%, 29.5% and 23.8% (F=0.37, P=0.691); and the average rectum RV 100 were 0.31 cm 3 , 0.22 cm 3 and 0.19 cm 3 (F=0.43, P=0.652). For 103 Pd, 125 I and 131 Cs, the average number of implanted seeds per cm 3 prostate were 2.02, 2.01 and 1.87 (F=1.92, P=0.154), and the average number of needles were 33.6, 32.9 and 31.6 (F=0.26,P=0.772). Conclusions: Comparing to 125 I and 103 Pd seeds used in permanent prostate brachytherapy, 131 Cs seeds has better dose homogeneity, and possible better sparing of the urethra and rectum
Metallurgy department progress report for the period 1 January to 31 December 1978
International Nuclear Information System (INIS)
1979-04-01
The activities of the metallurgy department at Risoe during 1978 are described. The work is presented in four chapters: General materials research, technology and materials development, fuel elements, and non-destructive testing. Furthermore, a survey is given of the depratment's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1978 is included. (author)
Metallurgy Department progress report for the period 1 January to 31 December 1985
International Nuclear Information System (INIS)
Schroeder Pedersen, A.; Bilde Soerensen, J.B.
1986-04-01
The activities of the Metallurgy department at Risoe during 1985 are described. The work is presented in four chapters: General Materials Research, Technology and Materials Development, Chemical and Electrochemical Energy Research and Development, and Fuel elements. A survey is given of the Department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1985 is included. (author)
Metallurgy Department progress report for the period 1 January to 31 December 1986
International Nuclear Information System (INIS)
Schroeder Pedersen, A.; Bilde-Soerensen, J.B.
1987-04-01
The activities of the Metallurgy Department at Risoe during 1986 are described. The work is presented in four chapters: General Materials Research, Technology and Materials Development, Chemical and Electrochemical Energy Research and Development, and Fuel Elements. A survey is given of the Department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1986 is included. (editors)
Metallurgy department progress report for the period 1 January to 31 December 1975
International Nuclear Information System (INIS)
1976-03-01
The activities of the Metallurgy Department at Risoe during 1975 are described. The work is presented in four chapters: General Materials Research, Technology and Materials Development, Fuel Elements, and Non-Destructive Testing. Furthermore, a survey is given of the department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1975 is included. (author)
Metallurgy department progress report for the period 1 January to 31 December 1977
International Nuclear Information System (INIS)
1978-03-01
The activities of the Metallurgy Department at Risoe during 1977 are described. The work is presented in four chapters: General Materials Research, Technology and Materials Development, Fuel elements, and Non-Destructive Testing. Furthermore, a survey is given of the department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1977 is included. (author)
Physics, Computer Science and Mathematics Division annual report, 1 January-31 December 1983
Energy Technology Data Exchange (ETDEWEB)
Jackson, J.D.
1984-08-01
This report summarizes the research performed in the Physics, Computer Science and Mathematics Division of the Lawrence Berkeley Laboratory during calendar year 1983. The major activity of the Division is research in high-energy physics, both experimental and theoretical, and research and development in associated technologies. A smaller, but still significant, program is in computer science and applied mathematics. During 1983 there were approximately 160 people in the Division active in or supporting high-energy physics research, including about 40 graduate students. In computer science and mathematics, the total staff, including students and faculty, was roughly 50. Because of the creation in late 1983 of a Computing Division at LBL and the transfer of the Computer Science activities to the new Division, this annual report is the last from the Physics, Computer Science and Mathematics Division. In December 1983 the Division reverted to its historic name, the Physics Division. Its future annual reports will document high energy physics activities and also those of its Mathematics Department.
Physics, Computer Science and Mathematics Division annual report, 1 January-31 December 1983
International Nuclear Information System (INIS)
Jackson, J.D.
1984-08-01
This report summarizes the research performed in the Physics, Computer Science and Mathematics Division of the Lawrence Berkeley Laboratory during calendar year 1983. The major activity of the Division is research in high-energy physics, both experimental and theoretical, and research and development in associated technologies. A smaller, but still significant, program is in computer science and applied mathematics. During 1983 there were approximately 160 people in the Division active in or supporting high-energy physics research, including about 40 graduate students. In computer science and mathematics, the total staff, including students and faculty, was roughly 50. Because of the creation in late 1983 of a Computing Division at LBL and the transfer of the Computer Science activities to the new Division, this annual report is the last from the Physics, Computer Science and Mathematics Division. In December 1983 the Division reverted to its historic name, the Physics Division. Its future annual reports will document high energy physics activities and also those of its Mathematics Department
Absolute calibration of the Rh-103 (n, n') Rh-103m reaction rate
Energy Technology Data Exchange (ETDEWEB)
Taylor, W.H.; Murphy, M.F.; March, M.R. [Reactor Physics Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)
1979-05-15
The uncertainties in determining the absolute values of the Rh-103 (n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to {approx}{+-}5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the I.A.E.A. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Commerce. 1220.103 Section 1220.103 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.103 Commerce. The term commerce means interstate, foreign, or intrastate commerce. ...
1983-01-01
January 1982 - December 1983), supported by CNPq Brazil, carrying out research for Ph.D. degree in Chemistry from Instituto de Fisica e Quimica de Sao...Carlos, USP, Brazil. 2. Visiting Scientist at Los Alamos National Laboratory (May - July 1983) from Instituto de Fisica e Quimica de Sao Carlos, USP
Triangle Universities Nuclear Laboratory annual report-TUNL XVIII, 1 January-31 December 1979
International Nuclear Information System (INIS)
1979-01-01
Activities during the year 1979 are reported in the following categories: neutron cross section experiments, neutron polarization studies, high-resolution studies, charged-particle reactions with polarized beams, radiative capture reactions, atomic physics, other experiments, work done elsewhere by TUNL personnel, applications, ion source development, accelerator development and instrumentation, computer-related development, ad nuclear theory and phenomenology. Appendixes give lists of journal publications, talks, etc. Twelve of the contributions to this annual report have been abstracted and indexed individually
Temporal Variability of Lunar Exospheric Helium During January 2012 from LRO/LAMP
Feldman, Paul D.; Hurley, Dana M.; Retherford, Kurt D.; Gladstone, G. Randall; Stern, S. Alan; Pryor, Wayne; Parker, Joel Wm.; Kaufmann, David E.; Davis, Michael W.; Versteeg, Maarten; team, LAMP
2012-01-01
We report observations of the lunar helium exosphere made between December 29, 2011, and January 26, 2012, with the Lyman Alpha Mapping Project (LAMP) ultraviolet spectrograph on NASA's Lunar Reconnaissance Orbiter Mission (LRO). The observations were made of resonantly scattered He I 584 from illuminated atmosphere against the dark lunar surface on the dawn side of the terminator. We find no or little variation of the derived surface He density with latitude but day-to-day variations that li...
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Application. 646.103 Section 646.103 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS RAILROADS Railroad-Highway Insurance Protection § 646.103 Application. (a) This part applies: (1) To a contractors' legal...
33 CFR 174.103 - Administration.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Administration. 174.103 Section 174.103 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED....103 Administration. The State casualty reporting system must be administered by a State agency that...
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Location. 960.103 Section 960.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EXECUTIVE BOARDS § 960.103 Location. Federal Executive Boards have been established and shall continue in...
Floods of December 1966 in southwestern Utah
Butler, Elmer; Mundorff, J.C.
1970-01-01
Severe floods occurred in parts of southwestern Utah on December 5-6, 1966, as a result of precipitation of about 1 inch to more than 12 inches during December 3-6. The flood on the Virgin River was the greatest since the first settlers arrived in 1860.The peak discharge of the Virgin River at Virgin, Utah, was 22,830 cubic feet per second on December 6; this exceeded the previous maximum discharge of 13,500 cubic feet per second on March 3, 1938, and September 17, 1961, and probably has a recurrence interval of 100 years. At eight other gage sites in the flood area, the peak discharge in December 1966 was the highest of record; the recurrence intervals of some of the peak discharges may be 100 years. The flood peaks were generally of short duration and most streams receded to near base flow within 24 hours.The dissolved-solids content was significantly lower in the Virgin River at Virgin than at St. George, about 25 miles downstream; the water was of the calcium sulfate type at both sites. Data for the Santa Clara River above Winsor Dam and the Santa Clara River near Santa Clara show a significant increase in dissolved solids between the two sites. The water above Winsor Dam was of the calcium bicarbonate type, and the water near Santa Clara was of the calcium bicarbonate sulfate type.The suspended-sediment discharge, during the period December 5-8, 1966, at Santa Clara River above Winsor Dam, near Santa Clara was about foyer times greater than all the suspended-sediment discharge during the preceding 3 years ; the suspended-sediment discharge of the Virgin River at Virgin was greater during the 4-day period than during any one of the preceding 3 years.Nearly all the flood damage in the area occurred in the Virgin River basin. According to the Soil Conservation Service, total damage in the Dixie Soil Conservation District in Washington County was about $835,000; 60 percent of the damage was caused by floodwater and 40 percent by deposited sediment.
Health physics research abstracts No. 12
International Nuclear Information System (INIS)
1985-11-01
The No. 12 of Health Physics Research Abstracts is the continuation of a series of Bulletins published by the IAEA since 1967 and which collect reports from Member States on Health Physics research in progress or just completed. The present issue contains 386 reports received up to December 1984 and covering the following topics: personnel monitoring, dosimetry, assessment of dose to man, operational radiation protection techniques, biological effects of radiations, environmental studies, pathways and monitoring, radiation hazards resulting from the operation of nuclear facilities, radiation accidents and emergency plans, epidemiology of radiation damage, optimization of radiation protection, research programs and projects
14 CFR 1201.103 - Administration.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Administration. 1201.103 Section 1201.103 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION STATEMENT OF ORGANIZATION AND GENERAL INFORMATION Introduction § 1201.103 Administration. (a) NASA is headed by an Administrator, who is appointed...
Order on nuclear third party liability (ORCN) Amendment of 2 December 1985
International Nuclear Information System (INIS)
1985-01-01
According to the 1983 Act on Nuclear Third Party Liability the Federal Council must increase the minimum amount of three hundred million francs covered by private insurance when the insurance market offers a higher coverage at acceptable conditions. The Swiss insurers being in a position to cover the sum of four hundred million francs as from January 1986, the Government accordingly amended the Ordinance of 5th December 1983 on Nuclear Third Party Liability (ORCN). The Confederation continues to act as an insurer for the difference between this amount and one thousand million francs; contributions due in this respect will be reduced to take account of the greater sum to be covered by private insurance. The New Ordinance entered into force on 1st January 1986. (NEA) [fr
Reduced heating level during the end-of-year closure (from December 14, 2011 to January 4, 2012)
GS/SE/HE
2011-01-01
To save on energy costs, the heating will once again be operating at a reduced level during the end-of-year closure of the Laboratory. We would ask all those in charge of premises where normal temperature have to be maintained to let us know by 14 December 2011 at the latest by e-mail to paul.cruz@cern.ch
International Nuclear Information System (INIS)
Coffey, H.E.
1989-03-01
Contentsinclude: detailed index for 1988-1989; data for february 1989 (IUWDS alert periods (advance and worldwide), solar-activity indices, solar flares, solar radio emission, Stanford mean solar magnetic field); data for January 1989 (solar active regions, sudden ionospheric disturbances, solar radio spectral observations, cosmic-ray measurements by neutron monitor, geomagnetic indices, radio-propagation indices); late data (solar-active regions-- H-alpha synoptic charts 1806-1808 (September-November 1988), cosmic-ray measurements by neutron monitor--thule, December 1988, geomagnetic indices -- sudden commencements/solar flare effects December 1988)
Tzanetakis, G N; Tzimpoulas, N; Floratos, S; Agrafioti, A; Kontakiotis, E G; Shemesh, H
2017-06-26
To evaluate the full-text publication rates of scientific research abstracts presented at the European Society of Endodontology (ESE) Congresses held between 1993 and 2013 (a total of 11 occasions) and to determine factors associated with the manuscripts. An electronic database search was conducted from January 2015 to December 2016 to identify full text English written publications of the research abstracts presented at the last 11 ESE Biennial Congresses from 1993 to 2013. For each occasion, research abstract information were retrieved from the International Endodontic Journal (IEJ) through the official website of the ESE and the following parameters for each abstract presentation were recorded: Year of presentation, first author's affiliation, geographic origin, and type of study. Following full-text article identification, additional information was recorded such as: Year and journal of publication, elapsed time until full publication and number of authors per presentation and publication. A total of 1165 research abstracts were presented, of which 401 (34.4%) were finally published as full-length articles. Overall 235 articles (58.6%) were published either in the International Endodontic Journal (IEJ, 35.7%) or Journal of Endodontics (JOE, 22.9%). The mean time between abstract presentation and full-text publication was 18.95 months. Munich (2001) had the highest publication rate (44%) whereas Lisbon (2013) had the highest number of published articles (77). Turkey was the country with the highest number of published abstracts (56). However, the Netherlands was the country with the highest number of publications related to the number of presentations (21/26) (80.7%). Differences in authorship between presentation and full publication were found in 179 (44.6%) articles. A substantial number of research abstracts presented at ESE congresses were not published in peer reviewed journals. Authors prefer to publish their research papers in international journals with
Palladium-103 plaque radiotherapy for choroidal melanoma: an 11-year study
International Nuclear Information System (INIS)
Finger, Paul T.; Berson, Anthony; Ng, Tracy; Szechter, Andrzej
2002-01-01
Purpose: To describe 11 years of experience with 103 Pd ophthalmic plaque brachytherapy for intraocular melanoma. Methods and Materials: Since 1990, 152 patients have been diagnosed with uveal melanoma, found to be negative for metastatic disease, and treated with 103 Pd radioactive plaque radiotherapy. This study presents the first 100 patients treated with 103 Pd and followed for ≥2 years. Plaques were sewn to the episclera to cover the base of the intraocular tumor. Treatment involved delivery of a mean apical radiation dose of 80.5 Gy during 5-7 days' continuous treatment. Patients were evaluated for local tumor control, visual acuity, radiation damage (retinopathy, optic neuropathy, cataract), and metastatic disease. Results: Patients in this series were followed for a mean of 4.6 years (55.4 months). 103 Pd seeds were found to be equivalent to 125 I with respect to plaque manufacture and ease of dosimetric calculations. We noted a local control rate of 96% and six secondary enucleations. Including the enucleated patients, the visual acuity evaluations revealed that 35% lost six or more lines of vision and 73% had vision of 20/200 or better. Conclusion: Long-term results now exist describing the use of 103 Pd plaque radiotherapy for uveal (iris, ciliary body, and choroidal) melanoma. Compared with the results from centers using 125 I, patients in this series experienced equivalent local control rates and better visual function
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 308.103 Section 308.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS VOLUNTEER SERVICE § 308.103 Authority. Section 301 of the Civil Service Reform Act of 1978, Public Law 95-454, authorized Federal...
Coy, Lawrence; Pawson, Steven
2014-01-01
We examine the major stratosphere sudden warming (SSW) that occurred on 6 January 2013, using output from the NASA Global Modeling and Assimilation Office (GMAO) GEOS-5 (Goddard Earth Observing System) near-real-time data assimilation system (DAS). Results show that the major SSW of January 2013 falls into the vortex splitting type of SSW, with the initial planetary wave breaking occurring near 10 hPa. The vertical flux of wave activity at the tropopause responsible for the SSW occurred mainly in the Pacific Hemisphere, including the a pulse associated with the preconditioning of the polar vortex by wave 1 identified on 23 December 2012. While most of the vertical wave activity flux was in the Pacific Hemisphere, a rapidly developing tropospheric weather system over the North Atlantic on 28 December is shown to have produced a strong transient upward wave activity flux into the lower stratosphere coinciding with the peak of the SSW event. In addition, the GEOS-5 5-day forecasts accurately predicted the major SSW of January 2013 as well as the upper tropospheric disturbances responsible for the warming. The overall success of the 5-day forecasts provides motivation to produce regular 10-day forecasts with GEOS-5, to better support studies of stratosphere-troposphere interaction.
Preparation of 103Pd seed-molecular plating of 103Pd onto silver rod
International Nuclear Information System (INIS)
Zhang Chunfu; Wang Yongxian; Tian Haibin; Yin Duanzhi
2002-01-01
A method for 103 Pd 'molecular plating' onto the surface of a silver rod is reported. The optimal composition of the plating bath is as follows: palladium chloride 0.1 mol/l, formaldehyde 2 mol/l, nitric acid 1 mol/l, and formic acid 0.4 mol/l. The 103 Pd molecular plating procedure will last 25 min at 30 deg. C. This article provides a valuable experience for the preparation of 103 Pd brachytherapy seed
Content Abstract Classification Using Naive Bayes
Latif, Syukriyanto; Suwardoyo, Untung; Aldrin Wihelmus Sanadi, Edwin
2018-03-01
This study aims to classify abstract content based on the use of the highest number of words in an abstract content of the English language journals. This research uses a system of text mining technology that extracts text data to search information from a set of documents. Abstract content of 120 data downloaded at www.computer.org. Data grouping consists of three categories: DM (Data Mining), ITS (Intelligent Transport System) and MM (Multimedia). Systems built using naive bayes algorithms to classify abstract journals and feature selection processes using term weighting to give weight to each word. Dimensional reduction techniques to reduce the dimensions of word counts rarely appear in each document based on dimensional reduction test parameters of 10% -90% of 5.344 words. The performance of the classification system is tested by using the Confusion Matrix based on comparative test data and test data. The results showed that the best classification results were obtained during the 75% training data test and 25% test data from the total data. Accuracy rates for categories of DM, ITS and MM were 100%, 100%, 86%. respectively with dimension reduction parameters of 30% and the value of learning rate between 0.1-0.5.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Discovery. 1386.103 Section 1386.103 Public... Hearing Procedures § 1386.103 Discovery. The Department and any party named in the Notice issued pursuant to § 1386.90 has the right to conduct discovery (including depositions) against opposing parties as...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 535.103 Section 535.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CRITICAL POSITION PAY AUTHORITY § 535.103 Authority. (a) Subject to a grant of authority from OPM in consultation with OMB and all other...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 304.103 Section 304.103... APPOINTMENTS § 304.103 Authority. (a) Basic authority. (1) When authorized by an appropriation or other statute... expert or consultant who works on a strictly intermittent basis may be appointed under this authority...
The production of 103Pd and 109Cd from a proton irradiated tandem natAg/natAg targets
International Nuclear Information System (INIS)
Ineza, C.; Mphahlele, J.
2014-01-01
This paper describes a new method for the production of 103 Pd and 109 Cd using the 66 MeV proton beam of iThemba LABS on a tandem natural silver target (Ag/Ag). The radiochemical separation of the Pd radionuclides ( 103 Pd, 100 Pd) from the bulk nat Ag was done using a Chelex-100 chelating resin column. The recovery of 103 Pd from the irradiated nat Ag target was found to be >98 % without any Ag or Rh impurities detected. The radiochemical separation of 109 Cd from the bulk nat Ag target was done by the precipitation of Ag ions by Cu followed by the separation of 109 Cd, traces of Ag, Cu 2+ and Rh using a AG1-X10 anion exchange resin column. The recovery yield of 109 Cd was >99 % without any Ag or Rh impurities detected. (author)
International Nuclear Information System (INIS)
Sheehan, M.A.
1997-06-01
This compilation consists of bibliographic data and abstracts for the formal regulatory and technical reports issued by the U.S. Nuclear Regulatory Commission (NRC) Staff and its contractors. This compilation is published quarterly and cummulated annually. Reports consist of staff-originated reports, NRC-sponsored conference reports, NRC contractor-prepared reports, and international agreement reports
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Definitions. 410.103 Section 410.103 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.103 Definitions...
Metallurgy department progress report for the period 1 January to 31 December 1979
International Nuclear Information System (INIS)
1980-07-01
The activities of the Metallurgy Department at Risoe during 1979 are described. The work is presented in four chapters: General material research, technology and materials development, fuel elements, non-destructive testing. An article on wingblades of glass fibre reinforced polyester for a 630 kW windturbine is also included. Furthermore, a survey is given of the department's participation in international collaboration and of its activities within education and training. A list (with abstracts) of publications and lectures by the staff during 1979 is included. (author)
CERN Health Insurance Scheme - changes on 1 January 2011
HR Department
2011-01-01
Changes decided by the Council on 16 December 2010 Following the five-yearly review of financial and social conditions, which included the CERN Health Insurance Scheme (CHIS), the CERN Council has taken certain decisions which affect both active and retired staff. In order to restore the financial equilibrium of the CHIS, the level of contributions will increase progressively over the next five years. In 2011, the contributions of both active and retired members increase from 4.02% to 4.27%. The amounts of the fixed premiums for voluntary insured members (e.g. users and associates) as well as the supplementary contributions for spouses with an income from a professional activity increase accordingly. The amounts of the daily allowance for Long-Term Care have been increased by 20% as of 1 January 2011. The CHIS Rules have been amended according to the above decisions. They entered into force on 1 January 2011 and are available on the CHIS site. Tel. 74125 Members of the personnel shall be deemed to ...
STANDING CONCERTATION COMMITTEE: ORDINARY MEETINGS IN NOVEMBER & DECEMBER 2003
2004-01-01
Original: English These meetings were devoted to the main topics summarised below. 1-Follow-up of the meetings of TREF in October and the Finance Committee in November, and preparation for the Committee meetings in December The Chairman reported that the Management's proposals to adjust, on 1 January 2004, the salaries by 1.1%, on the basis of the calculated salary index, and the pensions by 0.7%, corresponding to the Geneva cost-of-living index, had received the support of TREF and would now be proposed by the Finance Committee for approval by Council in December. TREF had taken note of a factual status report regarding the first phase of recruitment of Local Staff and looked forward to a final report on overall implementation in June next year. TREF also gave its support to the Management's proposed modification to the Progressive Retirement Programme. Subject to some amendments and clarifications made at TREF and at the SCC, this proposal will be submitted for approval at the Finance Committee and Counci...
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Security. 1786.103 Section 1786.103 Agriculture... Prepayments on RUS Notes in the Event of a Merger of Certain RUS Electric Borrowers § 1786.103 Security. If... of providing security for loans the proceeds of which were used to prepay RUS Notes. Such lien...
Standing Concertation Committee - Ordinary Meeting on 4 December 2007
HR Department
2008-01-01
The main items discussed at the meeting of the Standing Concertation Committee on 4 December 2007 included: 2006 Medical Service Annual Report The Committee took note of the report by the head of the Medical Service, Dr V. Fassnacht, (see http://sc-me.web.cern.ch/sc-me/index.html) and of a number of points raised during the discussion, including the importance of further prevention measures. The Committee expressed its thanks to all members of the Medical Service for their work in 2006 and over the past year. Short-Term Saved leave Scheme As announced in Weekly Bulletins Nos. 28/2007 and 51/2007, the Saved Leave Scheme will be succeeded from 1 January 2008 by the Short-Term Saved Leave Scheme (see also https://hr-services.web.cern.ch/hr-services/services-Ben/sls_shortterm.asp). The Committee agreed to recommend the Director-General to adopt the relevant procedure. It was noted that staff could apply immediately to participate from 1 January 2008 and that applications to pa...
International Nuclear Information System (INIS)
1988-06-01
This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility
International Nuclear Information System (INIS)
1987-05-01
This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility
Tokamak poloidal field systems. Progress report, January 1-December 31, 1979
International Nuclear Information System (INIS)
Rogers, J.D.
1980-05-01
Work is reported on the development of superconducting tokamak poloidal field systems (TPFS). Progress is discussed on the design of a 20 MJ, 50 kA, 7.5 T superconducting pulsed energy storage coil operated in a 1 to 2 s bipolar mode from +7.5 T to -7.5 T in 1982. Conductor development for the coil is presented. A facility that uses a traction motor energy transfer system to test coils in the 20 to 100 MJ energy range is discussed. Current interrupter development and testing for protection and energy transfer circuits are also presented. The 400 kJ METS coil test preparation is under way
International Nuclear Information System (INIS)
Wenzel, M.; Wu, Y.
1988-01-01
The tropanol esters of the carboxylic acids of ferrocene, 103 Ru-ruthenocene and sup(103m)Rh-rhodocinium were synthezised. The organ distribution of the 103 Ru or sup(103m)Rh labelled tropanol-esters were investigated. Only the 103 Ru labelled ester showed a high heart/blood ratio. (author)
African Journals Online (AJOL)
Items 51 - 100 of 250 ... Vol 103, No 1 (2014), Butterfly pollination of the dryland wildflower Gloriosa minor, Abstract. DJ Martins. Vol 88, No 1 (1999), Canthariphilous insects in east Africa, Abstract. C Hemp, A Hemp, K Dettner. Vol 103, No 2 (2014), Cape grass owl tyto capensis pellet indicates a Range extension for the vlei rat ...
Adult/Patient Nutrition Education Materials. January 1982-October 1989. Quick Bibliography Series.
Updegrove, Natalie A.
This publication contains abstracts of books, articles, and research studies on the subject of adult patient nutrition. The materials offer dietary guidelines for mature individuals with a variety of ailments. The citations in this bibliography were entered in the "Agricola" database between January, 1979 and October, 1989. (JD)
Pérez, Cristina Díaz-Agero; Rodela, Ana Robustillo; Monge Jodrá, Vincente
2009-12-01
In 1997, a national standardized surveillance system (designated INCLIMECC [Indicadores Clínicos de Mejora Continua de la Calidad]) was established in Spain for health care-associated infection (HAI) in surgery patients, based on the National Nosocomial Infection Surveillance (NNIS) system. In 2005, in its procedure-associated module, the National Healthcare Safety Network (NHSN) inherited the NNIS program for surveillance of HAI in surgery patients and reorganized all surgical procedures. INCLIMECC actively monitors all patients referred to the surgical ward of each participating hospital. We present a summary of the data collected from January 1997 to December 2006 adapted to the new NHSN procedures. Surgical site infection (SSI) rates are provided by operative procedure and NNIS risk index category. Further quality indicators reported are surgical complications, length of stay, antimicrobial prophylaxis, mortality, readmission because of infection or other complication, and revision surgery. Because the ICD-9-CM surgery procedure code is included in each patient's record, we were able to reorganize our database avoiding the loss of extensive information, as has occurred with other systems.
International Nuclear Information System (INIS)
Epperson, C.E.; Landolt, R.R.; Kessler, W.V.
1976-01-01
/sup 103m/Rh in equilibrium with parent 103 Ru was separated in yields of 94 percent of those theoretically possible. 103 Ru chloride was first converted to the tetroxide which was then extracted from an aqueous solution of the equilibrium mixture with carbon tetrachloride
A comprehensive study of the structure, tautomeric properties, and ...
Indian Academy of Sciences (India)
aDepartment of Chemistry, Graduate University of Advanced Technology, Kerman, Iran ... MS received 28 March 2014; revised 05 December 2014; accepted 27 January 2015. Abstract ... an essential micronutrient whose absence from the diet.
Journal of Glenn T. Seaborg (1946-1958), January 1, 1957--December 31, 1957
International Nuclear Information System (INIS)
Seaborg, G.T.
1990-07-01
This portion of the Glenn T. Seaborg journal concerns the 12-year period during which I served as Director of the Division of Nuclear Chemistry of the Radiation Laboratory (now the Lawrence Berkeley Laboratory). This portion of my journal consists of Volume 11 January 1, 1958. The journal is based on my notebook entries; memos covering phone calls, appointments, and meetings; minutes of meetings; my appointment calendars and correspondence files; the Radiation Laboratory Chemistry Division personnel files and travel vouchers; laboratory notebooks of my scientific colleagues and cyclotron bombardment logs; some catalogs and materials from the Bancroft Library and the University Archives; back issues of the campus newspaper the Daily California and clippings from S.F. Bay Area newspapers found in my scrapbook, etc. Helen was able to provide me with some of her appointment calendars, which helped clarify family and social activities. Many of these resources provided clear and detailed material. Other notes made hastily, and causally, using initials for people's names and rather cryptic abbreviations; however, when these were deciphered, they provided surprisingly complete information
Journal of Glenn T. Seaborg (1946-1958), January 1, 1956--December 31, 1956
International Nuclear Information System (INIS)
Seaborg, G.T.
1990-07-01
This portion of the Glenn T. Seaborg journal concerns the 12-year period during which I served as Director of the Division of Nuclear Chemistry of the Radiation Laboratory (now the Lawrence Berkeley Laboratory). This portion of my journal consists of Volume 10 January 1, 1956. The journal is based on my notebook entries; memos covering phone calls, appointments, and meetings; minutes of meetings; my appointment calendars and correspondence files; the Radiation Laboratory Chemistry Division personnel files and travel vouchers; laboratory notebooks of my scientific colleagues and cyclotron bombardment logs; some catalogs and materials from the Bancroft Library and the University Archives; back issues of the campus newspaper the Daily California and clippings from S.F. Bay Area newspaper found in my scrapbook, etc. Helen was able to provide me with some of her appointment calendars, which helped clarify family and social activities. Many of these resources provided clear and detailed material. Other notes made hastily and causally, using initials for people's names and rather cryptic abbreviations; however, when these were deciphered, they provided surprisingly complete information
Progress report (January - December 1978)
International Nuclear Information System (INIS)
Hainge, W.M.
1979-09-01
The annual report of the Environmental and Medical Sciences Division is primarily concerned with research and analytical services, covering both radiological and non-nuclear research programmes in the environmental and toxicological fields. Environmental safety projects from the Hazardous Materials Service, the Waste Research Unit, the Chemical Emergency Centre, the Waste Management Information Bureau, the Landfill Research Project and the Operations and Disposals Team are described. The work of the Environmental Analytical Services is also outlined. The Atmospheric Pollution Programme has been mainly concerned with the life cycle of sulphur compounds in the atmosphere and with the effects of pollutants, mainly hydrocarbons, on the level of ozone in the stratosphere. The Aerosols and Metabolic Studies Programme included further studies on the environmental behaviour and the metabolism of inhaled lead from vehicle exhausts and whole-body counting of plutonium. Inhalation Toxicology and Radionuclide Analysis studies included the deposition and clearance of inhaled particles and the effects of radioactive ( 239 Pu) and non-radioactive dusts on the lung. A substantial amount of research was performed in the field of radiation physics, in relation to dosimetry, applied radiation spectrometry, data systems, radioactive fallout and environmental analysis. (UK)
International Nuclear Information System (INIS)
Wyrwas, Bogdan; Chrzanowski, Łukasz; Ławniczak, Łukasz; Szulc, Alicja; Cyplik, Paweł; Białas, Wojciech; Szymański, Andrzej; Hołderna-Odachowska, Aleksandra
2011-01-01
Highlights: ► Efficient degradation of Triton X-100 under both aerobic and aerobic conditions. ► Triton X-100 was most likely degraded via the ‘central fission’ mechanism. ► Preferential degradation of Triton X-100 over diesel oil. ► The presence of surfactants decreased diesel oil biodegradation efficiency. - Abstract: The hypothesis regarding preferential biodegradation of surfactants applied for enhancement of microbial hydrocarbons degradation was studied. At first the microbial degradation of sole Triton X-100 by soil isolated hydrocarbon degrading bacterial consortium was confirmed under both full and limited aeration with nitrate as an electron acceptor. Triton X-100 (600 mg/l) was utilized twice as fast for aerobic conditions (t 1/2 = 10.3 h), compared to anaerobic conditions (t 1/2 = 21.8 h). HPLC/ESI-MS analysis revealed the preferential biodegradation trends in both components classes of commercial Triton X-100 (alkylphenol ethoxylates) as well as polyethylene glycols. The obtained results suggest that the observed changes in the degree of ethoxylation for polyethylene glycol homologues occurred as a consequence of the ‘central fission’ mechanism during Triton X-100 biodegradation. Subsequent experiments with Triton X-100 at approx. CMC concentration (150 mg/l) and diesel oil supported our initial hypothesis that the surfactant would become the preferred carbon source even for hydrocarbon degrading bacteria. Regardless of aeration regimes Triton X-100 was utilized within 48–72 h. Efficiency of diesel oil degradation was decreased in the presence of surfactant for aerobic conditions by approx. 25% reaching 60 instead of 80% noted for experiments without surfactant. No surfactant influence was observed for anaerobic conditions.
The raw milk quality from organic and conventional agriculture
Directory of Open Access Journals (Sweden)
Juraj Čuboň
2008-01-01
Full Text Available In the experiment the parameters of milk quality from organic and conventional dairy farm were analyzed. The number of somatic cells was 219. 103 . ml−1 in the organic milk and 242. 103 . ml−1 in the conventional milk. It seems that conditions of organic farming could be able to have a positive effect of health of mammary gland. We found the highest number of somatic cells at the end of the year (336.103 . ml−1 in organic milk in December, respectively 336.103 . ml−1 in conventional milk in November. The total bacteria count was higher in organic milk (86.103 CFU . ml−1 than conventional (51.103 CFU . ml−1 likewise the number of coliform bacteria. Number of coliform bacteria was by conventional milk under 1000 CFU . ml−1 for all samples. The highest number of coliform bacteria in organic milk was achieved in February (1000 CFU . ml−1. We found higher content of fat (4.23 g . 100g−1 and protein (3.41 g . 100g−1 by organic milk in comparison with the conventional milk (4.11 g . 100g−1, resp. 3.39 g . 100g−1. The higher content of protein and fat in organic milk and the higher protein content in conventional milk were determined in December. The heat resistance was determined by 96 % ethanol required to coagulation of 2 ml of milk. The conventional milk has significantly lower heat resistance (1.38 ml than the organic one (1.86 ml. Better heat stability by organic milk and higher content of Ca (144.29 mg . 100g−1 correspond with higher technological quality of organic milk.
Radiological and Environmental Research Division: ecology. Annual report, January-December 1978
International Nuclear Information System (INIS)
1978-01-01
Ecological studies continue to focus on the determination of the effects of energy-related pollutants on planktonic species typical of the Great Lakes. Also included were experimental studies of the effects of enclosure size on the response of zooplankton to stress by cadmium. A new mobile field laboratory was constructed to support studies of the effects of water temperatures regimes on rates of accumulation by salmonid fishes of persistent organic contaminants such as PCB's. A significant new addition to the Great Lakes Research Program was marked by the arrival and formal acceptance of the new research vessel, the R/V Ekos. Descriptions of the Ekos and its research capabilities are included. A variety of studies of the behavior of transuranic elements conducted in environments as diverse as the Irish Sea, Great Slave Lake, the Great Miami River, and the Great Lakes, have focused on changes in the oxidation state of plutonium, and the effects these changes have on the behavior of this important element in the aquatic environment. Twenty-six sections of the report were abstracted and indexed individually for inclusion on ERA/EDB and those in scope for INIS
Report of mass communication Ceylon: October 1969-December 31, 1970.
1971-01-01
Experience with media usage by the FPA (Family Planning Association of Ceylon between October 1969 and December 1970 is summarized. During this time, the Association purchased 100-200 column inches each of contract advertising space in 26 newspapers. The press has published 268 press release, I.P.P.F., U.N., features and international press clipping in addition to specialized medical articles on family planning methods and 8 articles by FPA office-bearers. In January 1970; the Association launched local radio's first 5-minute daily commercial in Sinhala and Tamil. The program was repeated from April to July 1970. A series of 5 slides on family planning has been shown in movie theathers and more sets are being prepared for viewing. Posters have been used on buses and are currently on display on the National Railways project. Folders, leaflect, and poster calendars have been produced and used. Family Planning stickers have put up in 700 barber saloons. The FPA had stalls in the 1970 3-day National Exhibition at Batticaloa, the 4-day U.N. Poster Exhibition at Badulla, and the 2-week Ceylon Medical College Centenary Exhibition in Colombo. The Information Unit of FPA has answered 18, 541 written inquiries. A family planning communication us regularly dispatched to members of the Cabinet, government and opposition members of parliament, senators, chairmen of local bodies, and key trade union officials.
8 CFR 103.41 - Genealogy request fees.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Genealogy request fees. 103.41 Section 103...; AVAILABILITY OF RECORDS § 103.41 Genealogy request fees. (a) Genealogy search fee. See 8 CFR 103.7(b)(1). (b) Genealogy records fees. See 8 CFR 103.7(b)(1). (c) Manner of submission. When a request is submitted online...
Journal of Glenn T. Seaborg (1946--1958), January 1, 1953--December 31, 1953
International Nuclear Information System (INIS)
Seaborg, G.T.
1991-05-01
This portion of the Glenn T. Seaborg journal covers the 12-year period during which I served as Director of the Division of Nuclear Chemistry of the Radiation Laboratory (now the Lawrence Berkeley Laboratory). This portion of my journal consists of about a dozen volumes, starting with Volume 1 (May 19, 1946--December 31, 1947). The journal is based on my notebook entries; memos covering phone calls, appointments, and meetings; minutes of meetings; my appointment calendars and correspondence files; the Radiation Laboratory Chemistry Division personnel files and travel vouchers; laboratory notebooks of my scientific colleagues and cyclotron bombardment logs; some catalogs and materials from the Bancroft Library and the University Archives; back issues of the campus newspaper the Daily Californian and clippings from S. F. Bay Area newspapers found in my scrapbook, etc. Helen was able to provide me with some of her appointment calendars, which helped clarify family and social activities. Many of these resources provided clear and detailed material. Other notes were made hastily and casually, using initials for people's names and rather cryptic abbreviations; however, when these were deciphered, they provided surprisingly complete information
Journal of Glenn T. Seaborg (1946--1958), January 1, 1954--December 31, 1954
International Nuclear Information System (INIS)
Seaborg, G.T.
1991-05-01
This portion of the Glenn T. Seaborg journal concerns the 12-year period during which I served as Director of the Division of Nuclear Chemistry of the Radiation Laboratory (now the Lawrence Berkeley Laboratory). This portion of my journal consists of about a dozen volumes, starting with Volume 1 (May 19, 1946--December 31, 1947). The journal is based on my notebook entries; memos covering phone calls, appointments, and meetings; minutes of meetings; my appointment calendars and correspondence files; the Radiation Laboratory Chemistry Division personnel files and travel vouchers; laboratory notebooks of my scientific colleagues and cyclotron bombardment logs; some catalogs and materials from the Bancroft Library and the University Archives; back issues of the campus newspaper the Daily Californian and clippings from S. F. Bay Area newspapers found in my scrapbook, etc. Helen was able to provide me with some of her appointment calendars, which helped clarify family and social activities. Many of these resources provided clear and detailed material. Other notes were made hastily and casually, using initials for people's names and rather cryptic abbreviations; however, when these were deciphered, they provided surprisingly complete information
December Variations (on a Theme by Earle Brown)
2014-01-01
Earle Brown’s December 1952 is a score characterised by the use of 31 abstract graphical elements. Brown later re-imagined it as a Calderesque orrery in which “elements would actually physically be moving in front of the pianist” [1]. Although there are many more recent examples of graphic, open and animated scores, for the purposes of this practice-led research the simplicity and grace of Brown’s score makes it a pragmatic choice as it is significantly easier to follow the “translations” bei...
Aulicino, Paula C; Rocco, Carlos A; Mecikovsky, Debora; Bologna, Rosa; Mangano, Andrea; Sen, Luisa
2010-01-01
Patterns and pathways of HIV type-1 (HIV-1) antiretroviral (ARV) drug resistance-associated mutations in clinical isolates are conditioned by ARV history and factors such as viral subtype and fitness. Our aim was to analyse the frequency and association of ARV drug resistance mutations in a group of long-term vertically infected patients from Argentina. Plasma samples from 71 patients (38 children and 33 adolescents) were collected for genotypic HIV-1 ARV resistance testing during the period between February 2006 and October 2008. Statistically significant pairwise associations between ARV resistance mutations in pol, as well as associations between mutations and drug exposure, were identified using Fisher's exact tests with Bonferroni and false discovery rate corrections. Phylogenetic analyses were performed for subtype assignment. In protease (PR), resistance-associated mutations M46I/L, I54M/L/V/A/S and V82A/F/T/S/M/I were associated with each other and with minor mutations at codons 10, 24 and 71. Mutations V82A/F/T/S/M/I were primarily selected by the administration of ritonavir (RTV) in an historical ARV regimen. In reverse transcriptase, thymidine analogue mutation (TAM)1 profile was more common than TAM2. The non-nucleoside K103N+L100I mutations were observed at high frequency (15.5%) and were significantly associated with the nucleoside mutation L74V in BF recombinants. Associations of mutations at PR sites reflect the frequent use of RTV at an early time in this group of patients and convergent resistance mechanisms driven by the high exposure to protease inhibitors, as well as local HIV-1 diversity. The results provide clinical evidence of a molecular interaction between K103N+L100I and L74V mutations at the reverse transcriptase gene in vivo, limiting the future use of second-generation non-nucleoside reverse transcriptase inhibitors such as etravirine.
a phenomenon for achieving time-division-multiplexed multi-port
Indian Academy of Sciences (India)
Olive Ray
MS received 8 December 2015; revised 21 September 2016; accepted 28 January 2017. Abstract. Multi-port .... Converters based upon this principle operate using lower number of ..... Smart DC power management system based on software-.
48 CFR 3.103 - Independent pricing.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Independent pricing. 3.103 Section 3.103 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Safeguards 3.103 Independent pricing. ...
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a series providing continuing information on recent doctoral dissertations. The 23 titles deal with a variety of topics, including the following: (1) the rhetoric of scientific controversy; (2) Erving Goffman's interactional theory of communication conduct; (3) a phenomenology of feminism; (4) a…
2011-02-04
... Nonattainment and Maintenance Areas'' (EPA-420-B-10-040, December 2010). \\2\\ For estimating road dust from... maintenance areas and any PM 2.5 nonattainment and maintenance areas where re-entrained road dust is a... January 2011 AP-42 Method for Estimating Re-Entrained Road Dust From Paved Roads AGENCY: Environmental...
International Nuclear Information System (INIS)
Chaves Porras, Jorge Alvaro
2013-01-01
The impact of survival is determined by the incorporation of the chemotherapeutic temozolamide into the therapy regimen of patients with high grade gliomas. Overall survival is determined in patients with high grade gliomas. The investigation is performed with the total of patients with high grade gliomas, with treatment of radiotherapy and temozolamide. Progression-free survival is determined in the population with high-grade gliomas at Hospital Mexico, from January 2009 to December 2011. The diagnosis of glioblastoma is given in 86% and astrocytoma grade III in 14% of the cases. The concomitance of radiotherapy with temozolomide is received by 33 of 37 patients. Seventy-six percent of patients completed the 6 cycles of adjuvant therapy. The overall survival rate was 14.39 months. Patients with grade III gliomas have had a better prognosis [es
7 CFR 1400.103 - Charitable organizations.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Charitable organizations. 1400.103 Section 1400.103... AND SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Limitation § 1400.103 Charitable organizations. (a) A charitable organization, including a club, society, fraternal organization, or religious...
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The 31 titles deal with a variety of topics, including the following: (1) the rhetoric of confrontation in Northern Ireland; (2) rhetorical arguments in public health regulations; (3) epideictic discourse in the founding of the…
Progress report of Physics Division. 1st January - 31st December 1973
Energy Technology Data Exchange (ETDEWEB)
NONE
2004-07-01
The reactor MOATA is operating successfully at 100 kW with the higher available flux being much appreciated by all users. An uranium analysis service commenced and the various mining exploration companies are gradually availing themselves of it in an increasing fashion. The possible introduction of a similar service for neutron radiography is being explored following successful laboratory studies. Various other applications of nuclear science are under development. The revised safety assessment carried out for 100 kW operation of MOATA led to a more generalized study of self limited, non boiling power transients and in particular the maximum reactivity limit for these transients. This involved a re-examination of the SPERT non boiling transients and the prediction of their outcome in quantitative terms on purely physics considerations without resort to normalization. The indications are that a 10 second period transient in MOATA would give rise to a power transient which would be self limited to 100 . A possible experiment to test this prediction is under examination. Various physics aspects of MOATA operation were studied on a mockup of the reactor on the split table machine and the degree of understanding by staff of this reactor's behavior much improved. The safety assessment of the split table machine (Critical Facility) was completed and should shortly be available from the printer for submission to the new Licensing and Regulatory Bureau for authority to operate. {nu}-bar measurements for the various fissile elements are complete, but studies of neutron emission from the individual fragments produced during the spontaneous fission of {sup 252}Cf fission and the neutron energy spectrum of {sup 252}Cf fission neutrons are being undertaken to clarify some of the remaining discrepancies. Analysis of neutron capture cross section data obtained at Oak Ridge National Laboratory is continuing. Details of the analysis for some element studies are given. Progress has
Progress report of Physics Division. 1st January - 31st December 1973
International Nuclear Information System (INIS)
2004-01-01
The reactor MOATA is operating successfully at 100 kW with the higher available flux being much appreciated by all users. An uranium analysis service commenced and the various mining exploration companies are gradually availing themselves of it in an increasing fashion. The possible introduction of a similar service for neutron radiography is being explored following successful laboratory studies. Various other applications of nuclear science are under development. The revised safety assessment carried out for 100 kW operation of MOATA led to a more generalized study of self limited, non boiling power transients and in particular the maximum reactivity limit for these transients. This involved a re-examination of the SPERT non boiling transients and the prediction of their outcome in quantitative terms on purely physics considerations without resort to normalization. The indications are that a 10 second period transient in MOATA would give rise to a power transient which would be self limited to 100 . A possible experiment to test this prediction is under examination. Various physics aspects of MOATA operation were studied on a mockup of the reactor on the split table machine and the degree of understanding by staff of this reactor's behavior much improved. The safety assessment of the split table machine (Critical Facility) was completed and should shortly be available from the printer for submission to the new Licensing and Regulatory Bureau for authority to operate. ν-bar measurements for the various fissile elements are complete, but studies of neutron emission from the individual fragments produced during the spontaneous fission of 252 Cf fission and the neutron energy spectrum of 252 Cf fission neutrons are being undertaken to clarify some of the remaining discrepancies. Analysis of neutron capture cross section data obtained at Oak Ridge National Laboratory is continuing. Details of the analysis for some element studies are given. Progress has also been
Safety and Environmental Protection Division. Progress report, January 1, 1974--December 31, 1975
International Nuclear Information System (INIS)
1977-01-01
Progress is reported in the analysis of food chain samples collected during 1974 and 1975 at the Bikini Atoll in the Marshall Islands for 90 Sr, 137 Cs, 239 Pu, 240 Pu, and 241 Am remaining in the environment from the 1946-1958 nuclear tests. Data on levels of radioactivity in environmental samples and SO 2 and NO/sub x/ in air samples collected in the vicinity of Brookhaven National Laboratory during 1975 are reported. Samples of surface air, surface waters, ground water, sediments and biota from streams, soils, grass, and milk were analyzed. Abstracts of papers published during 1974 and 1975 are included
29 CFR 1926.103 - Respiratory protection.
2010-07-01
... 29 Labor 8 2010-07-01 2010-07-01 false Respiratory protection. 1926.103 Section 1926.103 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... § 1926.103 Respiratory protection. Note: The requirements applicable to construction work under this...
7 CFR 1416.103 - Application process.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Application process. 1416.103 Section 1416.103 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT... PROGRAMS Livestock Compensation Program § 1416.103 Application process. (a) Applicants must submit to CCC...
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The 25 titles deal with a variety of topics, including the following: (1) the development of American theatre management practices between 1830 and 1896; (2) the aesthetics of audience response; (3) P. Picasso as a theatrical…
Short-term energy outlook, January 1999
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-01-01
The Energy Information Administration (EIA) prepares the Short-Term Energy Outlook (energy supply, demand, and price projections) monthly. The forecast period for this issue of the Outlook extends from January 1999 through December 2000. Data values for the fourth quarter 1998, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in EIA`s Weekly Petroleum Status Report) or are calculated from model simulations that use the latest exogenous information available (for example, electricity sales and generation are simulated by using actual weather data). The historical energy data, compiled in the January 1999 version of the Short-Term Integrated Forecasting System (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding. The STIFS model is driven principally by three sets of assumptions or inputs: estimates of key macroeconomic variables, world oil price assumptions, and assumptions about the severity of weather. Macroeconomic estimates are produced by DRI/McGraw-Hill but are adjusted by EIA to reflect EIA assumptions about the world price of crude oil, energy product prices, and other assumptions which may affect the macroeconomic outlook. By varying the assumptions, alternative cases are produced by using the STIFS model. 28 figs., 19 tabs.
31 CFR 103.63 - Structured transactions.
2010-07-01
... Section 103.63 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS General Provisions § 103.63 Structured transactions. No person shall for the purpose of evading the reporting requirements of § 103.22 with respect to...
48 CFR 2922.103-4 - Approvals.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Approvals. 2922.103-4 Section 2922.103-4 Federal Acquisition Regulations System DEPARTMENT OF LABOR SOCIOECONOMIC PROGRAMS APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS Basic Labor Policies 2922.103-4 Approvals. The “agency...
Preparation of 103Pd seeds. Part 2. 'Molecular Plating' of 103Pd onto copper rod
International Nuclear Information System (INIS)
Chunfu Zhang; Yongxian Wang; Haibin Tian; Duanzhi Yin
2002-01-01
A method for 103 Pd 'molecular plating' onto the surface of the copper rod is reported. The optimal composition of the plating bath was: palladium chloride 2 g/l, ammonium hydroxide (28%) 150 ml/l, sodium hypophosphite 12 g/l, and ammonium chloride 37 g/l. The whole procedure of 103 Pd 'molecular plating' will last 50 minutes at 40 deg C. Valuable experience for the preparation of 103 Pd seeds is provided. (author)
Triangle Universities Nuclear Laboratory annual report: TUNL, XV. 1 January 1976--31 December 1976
International Nuclear Information System (INIS)
1976-01-01
Brief reports of research are presented under the following categories: neutron and fission physics, neutron polarization studies, high-resolution studies, gamma ray spectroscopy, charged-particle reactions with polarized beams, radiative capture reactions, atomic collision physics, heavy-ion reactions, applications, ion source development, accelerator development and instrumentation, computer-related developments, and nuclear theory and phenomenology. Although some data are furnished, many of these partial-page summaries are simply abstracts of published papers. Lists of publications, talks, personnel, etc., are included
Directory of Open Access Journals (Sweden)
Wojciech Cendrowski
2013-06-01
Full Text Available Background: The role of environmental factors (EF determining the occurrence of multiple sclerosis (SM is the subject of current investigations. Objective: To establish association between duration of insolation along with intensity of ultraviolet B (UVB radiation and mortality rates for SM in Poland. Method: The study was based on assemblage of 2172 SM persons (M – 878, F – 1294 who died in Poland in the years 2004–2008. Regional previous duration of insolation was measured in hours, intensity of UVB radiation was monitored in minimal erythema dose units (MED, ozone concentration in the ground layer of atmosphere was recorded in µg/m3 . Measurements of insolation, UVB radiation and ozone concentration were performed at provincial stations and territorial sites of the State Environmental Monitoring. EF were correlated to provincial crude mortality rates (CMR for MS. Correlational test by Pearson was used in the study. Demographic data were obtained from the Central Statistical Office, information on EF was received from the Institute of Meteorology and the Institute of Environmental Protection. Results: Annual, average, crude MR for MS per 100,000 inhabitants in Poland was 1.12 (SD 0.14. In northern part it amounted to 1.20 (SD 0.18 and in southern part reached 1.03 (SD 0.11. Significant inverse correlation was found between previous minimal duration of insolation in December and CMR for SM in the country: r = -0.518, p = 0.044. Borderline significance of inverse correlation was established between minimal intensity of UVB radiation in December and crude death rates for SM in Poland: r = -0.478, p = 0.060. CMR for SM in northern Poland was accompanied not only by lower UVB radiation level, but also by slower spring increase and autumn faster decrease of radiation. No significant correlation was ascertained between the ground atmospheric ozone concentration or the annual number of days with ozone concentration above 120 µg/m3 and MS
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The 10 titles deal with the following topics: (1) press bias in Northern Ireland; (2) the nature of news media selection; (3) the agenda-setting function of the press; (4) a training program for newsroom supervisors using video taped…
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Fire safety. 238.103 Section 238.103..., DEPARTMENT OF TRANSPORTATION PASSENGER EQUIPMENT SAFETY STANDARDS Safety Planning and General Requirements § 238.103 Fire safety. (a) Materials. (1) Materials used in constructing a passenger car or a cab of a...
7 CFR 94.103 - Analytical methods.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Analytical methods. 94.103 Section 94.103 Agriculture... POULTRY AND EGG PRODUCTS Voluntary Analyses of Egg Products § 94.103 Analytical methods. The analytical methods used by the Science and Technology Division laboratories to perform voluntary analyses for egg...
Energy Technology Data Exchange (ETDEWEB)
Shakilur Rahman, Md.; Kim, Kwangsoo; Kim, Guinyun; Nadeem, Muhammad; Thi Hien, Nguyen; Shahid, Muhammad [Kyungpook National University, Department of Physics, Daegu (Korea, Republic of); Naik, Haladhara [Bhabha Atomic Research Centre, Radiochemistry Division, Mumbai (India); Yang, Sung-Chul; Cho, Young-Sik; Lee, Young-Ouk [Korea Atomic Energy Research Institute, Nuclear Data Center, Daejeon (Korea, Republic of); Shin, Sung-Gyun; Cho, Moo-Hyun [Pohang University of Science and Technology, Division of Advanced Nuclear Engineering, Pohang (Korea, Republic of); Woo Lee, Man; Kang, Yeong-Rok; Yang, Gwang-Mo [Dongnam Institute of Radiological and Medical Science, Research Center, Busan (Korea, Republic of); Ro, Tae-Ik [Dong-A University, Department of Materials Physics, Busan (Korea, Republic of)
2016-07-15
We measured the flux-weighted average cross-sections and the isomeric yield ratios of {sup 99m,g,100m,g,101m,g,102m,g}Rh in the {sup 103}Rh(γ, xn) reactions with the bremsstrahlung end-point energies of 55 and 60 MeV by the activation and the off-line γ-ray spectrometric technique, using the 100 MeV electron linac at the Pohang Accelerator Laboratory (PAL), Korea. The flux-weighted average cross-sections were calculated by using the computer code TALYS 1.6 based on mono-energetic photons, and compared with the present experimental data. The flux-weighted average cross-sections of {sup 103}Rh(γ, xn) reactions in intermediate bremsstrahlung energies are the first time measurement and are found to increase from their threshold value to a particular value, where the other reaction channels open up. Thereafter, it decreases with bremsstrahlung energy due to its partition in different reaction channels. The isomeric yield ratios (IR) of {sup 99m,g,100m,g,101m,g,102m,g}Rh in the {sup 103}Rh(γ, xn) reactions from the present work were compared with the literature data in the {sup 103}Rh(d, x), {sup 102-99}Ru(p, x), {sup 103}Rh(α, αn), {sup 103}Rh(α, 2p3n), {sup 102}Ru({sup 3}He, x), and {sup 103}Rh(γ, xn) reactions. It was found that the IR values of {sup 102,101,100,99}Rh in all these reactions increase with the projectile energy, which indicates the role of excitation energy. At the same excitation energy, the IR values of {sup 102,101,100,99}Rh are higher in the charged particle-induced reactions than in the photon-induced reaction, which indicates the role of input angular momentum. (orig.)
Waste management research abstracts no. 22. Information on radioactive waste programmes in progress
International Nuclear Information System (INIS)
1995-07-01
The research abstracts contained in this issue have been collected during recent months and cover the period between January 1992 - February 1994 (through July 1994 for abstracts from the United States). The abstracts reflect research currently in progress in the field of radioactive waste management: environmental impacts, site selection, decontamination and decommissioning, environmental restoration and legal aspects of radioactive waste management. Though the information contained in this publication covers a wide range of programmes in many countries, the WMRA should not be interpreted as providing a complete survey of on-going research and IAEA Member States. For the first time, the abstracts published in document are only in English language. In addition, the abstracts received for this issue have been assigned INIS subject category codes and thesaurus terms to facilitate searches and also to fully utilize established sets of technical categories and terms
41 Polish Seminar on Nuclear Magnetic Resonance and Its Applications - Abstracts
Energy Technology Data Exchange (ETDEWEB)
NONE
2008-07-01
The Report consist of abstracts of 63 communications presented during the 41 Polish Seminar on Nuclear Magnetic Resonance and Its Applications, held on December 1-2, 2008 in Cracow. Presentations cover a variety of research fields, including magnetic resonance imaging in vivo, applications of NMR spectroscopy to medical diagnosis, studies on molecular properties of different materials as well as quantum chemical calculations of NMR parameters.
41 Polish Seminar on Nuclear Magnetic Resonance and Its Applications - Abstracts
International Nuclear Information System (INIS)
2008-01-01
The Report consist of abstracts of 63 communications presented during the 41 Polish Seminar on Nuclear Magnetic Resonance and Its Applications, held on December 1-2, 2008 in Cracow. Presentations cover a variety of research fields, including magnetic resonance imaging in vivo, applications of NMR spectroscopy to medical diagnosis, studies on molecular properties of different materials as well as quantum chemical calculations of NMR parameters
8 CFR 103.38 - Genealogy Program.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Genealogy Program. 103.38 Section 103.38...; AVAILABILITY OF RECORDS § 103.38 Genealogy Program. (a) Purpose. The Department of Homeland Security, U.S. Citizenship and Immigration Services Genealogy Program is a fee-for-service program designed to provide...
Fortaleza Station Report for 2012
Kaufmann, Pierre; Pereira de Lucena, A. Macilio; Sombra da Silva, Adeildo
2013-01-01
This is a brief report about the activities carried out at the Fortaleza geodetic VLBI station (ROEN: R´adio Observat´orio Espacial do Nordeste), located in Eus´ebio, CE, Brazil, during the period from January until December 2012. The observing activities were resumed in May after the major maintenance that comprised the azimuth bearing replacement. The total observational experiments consisted of 103 VLBI sessions and continuous GPS monitoring recordings.
Triangle Universities Nuclear Laboratory annual report: TUNL, XV. 1 January 1976 -- 31 December 1976
Energy Technology Data Exchange (ETDEWEB)
None
1976-01-01
Brief reports of research are presented under the following categories: neutron and fission physics, neutron polarization studies, high-resolution studies, gamma ray spectroscopy, charged-particle reactions with polarized beams, radiative capture reactions, atomic collision physics, heavy-ion reactions, applications, ion source development, accelerator development and instrumentation, computer-related developments, and nuclear theory and phenomenology. Although some data are furnished, many of these partial-page summaries are simply abstracts of published papers. Lists of publications, talks, personnel, etc., are included. (RWR)
INL Seismic Monitoring Annual Report: January 1, 2007 - December 31, 2007
Energy Technology Data Exchange (ETDEWEB)
S. J. Payne; N. S. Carpenter; J. M. Hodges; R. G. Berg
2008-09-01
During 2007, the INL Seismic Monitoring Program evaluated 2,515 earthquakes from around the world, the western United States, and local region of the eastern Snake River Plain. 671 earthquakes and man-made blasts occurred within the local region outside and within a 161-km (or 100-mile) radius of INL. Of these events, eleven were small to moderate size earthquakes ranging in magnitude from 3.0 to 4.8. 341 earthquakes occurred within the 161-km radius of INL and the majority of these earthquakes were located in active regions of the Basin and Range Province that surrounds the ESRP. Three earthquakes were located within the ESRP at Craters of the Moon National Monument. The earthquakes were of Mc 0.9, 1.4, and 1.8. Since 1972, INL has recorded 36 small-magnitude microearthquakes (M < 2.0) within the ESRP.
31 CFR 103.57 - Civil penalty.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Civil penalty. 103.57 Section 103.57... REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS General Provisions § 103.57 Civil penalty. (a) For any... willfully participates in the violation, a civil penalty not to exceed $1,000. (b) For any willful violation...
International Nuclear Information System (INIS)
Wenzel, M.; Wu, Y.
1987-01-01
The radioactive decay of [ 103 Ru]ruthenocene derivatives leads to sup(103m)Rh labelled rhodocinium derivatives, which can be separated by the extraction of a lipophilic solution of the ruthenocen derivate with water. The separation factor sup(103m)Rh/ 103 Ru reaches values of 32:1 Rh 3+ ions are not liberated and extracted. The organ distribution of the sup(103m)Rh labelled rhodocinium derivatives gained from ruthenocene and from N-isopropyl-ruthenocene amphetamine is different from the distribution of the parent ruthenocene compound. The liver and kidney uptake of the rhodocinium-amphetamine is much higher than the uptake with ruthenocene amphetamine. (author)
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Authority. 401.103 Section... ACQUISITION REGULATION SYSTEM Purpose, Authority, Issuance 401.103 Authority. The AGAR and amendments thereto... delegated authority to promulgate Departmental acquisition regulations. ...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Definitions. 25.103 Section 25.103 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... communications satellites. (c) Communications satellite corporation. (1) The terms “communications satellite...
Directory of Open Access Journals (Sweden)
Diego Gazzolo
Full Text Available BACKGROUND: Neonatal death in full-term infants who suffer from perinatal asphyxia (PA is a major subject of investigation, since few tools exist to predict patients at risk of ominous outcome. We studied the possibility that urine S100B measurement may identify which PA-affected infants are at risk of early postnatal death. METHODOLOGY/PRINCIPAL FINDINGS: In a cross-sectional study between January 1, 2001 and December 1, 2006 we measured S100B protein in urine collected from term infants (n = 132, 60 of whom suffered PA. According to their outcome at 7 days, infants with PA were subsequently classified either as asphyxiated infants complicated by hypoxic ischemic encephalopathy with no ominous outcome (HIE Group; n = 48, or as newborns who died within the first post-natal week (Ominous Outcome Group; n = 12. Routine laboratory variables, cerebral ultrasound, neurological patterns and urine concentrations of S100B protein were determined at first urination and after 24, 48 and 96 hours. The severity of illness in the first 24 hours after birth was measured using the Score for Neonatal Acute Physiology-Perinatal Extension (SNAP-PE. Urine S100B levels were higher from the first urination in the ominous outcome group than in healthy or HIE Groups (p1.0 microg/L S100B had a sensitivity/specificity of 100% for predicting neonatal death. CONCLUSIONS/SIGNIFICANCE: Increased S100B protein urine levels in term newborns suffering PA seem to suggest a higher risk of neonatal death for these infants.
Rift Valley fever outbreak--Kenya, November 2006-January 2007.
2007-02-02
In mid-December 2006, several unexplained fatalities associated with fever and generalized bleeding were reported to the Kenya Ministry of Health (KMOH) from Garissa District in North Eastern Province (NEP). By December 20, a total of 11 deaths had been reported. Of serum samples collected from the first 19 patients, Rift Valley fever (RVF) virus RNA or immunoglobulin M (IgM) antibodies against RVF virus were found in samples from 10 patients; all serum specimens were negative for yellow fever, Ebola, Crimean-Congo hemorrhagic fever, and dengue viruses. The outbreak was confirmed by isolation of RVF virus from six of the specimens. Humans can be infected with RVF virus from bites of mosquitoes or other arthropod vectors that have fed on animals infected with RVF virus, or through contact with viremic animals, particularly livestock. Reports of livestock deaths and unexplained animal abortions in NEP provided further evidence of an RVF outbreak. On December 20, an investigation was launched by KMOH, the Kenya Field Epidemiology and Laboratory Training Program (FELTP), the Kenya Medical Research Institute (KEMRI), the Walter Reed Project of the U.S. Army Medical Research Unit, CDC-Kenya's Global Disease Detection Center, and other partners, including the World Health Organization (WHO) and Médecins Sans Frontières (MSF). This report describes the findings from that initial investigation and the control measures taken in response to the RVF outbreak, which spread to multiple additional provinces and districts, resulting in 404 cases with 118 deaths as of January 25, 2007.
Energy Technology Data Exchange (ETDEWEB)
Watanabe, Norimoto; Kishi, Masami; Hayakawa, Osamu
1988-03-31
On the each samples of rain and snow collected in the City of Sapporo from January 1984 through December 1986, analyses were made in eleven ionic species, amount of rainfall, conductivity, ninhydrin-N, pH buffer, chemical oxygen demand (COD), and ultra violet absorbance. The pH of samples correlated to the logarithm of the concentration on each analysis except Na, NH/sub 4/, ninhydrin-N, and PO. Rainfall samples were divided into five respective pH range as follows: 5.0 or less, 5.0 to 5.5, 5.5 to 6.0, 6.0 to 6.5, and 6.5 or more. Equivalent amount of cation and anion, and cation/anion ratio increased in higher pH range. No significant correlation was found between the pH of the samples and the concentration of N and S oxides, nor between the hydrogen ion concentration precipitated amounts and the NO/sub 2/ and SO/sub 4/ precipitated amounts in pH range of 5.5 or less. The study yeilded the result that the increase of N and S oxides has little effect on the increase of H/sup +/. (8 figs, 6 tabs, 1 ref)
2015-05-01
fatigue an induced ultrasonic elastic vibration (via piezoelectric transducers [ PZTs ]) propagates through the dogbone specimen. A receiver PZT picks up...inspection of fatigue crack growth in aluminum 7075-T6 dogbone specimens. Acellent Technologies, Inc., is supporting this project through providing...January 2015. 15. SUBJECT TERMS structural health monitoring, probabilistics, fatigue damage, guided waves, Lamb waves 16. SECURITY CLASSIFICATION OF
Remarks on the 103Rh(n,n') sup(103m)Rh excitation curve
International Nuclear Information System (INIS)
Pazsit, A.; Peto, G.; Csikai, J.; Jozsa, I.; Bacso, J.
1975-01-01
The cross sections of the 103 Rh(n,n')sup(103m)Rh reaction have been measured at 2.7MeV and 14.8MeV neutron energies as well as for neutron spectra of 252 Cf and 239 Pu-α-Be sources; the results are 999+-111mb, 216+-26mb, 757+-53mb and 918+-64mb, respectively. (author)
Cross section measurement for the reaction /sup 103/Rh (n,n') /sup 103m/Rh
International Nuclear Information System (INIS)
Paulsen, A.; Liskien, H.; Vaninbroukx, R.; Widera, R.
1980-01-01
The excitation function for the reaction /sup 103/Rh (n,n') /sup 103m/Rh was measured by the activation technique from 0.2 to 6.1 MeV in 0.1-MeV steps and from 13.0 to 16.7 MeV in 1-MeV steps. This excitation function is normalized through an absolute measurement at 1.8 MeV. This measurement is based on n-p scattering for neutron flux determination and on liquid scintillation counting of /sup 103m/Rh separated from /sup 103/Pd solutions for the activity determination. The total uncertainty of the cross-section results is typically + or -5% above 0.5 MeV (about + or -10% above 13 MeV). Concurrence with existing data is good except below 0.35 MeV, where the present results are considerably higher
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Definitions. 838.103 Section 838.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) COURT ORDERS AFFECTING RETIREMENT BENEFITS Court Orders Generally Organization and Structure of Regulations on...
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Authority. 501.103 Section... SERVICES ADMINISTRATION ACQUISITION REGULATION SYSTEM Purpose, Authority, Issuance 501.103 Authority. GSA's Senior Procurement Executive issues the GSAR under the authority of the Federal Property and...
International Nuclear Information System (INIS)
2007-01-01
In this leaflet results of exploitation of four units of the Bohunice V1 and V2 NPPs are presented. The electricity and heat production in December 2006 are reviewed. Within a December 2006 the electricity was produced in NPP V1: 301.221 GWh (block 1), 281.125 GWh (block 2), totally 582.346 GWh, and 6179.205 GWh within a January - December 2006. Within a November 2006 the NPP V2: the block 3 and block 4 has worked in stabile regime according to needs of regulation. Processing and storage of radioactive wastes in Jadrova vyradovacia spolocnost (JAVYS) is presented. Twenty pieces of fibre-concrete containers were processed into fibre-concrete containers in Bohunice processing centre of radioactive wastes (BSC RAO) in December 2006. Eight fibre-concrete containers were stored into Republic storage of radioactive wastes (RU RAO). Total number in RU RAO reached 1260 pieces of fibre-concrete containers, which represent 17.50 per cent of storage capacity (7200 containers)
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true The Act. 4.103 Section 4.103 Labor Office of the Secretary... Contract Act Introductory § 4.103 The Act. The McNamara-O'Hara Service Contract Act of 1965 (Pub. L. 89-286, 79 Stat. 1034, 41 U.S.C. 351 et seq.), hereinafter referred to as the Act, was approved by the...
INL Seismic Monitoring Annual Report: January 1, 2012 - December 31, 2012
Energy Technology Data Exchange (ETDEWEB)
Payne, S. J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Bruhn, D. F. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hodges, J. M. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Berg, R. G. [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-03-01
During 2012, the Idaho National Laboratory Seismic Monitoring Program evaluated 17,329 independent triggers that included earthquakes from around the world, the western United States, and local region of the Snake River Plain. Seismologists located 1,460 earthquakes and man-made blasts within and near the 161-km (or 100-mile) radius of the Idaho National Laboratory. Of these earthquakes, 16 had small-to-moderate size magnitudes (M) from 3.0 to 3.6. Within the 161-km radius, the majority of 695 earthquakes (M < 3.6) occurred in the active regions of the Basin and Range Provinces adjacent to the eastern Snake River Plain. Only 11 microearthquakes occurred within the Snake River Plain, four of which occurred in Craters of the Moon National Monument. The earthquakes had magnitudes from 1.0 to 1.7 and occurred at deep depths (11-24 km). Two events with magnitudes less than 1.0 occurred within the Idaho National Laboratory boundaries and had depths less than 10 km.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false General. 45.103 Section 45.103 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT... voluntary consensus standards (see FAR 11.101(b)) and industry-leading practices and standards to manage...
2010-10-01
... article is likely to affect future acquisitions, include a recommendation that a copy of the determination... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Exceptions. 825.103 Section 825.103 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS SOCIOECONOMIC...
Energy Technology Data Exchange (ETDEWEB)
Wenzel, M.; Wu, Y.
1987-01-01
The radioactive decay of (/sup 103/Ru)ruthenocene derivatives leads to sup(103m)Rh labelled rhodocinium derivatives, which can be separated by the extraction of a lipophilic solution of the ruthenocen derivate with water. The separation factor sup(103m)Rh//sup 103/Ru reaches values of 32:1 Rh/sup 3 +/ ions are not liberated and extracted. The organ distribution of the sup(103m)Rh labelled rhodocinium derivatives gained from ruthenocene and from N-isopropyl-ruthenocene amphetamine is different from the distribution of the parent ruthenocene compound. The liver and kidney uptake of the rhodocinium-amphetamine is much higher than the uptake with ruthenocene amphetamine.
EIA publications directory 1996
International Nuclear Information System (INIS)
1997-05-01
This edition of the EIA Publications Directory contains titles and abstracts of periodicals and one-time reports produced by the Energy Information Administration (EIA) from January through December 1996. The body of the Directory contains citations and abstracts arranged by broad subject categories; metadata, coal, oil and gas, nuclear, electricity, renewable and energy/alternative fuels, multifuel, end-use consumption, models, and forecasts
2010-07-01
... REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering Programs Special Due Diligence for...-money laundering program requirement; (viii) A broker or dealer in securities registered, or required to... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 103.175 Section 103.175...
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 1.103 Section 1... REGULATIONS SYSTEM Purpose, Authority, Issuance 1.103 Authority. (a) The development of the FAR System is in..., National Aeronautics and Space Administration, under their several statutory authorities. [48 FR 42103...
19 CFR 200.735-103 - Counseling service.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Counseling service. 200.735-103 Section 200.735-103 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION EMPLOYEE RESPONSIBILITIES AND CONDUCT General Provisions § 200.735-103 Counseling service. (a) The Chairman shall appoint a Designated Agency...
5 CFR 307.103 - Nature of VRAs.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Nature of VRAs. 307.103 Section 307.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS VETERANS RECRUITMENT APPOINTMENTS § 307.103 Nature of VRAs. VRAs are excepted appointments, made without competition, to positions...
International Nuclear Information System (INIS)
1985-03-01
Research progress is reported in the following areas: (1) photoionization of radicals or excited states; (2) molecular spectroscopy by resonant multiphoton ionization; (3) studies conducted with the synchrotron radiation facility at the National Bureau of Standards; (4) theoretical studies on molecular photoabsorption; (5) analysis of photoabsorption spectra of open-shell atoms; (6) the electron energy-loss spectra of molecules; and (7) cross sections and stopping powers. Items have been individually abstracted for the data base
2010-07-01
... definitions apply: (a) Money laundering means an activity criminalized by 18 U.S.C. 1956 or 1957, or an... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 103.90 Section 103.90 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND...
2010-07-01
...) Children means— (1) Persons up through age 21 who are entitled to a free public education through grade 12... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 200.103 Section 200.103 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION...
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 1301.103... COMMERCE ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 1301.103 Authority. The CAR is issued under the authority of section 22 of the Office of Federal Procurement Policy Act, as amended (41 U.S.C...
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 801.103 Section... VETERANS AFFAIRS ACQUISITION REGULATION SYSTEM Purpose, Authority, Issuance 801.103 Authority. The Secretary issues the VAAR under the authority of 40 U.S.C. 121(c), Title 48 of the Code of Federal...
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Authority. 301.103 Section... REGULATION SYSTEM Purpose, Authority, and Issuance 301.103 Authority. (b) The Assistant Secretary for Financial Resources (ASFR) prescribes the HHSAR under the authority of 5 U.S.C. 301 and section 205(c) of...
Plastic deformation in oxide ceramics. Progress report, January 1-December 31, 1980
International Nuclear Information System (INIS)
Heuer, A.H.
1980-09-01
Effects of O/U ratio on UO 2 single crystals oriented either to suppress or promote ]100] slip are described. For both orientations, a change from crystallographic to noncrystallographic slip is observed with composition and temperature and correlated with the presence of Willis defects. Research on the kinetics and mechanism of formation of crystallographic shear (CS) planes in reduced rutile (TiO/sub 2-x/) is also described. Two orientations of CS planes, ]132] and ]121], are present, although prior work had suggested that only one orientation would be present for the particular value of x studied. In-situ reductions in the environmental stage of the HVEM have also begun. Precipitation in nonstoichiometric spinels was also investigated
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT
International Nuclear Information System (INIS)
Leigh, C.
2000-01-01
The purpose of the inventory abstraction as directed by the development plan (CRWMS M and O 1999b) is to: (1) Interpret the results of a series of relative dose calculations (CRWMS M and O 1999c, 1999d). (2) Recommend, including a basis thereof, a set of radionuclides that should be modeled in the Total System Performance Assessment in Support of the Site Recommendation (TSPA-SR) and the Total System Performance Assessment in Support of the Final Environmental Impact Statement (TSPA-FEIS). (3) Provide initial radionuclide inventories for the TSPA-SR and TSPA-FEIS models. (4) Answer the U.S. Nuclear Regulatory Commission (NRC)'s Issue Resolution Status Report ''Key Technical Issue: Container Life and Source Term'' (CLST IRSR) (NRC 1999) key technical issue (KTI): ''The rate at which radionuclides in SNF [Spent Nuclear Fuel] are released from the EBS [Engineered Barrier System] through the oxidation and dissolution of spent fuel'' (Subissue 3). The scope of the radionuclide screening analysis encompasses the period from 100 years to 10,000 years after the potential repository at Yucca Mountain is sealed for scenarios involving the breach of a waste package and subsequent degradation of the waste form as required for the TSPA-SR calculations. By extending the time period considered to one million years after repository closure, recommendations are made for the TSPA-FEIS. The waste forms included in the inventory abstraction are Commercial Spent Nuclear Fuel (CSNF), DOE Spent Nuclear Fuel (DSNF), High-Level Waste (HLW), naval Spent Nuclear Fuel (SNF), and U.S. Department of Energy (DOE) plutonium waste. The intended use of this analysis is in TSPA-SR and TSPA-FEIS. Based on the recommendations made here, models for release, transport, and possibly exposure will be developed for the isotopes that would be the highest contributors to the dose given a release to the accessible environment. The inventory abstraction is important in assessing system performance because
40 CFR 406.103-406.104 - [Reserved
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 406.103-406.104 Section 406.103-406.104 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS GRAIN MILLS POINT SOURCE CATEGORY Wheat Starch and Gluten Subcategory §§ 406.103-406.104...
18 CFR 284.103-284.106 - [Reserved
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.103-284.106 Section 284.103-284.106 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... RELATED AUTHORITIES Certain Transportation by Interstate Pipelines §§ 284.103-284.106 [Reserved] ...
31 CFR 103.73 - Contents of summons.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Contents of summons. 103.73 Section 103.73 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Summons § 103.73 Contents of summons. (a) Summons...
49 CFR 38.103 - Public information system.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Public information system. 38.103 Section 38.103... SPECIFICATIONS FOR TRANSPORTATION VEHICLES Commuter Rail Cars and Systems § 38.103 Public information system. (a... information. Alternative systems or devices which provide equivalent access are also permitted. (b) [Reserved] ...
14 CFR 1250.103 - Discrimination prohibited.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Discrimination prohibited. 1250.103 Section 1250.103 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION NONDISCRIMINATION IN... Discrimination prohibited. ...
2010-07-01
... unavoidable failure of air pollution control equipment or process equipment or of a process to operate in a... pollutant in the ambient air by varying the emissions of that pollutant according to atmospheric conditions... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Definitions. 57.103 Section 57.103...
Abstracts of Phase I awards, 1983. Small Business Innovation Research program
International Nuclear Information System (INIS)
1983-12-01
The Department of Energy (DOE) issued its first solicitation for the Small Business Innovation Research (SBIR) program on December 15, 1982, with a due date of March 1, 1983. Out of the 1734 proposals received, 106 were selected for Phase I funding totaling about $5 million. All projects selected are now under contract, with a period of performance typically of six months, starting in almost all cases on September 1, 1983. This publication provides abstracts of the projects selected, including brief comments on the potential applications as described by the proposer. Individuals and organizations, including venture capital and larger industrial firms, with an interest in the research described in any of the abstracts are encouraged to contact the respective company directly
Military Review, Volume 74, Number 1. January 1994. FM 100-5 and Operations Other than War
1994-01-01
assistance of the brrdal. Azerisnarraya Gazeitate 4 January 1993), For a detailed discussion of Croatian Diaspora to their blood relations" faoilitatin me...could be obligation to undertake immediate reinforce- many times larger than the Mariel immigration ment of the public health care system." Again. of 1980...population. It will be could be many times larger than the Mariel in the best interests of the United States and immigration of 1980 and may include
Energy Technology Data Exchange (ETDEWEB)
1985-03-01
Research progress is reported in the following areas: (1) photoionization of radicals or excited states; (2) molecular spectroscopy by resonant multiphoton ionization; (3) studies conducted with the synchrotron radiation facility at the National Bureau of Standards; (4) theoretical studies on molecular photoabsorption; (5) analysis of photoabsorption spectra of open-shell atoms; (6) the electron energy-loss spectra of molecules; and (7) cross sections and stopping powers. Items have been individually abstracted for the data base. (ACR)
Energy Technology Data Exchange (ETDEWEB)
Powers, D.W. [Powers (Dennis W.), Anthony, TX (United States); Martin, M.L. [International Technology, Inc., Las Vegas, NV (United States)
1993-08-01
This select bibliography contains 941 entries. Each bibliographic entry contains the citation of a report, conference paper, or journal article containing geotechnical information about the Waste Isolation Pilot Plant (WIPP). The entries cover the period from 1972, when investigation began for a WIPP Site in southeastern New Mexico, through December 1990. Each entry is followed by an abstract. If an abstract or suitable summary existed, it has been included; 316 abstracts were written for other documents. For some entries, an annotation has been provided to clarify the abstract, comment on the setting and significance of the document, or guide the reader to related reports. An index of key words/phrases is included for all entries.
International Nuclear Information System (INIS)
Powers, D.W.; Martin, M.L.
1993-08-01
This select bibliography contains 941 entries. Each bibliographic entry contains the citation of a report, conference paper, or journal article containing geotechnical information about the Waste Isolation Pilot Plant (WIPP). The entries cover the period from 1972, when investigation began for a WIPP Site in southeastern New Mexico, through December 1990. Each entry is followed by an abstract. If an abstract or suitable summary existed, it has been included; 316 abstracts were written for other documents. For some entries, an annotation has been provided to clarify the abstract, comment on the setting and significance of the document, or guide the reader to related reports. An index of key words/phrases is included for all entries
39 CFR 10.3 - Post-employment activities.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Post-employment activities. 10.3 Section 10.3 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.3 Post-employment activities. Governors are subject...
8 CFR 103.30 - Accounting for disclosures.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Accounting for disclosures. 103.30 Section... DUTIES; AVAILABILITY OF RECORDS § 103.30 Accounting for disclosures. (a) An accounting of each disclosure of information for which accounting is required (see § 103.24 of this part) shall be attached to the...
17 CFR 248.103-248.119 - [Reserved
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false [Reserved] 248.103-248.119 Section 248.103-248.119 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing §§ 248.103-248.119 [Reserved] ...
48 CFR 922.103-5 - Contract clauses.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 922.103... PROGRAMS APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITION Basic Labor Policies 922.103-5 Contract clauses. In accordance with FAR 22.101-1(e) and FAR 22.103-5, the contracting officer shall insert the...
12 CFR 509.103 - Civil money penalties.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Civil money penalties. 509.103 Section 509.103... PROCEDURE IN ADJUDICATORY PROCEEDINGS Local Rules § 509.103 Civil money penalties. (a) Assessment. In the... may serve an order of assessment of civil money penalty upon the party concerned. The assessment order...
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The eight titles deal with the following topics: (1) the effects of self-instructional and discrimination communication training on the development of confrontation skills in prepracticum counseling trainees, (2) cross-cultural…
Séminaire de physique corpusculaire⎪5 December
2012-01-01
Physics and Realisation of the LHeC, by Prof. Max Klein, University of Liverpool Wednesday 5 December 2012 at 11:15 Science III, Auditoire 1S081 30, quai Ernest-Ansermet, 1211 Genève 4 Abstract: The Large Hadron Electron Collider (LHeC) project involves upgrading the LHC with a new electron beam in order to build a luminous, TeV energy ep and eA collider at CERN. An introduction is given to the physics programme of the LHeC, and the design concepts are described of the 60 GeV electron accelerator and of a new detector for precision deep inelastic scattering. More information here.
Morrison, Suzanne DePalma; Sutton, Sonya F; Mebane, Felicia E
2006-01-01
News organizations are an important and influential part of the social environment. They identify certain issues by the extent and nature of their coverage. To help explain what public health policy messages may have influenced school policy decisions, this content analysis provides an examination of newspaper coverage of North Carolinas 100% tobacco-free schools campaign. Researchers searched LexisNexis for articles published in North Carolina newspapers between January 1, 2001 and December 31, 2004 that included variations of "North Carolina tobacco-free schools." Researchers then conducted a descriptive analysis of 138 stories from nine North Carolina newspapers (approximately 4% of all the states newspapers) and used page placement and story type to examine the level of importance placed on the issue. Finally, frames for and against tobacco-free school policies were tracked, along with the presence of key messages presented by 100% TFS advocates. The volume of news coverage changed throughout the study period, with peaks and valleys closely associated with external "trigger" events. In addition, a majority of the newspaper articles did not include key public health messages. The results suggest an opportunity for public health experts and officials to work more effectively with local journalists to increase the use (and impact) of public health messages in news coverage of tobacco policies affecting youth.
Nevada Nuclear Waste Storage Investigations, January-June 1987: An update
International Nuclear Information System (INIS)
Tamura, A.T.; Lorenz, J.J.
1988-03-01
This update contains information on the Nevada Nuclear Waste Storage Investigations (NNWSI) that was added to the DOE Energy Data Base during the first six months of 1987. The update is categorized by principal NNWSI Project participating organization, and items are arranged in chronological order. Participant-sponsored subcontractor reports, papers, and articles are included in the sponsoring organization's list. The publication following this update will be a supplement to the first bibliography (DOE/TIC-3406) and will include all information retrieved from January 1, 1986, to December 31, 1987. It will be a cumulation of all updates for this two-year interval and will include indexing for: Corporate Author, Personal Author, Subject, Contract Number, Report Number, Order Number Correlation, and Key Word in Context
Energy Technology Data Exchange (ETDEWEB)
Holland, L.M.; Stafford, C.G. (comps.)
1982-10-01
This report summarizes research and development activities of the Los Alamos Life Sciences Division's Biomedical and Environmental Research program for the calendar year 1981. Individual reports describing the current status of projects have been entered individually into the data base.
Transmission of 2 × 56 Gb/s PAM-4 signal over 100 km SSMF using 18 GHz DMLs.
Zhou, Shiwei; Li, Xiang; Yi, Lilin; Yang, Qi; Fu, Songnian
2016-04-15
We experimentally demonstrate C-band 2 × 56 Gb/s pulse-amplitude modulation (PAM)-4 signal transmission over 100 km standard single-mode fiber (SSMF) using 18 GHz direct-modulated lasers (DMLs) and direct detection, without inline optical amplifier. A delay interferometer (DI) at the transmitter side is used to extend the transmission reach from 40 to 100 km. A digital Volterra filter at the receiver side is used to mitigate the nonlinear distortions. We obtain an average bit error ratio (BER) of 1.5 × 10(-3) for 2 × 56 Gb/s PAM-4 signal after 100 km SSMF transmission at the optimal input power, which is below the 7% forward error correction (FEC) threshold (3.8 × 10(-3)).
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The 11 titles deal with the following topics: secondary school principals' attitudes toward characteristics of an ideal reading program; the effects of rock music on the reading comprehension of eighth grade students; objectives for…
1983-12-01
W6 1 December 193 TECHNICAL REPORT 111/ 0 ’I~u ABSTRACTS OF RESEARCH PROJECT REPORTS BY NAVAL DENTAL CLZUC IRST- AND SEcon-TEu RESIDENTS - JUNE 1983 by...no signs, symptoms, or history of myofascial pain dysfunction syndrome, temporomandibular joint dysfunction, or posterior bite collapse. An isokinetic
Low dose rate Ir-192 interstitial brachytherapy for prostate cancer
Energy Technology Data Exchange (ETDEWEB)
Oki, Yosuke; Dokiya, Takushi; Yorozu, Atsunori; Suzuki, Takayuki; Saito, Shiro; Monma, Tetsuo; Ohki, Takahiro [National Tokyo Medical Center (Japan); Murai, Masaru; Kubo, Atsushi
2000-04-01
From December 1997 through January 1999, fifteen prostatic cancer patients were treated with low dose rate Ir-192 interstitial brachytherapy using TRUS and perineal template guidance without external radiotherapy. Up to now, as no apparent side effects were found, the safety of this treatment is suggested. In the future, in order to treat prostatic cancer patients with interstitial brachytherapy using I-125 or Pd-103, more investigation for this low dose rate Ir-192 interstitial brachytherapy is needed. (author)
International Nuclear Information System (INIS)
Mowlavi, A. A.; Binesh, A.; Moslehitabar, H.
2006-01-01
Palladium-103 ( 103 Pd) is a brachytherapy source for cancer treatment. The Monte Carlo codes are usually applied for dose distribution and effect of shieldings. Monte Carlo calculation of dose distribution in water phantom due to a MED3633 103 Pd source is presented in this work. Materials and Methods: The dose distribution around the 10 3Pd Model MED3633 located in the center of 30*30*30 m 3 water phantom cube was calculated using MCNP code by the Monte Carlo method. The percentage depth dose variation along the different axis parallel and perpendicular to the source was also calculated. Then, the isodose curves for 100%, 75%, 50% and 25% percentage depth dose and dosimetry parameters of TG-43 protocol were determined. Results: The results show that the Monte Carlo Method could calculate dose deposition in high gradient region, near the source, accurately. The isodose curves and dosimetric characteristics obtained for MED3633 103 Pd source are in good agreement with published results. Conclusion: The isodose curves of the MED3633 103 Pd source have been derived form dose calculation by MCNP code. The calculated dosimetry parameters for the source agree quite well with their Monte Carlo calculated and experimental measurement values
International Nuclear Information System (INIS)
1990-01-01
This Decree amends Decree No. 63-1228 of 11 December 1963 laying down a prior licensing procedure for large nuclear installations. The amendments aim to harmonize the 1963 Decree with the Act of 1987 on the prevention of major risks. Henceforth decommissioning is taken into account, both in the application and in the licence itself [fr
Do clinicians use more question marks?
Zijlmans, Maeike; Otte, Willem M; Van't Klooster, Maryse A; van Diessen, Eric; Leijten, Frans Ss; Sander, Josemir W
2015-01-01
OBJECTIVE: To quantify the use of question marks in titles of published studies. DESIGN AND SETTING: Literature review. PARTICIPANTS: All Pubmed publications between 1 January 2013 and 31 December 2013 with an available abstract. Papers were classified as being clinical when the search terms clin*,
African Journals Online (AJOL)
User
EFFECT OF THERMAL AND PHYSICOCHEMICAL TREATMENT ON ABATTOIR ... find means of effectively treating the abattoir waste water before they are reused or ... discharges into Ikpoba river water body and subjected to physicochemical and thermal ..... discharge into water body and hence reduces the risk of.
Progress at LAMPF, January--December 1991
International Nuclear Information System (INIS)
Poelakker, K.
1992-11-01
This report discusses research at the LAMPF accelerator in the following areas: Nuclear and particle physics; astrophysics; atomic and molecular physics; materials science; radiation effects; radioisotope production; theory; facility development; accelerator computer control system; radioactive beam facility - a new initiative; development of polarized 7 Li target material; LAMPF data analysis center (DAC); RF system development; environment, safety, and health; and accelerator operations
Utility FGD survey, January--December 1988
Energy Technology Data Exchange (ETDEWEB)
Hance, S.L.; McKibben, R.S.; Jones, F.M. (IT Corp., Cincinnati, OH (United States))
1991-09-01
The Utility FGD Survey report, which is generated by a computerized data base management system, represents a survey of operational and planned domestic utility flue gas desulfurization (FGD) systems. It summarizes information contributed by the utility industry, system and equipment suppliers, systems designers, research organizations, and regulatory agencies. The data cover system design, fuel characteristics, operating history, and actual system performance. Also included is a unit-by-unit discussion of problems and solutions associated with the boilers, scrubbers, and FGD systems. The development status (operational, under construction, or in the planning stages), system supplier, process, waste disposal practice, and regulatory class are tabulated alphabetically by utility company. Simplified process flow diagrams of FGD systems, definitions, and a glossary of terms are attached to the report. Current data for domestic FGD systems show systems in operation, systems under construction, and systems planned. The current total FGD-controlled capacity in the United States is 67,091 MW.
List of publications 1991 January-December
International Nuclear Information System (INIS)
1992-02-01
AECL Research is engaged in research and development related to the peaceful applications of nuclear energy. Specifically, the company's mission is to perform the research, development, demonstration and marketing required to apply nuclear sciences and their related technologies for the maximum benefit of Canada. Among our most important products are scientific reports, publications and conference presentations. This document lists our publications for 1991
Utility FGD Survey, January--December 1989
Energy Technology Data Exchange (ETDEWEB)
Hance, S.L.; McKibben, R.S.; Jones, F.M. (IT Corp., Cincinnati, OH (United States))
1992-03-01
The Utility flue gas desulfurization (FGD) Survey report, which is generated by a computerized data base management system, represents a survey of operational and planned domestic utility flue gas desulfurization (FGD) systems. It summarizes information contributed by the utility industry, system and equipment suppliers, system designers, research organizations, and regulatory agencies. The data cover system design, fuel characteristics, operating history, and actual system performance. Also included is a unit-by-unit discussion of problems and solutions associated with the boilers, scrubbers, and FGD systems. The development status (operational, under construction, or in the planning stages), system supplier, process, waste disposal practice, and regulatory class are tabulated alphabetically by utility company.
Progress at LAMPF, January--December 1990
International Nuclear Information System (INIS)
Poelakker, K.
1990-01-01
This report briefly discusses research conducted at the Lampf facility in the following areas: nuclear and particle physics; astrophysics; atomic and molecular physics; nuclear chemistry; radiation effects; radioisotopes production; accelerator operations and facility development
List of publications 1993 January - December
International Nuclear Information System (INIS)
1994-04-01
AECL research is engaged in research and development related to the peaceful applications of nuclear energy. Specifically, the company's mission is to perform the research, development, demonstration and marketing required to apply nuclear sciences and their related technologies for the maximum benefit of Canada. Among our most important products are scientific reports, publications and conference presentations. This document lists our publications for 1993. (author)
List of publications. 1992 January - December
International Nuclear Information System (INIS)
1993-04-01
AECL Research is engaged in research and development related to the peaceful applications of nuclear energy. Specifically, the company's mission is to perform the research, development, demonstration and marketing required to apply nuclear sciences and their related technologies for the maximum benefit of Canada. Among our most important products are scientific reports, publications and conference presentations. This document lists our publications for 1992. (author)
List of publications. 1992 January - December
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-04-01
AECL Research is engaged in research and development related to the peaceful applications of nuclear energy. Specifically, the company`s mission is to perform the research, development, demonstration and marketing required to apply nuclear sciences and their related technologies for the maximum benefit of Canada. Among our most important products are scientific reports, publications and conference presentations. This document lists our publications for 1992. (author).
List of publications 1993 January - December
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-04-01
AECL research is engaged in research and development related to the peaceful applications of nuclear energy. Specifically, the company`s mission is to perform the research, development, demonstration and marketing required to apply nuclear sciences and their related technologies for the maximum benefit of Canada. Among our most important products are scientific reports, publications and conference presentations. This document lists our publications for 1993. (author).
Utility FGD survey, January--December 1988
Energy Technology Data Exchange (ETDEWEB)
Hance, S.L.; McKibben, R.S.; Jones, F.M. (IT Corp., Cincinnati, OH (United States))
1991-09-01
The Utility FGD Survey report, which is generated by a computerized data base management system, represents a survey of operational and planned domestic utility flue gas desulfurization (FGD) systems. It summarizes information contributed by the utility industry, system and equipment suppliers, system designers, research organizations, and regulatory agencies. The data cover system design, fuel characteristics, operating history, and actual system performance. Also included is a unit-by-unit discussion of problems and solutions associated with the boilers, scrubbers, and FGD systems. The development status (operational, under construction, or in the planning stages), system supplier, process, waste disposal practice, and regulatory class are tabulated alphabetically by utility company. Simplified process flow diagrams of FGD systems, definitions, and a glossary of terms are attached to the report. Current data for domestic FGD systems show systems in operation, systems under construction, and systems planned. The current total FGD-controlled capacity in the United States is 67,091 MW.
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-07-01
This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility.
International Nuclear Information System (INIS)
1995-07-01
This journal includes all formal reports in the NUREG series prepared by the NRC staff and contractors; proceedings of conferences and workshops; as well as international agreement reports. The entries in this compilation are indexed for access by title and abstract, secondary report number, personal author, subject, NRC organization for staff and international agreements, contractor, international organization, and licensed facility
7 CFR 1280.103 - Certified organization.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Certified organization. 1280.103 Section 1280.103 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... organization. Certified organization means any organization which has been certified by the Secretary pursuant...
47 CFR 24.103 - Construction requirements.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Construction requirements. 24.103 Section 24.103 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PERSONAL... formula developed or generally used by industry, provided that such formula is based on the technical...
Chemical recovery of palladium-103 from irradiated silver target
International Nuclear Information System (INIS)
Lapshina, E.V.; Kokhanyuk, V.M.; Zhuikov, B.L.; Myasoedova, G.V.; Zakhartchenko, E.A.; Phillips, D.R.; Jamriska, D.J.
2003-01-01
The goal of this work is to develop an extraction method of no-carrier-added palladium-103 from silver. Metallic silver targets may be irradiated by protons with energy of 60-200 MeV or more to generate palladium-103 simultaneously with other radioactive isotopes of rhodium, ruthenium, technetium, palladium and silver. According to the dependence experimental production yield of Pd-103 and isotopes of other elements in thick silver target vs. Proton energy the most suitable energy for maximum yield of Pd-103 and minimum yield of other elements is from about 100 to about 140 MeV. Activity of radionuclides produced in silver target depends from many factors (target thickness, irradiation time, etc.). Two methods of Pd-103 recovering from irradiated silver target are considered in this work: (1) Silver target is dissolved in nitric acid followed by silver precipitation in the form of silver chloride by addition of HCl. The solution containing Pd, Rh and other radionuclides is passed through the layer of fibrous sorbent POLYORGS-15n. Then the sorbent is washed and Pd is desorbed by hot 12 M hydrochloric acid; (2) Silver target is dissolved in nitric acid followed by passing of the obtained solution (2 M HNO 3 ) through a disk set of complex forming sorbent POLYORGS-33n. Under these conditions palladium is sorbed by the sorbent while silver, rhodium, ruthenium and technetium are passed through the sorbent. Then the sorbent is washed with 2M nitric acid, and Pd is desorbed by 12 M hydrochloric acid. Extraction of palladium is occurred during the formation of palladium complex with a chelate sorbent specific to palladium in acidic solutions. Such a sorbent makes possible separation of palladium from accompanying radionuclides such as rhodium, ruthenium and technetium. The polymeric complex-forming sorbent of fibrous structure with the groups of 3(5)-methylpyrazole (POLYORGS-15) is used. The distinctive feature of the sorbents in the form of fibrous 'filled' material is
42 CFR 100.3 - Vaccine injury table.
2010-10-01
... respiratory distress, there may not be significant pathologic findings. (2) Encephalopathy. For purposes of... filed with the United States Court of Federal Claims on or after March 24, 1997. Petitions for... Act as in effect on January 1, 1995, or by § 100.3 as in effect on March 10, 1995 (see 60 FR 7678, et...
14 CFR 1251.103 - Discrimination prohibited.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Discrimination prohibited. 1251.103 Section... OF HANDICAP General Provisions § 1251.103 Discrimination prohibited. (a) General. No qualified... of, or otherwise be subjected to discrimination under any program or activity which receives Federal...
International Nuclear Information System (INIS)
Birdsall, C.K.
1989-01-01
This is a brief progress report, covering our research in general plasma theory and simulation, plasma-wall physics theory and simulation, and code development. Reports written in this period are included with this mailing. A publications list plus abstracts for two major meetings are included
38 CFR 13.103 - Investments by Federal fiduciaries.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Investments by Federal fiduciaries. 13.103 Section 13.103 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS VETERANS BENEFITS ADMINISTRATION, FIDUCIARY ACTIVITIES § 13.103 Investments by Federal fiduciaries. (a...
Analysis and dashboards on GRTgaz transmission activity - January-February 2016
International Nuclear Information System (INIS)
2017-01-01
GRTgaz is a European leader in natural gas transmission, a world expert in gas transmission networks and systems, and an operator firmly committed to the energy transition. It owns and operates the gas transmission network throughout most of France and it manages the transmission network in Germany, thereby helping to ensure correct operation of the French and European gas market. It contributes to the energy security of regional supply systems and performs a public service mission to ensure the continuity of consumer supply. This document presents the monthly key figures of GRTgaz activity in 2016: Shipper markets, Consumer markets; Transported quantities (GRTgaz network inputs and outputs, Monthly allocated quantities at PIR and PITTM); Consumptions (Gross monthly consumptions and average temperature, Gross consumptions and daily temperatures, Gross and climate-corrected consumptions for the public distributions, Industrial customers: consumptions by sectors of activity); GRTgaz customers (Key figures); Up-stream capacities (Capacities reserved on the Network Interface Points (PIR) and N/S and S/N links, Daily delivery service, Secondary capacities' market) Down-stream capacities (Industrial customers, Public distributions); Wholesale markets PEG (Volumes exchanged and number of exchanges at PEGs, Average price P1 by zones). Data in French cover the January-December period, while data in English cover the January-February 2016 period only
International Nuclear Information System (INIS)
Ragan, G.
2001-01-01
The purpose of the inventory abstraction, which has been prepared in accordance with a technical work plan (CRWMS M andO 2000e for/ICN--02 of the present analysis, and BSC 2001e for ICN 03 of the present analysis), is to: (1) Interpret the results of a series of relative dose calculations (CRWMS M andO 2000c, 2000f). (2) Recommend, including a basis thereof, a set of radionuclides that should be modeled in the Total System Performance Assessment in Support of the Site Recommendation (TSPA-SR) and the Total System Performance Assessment in Support of the Final Environmental Impact Statement (TSPA-FEIS). (3) Provide initial radionuclide inventories for the TSPA-SR and TSPA-FEIS models. (4) Answer the U.S. Nuclear Regulatory Commission (NRC)'s Issue Resolution Status Report ''Key Technical Issue: Container Life and Source Term'' (CLST IRSR) key technical issue (KTI): ''The rate at which radionuclides in SNF [spent nuclear fuel] are released from the EBS [engineered barrier system] through the oxidation and dissolution of spent fuel'' (NRC 1999, Subissue 3). The scope of the radionuclide screening analysis encompasses the period from 100 years to 10,000 years after the potential repository at Yucca Mountain is sealed for scenarios involving the breach of a waste package and subsequent degradation of the waste form as required for the TSPA-SR calculations. By extending the time period considered to one million years after repository closure, recommendations are made for the TSPA-FEIS. The waste forms included in the inventory abstraction are Commercial Spent Nuclear Fuel (CSNF), DOE Spent Nuclear Fuel (DSNF), High-Level Waste (HLW), naval Spent Nuclear Fuel (SNF), and U.S. Department of Energy (DOE) plutonium waste. The intended use of this analysis is in TSPA-SR and TSPA-FEIS. Based on the recommendations made here, models for release, transport, and possibly exposure will be developed for the isotopes that would be the highest contributors to the dose given a release
42 CFR 93.103 - Research misconduct.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Research misconduct. 93.103 Section 93.103 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...
DEFF Research Database (Denmark)
Demant, Jakob Johan; Laura Marie, Schierff
2016-01-01
version of the narrative synthesis approach described (Rodgers et al., 2009). The initial database used for the study consisted of 897 peer-reviewed academic articles published between January 2010 and December 2014 and retrieved from the databases Web of Science, PubMed, Sociological Abstracts and Psyc...
DOE patents available for licensing: a bibliography
International Nuclear Information System (INIS)
Thoeming, G.H.
1982-06-01
Abstracts and indexes are provided for 1344 DOE patents or patent applications concerning any aspect of energy production, conservation, and utilization. The entries are arranged by subject category as shown in the table of contents. The bibliography covers the period from January 1974 through December 1980
10 CFR 835.103 - Education, training and skills.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Education, training and skills. 835.103 Section 835.103... § 835.103 Education, training and skills. Individuals responsible for developing and implementing... education, training, and skills to discharge these responsibilities. [63 FR 59682, Nov. 4, 1998] ...
INL Seismic Monitoring Annual Report: January 1, 2011 - December 31, 2011
Energy Technology Data Exchange (ETDEWEB)
S. J. Payne; J. M. Hodges; R. G. Berg; D. F. Bruhn
2012-12-01
During 2011, the Idaho National Laboratory Seismic Monitoring Program evaluated 21,928 independent triggers that included earthquakes from around the world, the western United States, and local region of the Snake River Plain. Seismologists located 2,063 earthquakes and man-made blasts within and near the 161-km (or 100-mile) radius of the Idaho National Laboratory. Of these events, 16 were small-to-moderate size earthquakes ranging in magnitude (M) from 3.0 to 4.4. Within the 161-km radius, the majority of 941 earthquakes (M < 4.4) occurred in the active regions of the Basin and Range Province with only six microearthquakes occurring in the Snake River Plain. In the northern and southeastern Basin and Range, eight earthquake swarms occurred and included over 325 events. Five of the Snake River Plain earthquakes were located within and near the northern and southern ends of the Great Rift volcanic rift zone. All have anomalously deep focal depths (16 to 38 km) and waveforms indicative of fluid movement at mid- and lower-crustal levels and are a continuation of activity observed at Craters of the Moon National Monument since 2007. Since 1972, the Idaho National Laboratory has recorded 55 small-magnitude microearthquakes (M = 2.2) within the eastern Snake River Plain and 25 deep microearthquakes (M = 2.3) in the vicinity of Craters of the Moon National Monument.
EPOXI: Comet 103p/Hartley 2 Observations from a Worldwide Campaign
Meech, K. J.; Hearn, M. F. A.; Bauer, J. M.; Bonev, B. P.; Charnley, S. B.; DiSanti, M. A.; Gersch, A.; Immler, S. M.; Kaluna, H. M.; Keane, J. V.;
2011-01-01
Earth- and space-based observations provide synergistic information for space mission encounters by providing data over longer timescales. at different wavelengths and using techniques that are impossible with an in situ flyby. We report here such observations in support of the EPOXI spacecraft flyby of comet 103P (Hartley 2. The nucleus is small and dark, and exhibited a very rapidly changing rotation period. Prior to the onset of activity, the period was approximately 16.4 hr. Starting in 2010 August the period changed from 16.6 hr to near 19 hr in December. With respect to dust composition, most volatiles and carbon and nitrogen isotope ratios, the comet is similar to other Jupiter-family comets. What is unusual is the dominance of CO2-driven activity near perihelion, which likely persists out to aphelion. Near perihelion the comet nucleus was surrounded by a large halo of water-ice grains that contributed significantly to the total water production.
EPOXI: COMET 103P/HARTLEY 2 OBSERVATIONS FROM A WORLDWIDE CAMPAIGN
International Nuclear Information System (INIS)
Meech, K. J.; A'Hearn, M. F.; Bodewits, D.; Adams, J. A.; Bacci, P.; Bai, J.; Barrera, L.; Battelino, M.; Bauer, J. M.; Becklin, E.; Bhatt, B.; Biver, N.; Bockelee-Morvan, D.; Boehnhardt, H.; Boissier, J.; Bonev, B. P.; Borghini, W.; Brucato, J. R.; Bryssinck, E.; Buie, M. W.
2011-01-01
Earth- and space-based observations provide synergistic information for space mission encounters by providing data over longer timescales, at different wavelengths and using techniques that are impossible with an in situ flyby. We report here such observations in support of the EPOXI spacecraft flyby of comet 103P/Hartley 2. The nucleus is small and dark, and exhibited a very rapidly changing rotation period. Prior to the onset of activity, the period was ∼16.4 hr. Starting in 2010 August the period changed from 16.6 hr to near 19 hr in December. With respect to dust composition, most volatiles and carbon and nitrogen isotope ratios, the comet is similar to other Jupiter-family comets. What is unusual is the dominance of CO 2 -driven activity near perihelion, which likely persists out to aphelion. Near perihelion the comet nucleus was surrounded by a large halo of water-ice grains that contributed significantly to the total water production.
8 CFR 103.34 - Security of records systems.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Security of records systems. 103.34 Section 103.34 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS POWERS AND DUTIES; AVAILABILITY OF RECORDS § 103.34 Security of records systems. The security of records systems...
International Nuclear Information System (INIS)
Dudu, D.; Popa, V.; Racolta, P.M.; Tetcu, N.; Voiculescu, Dana
2001-01-01
Historically, 103 Pb, a short-lived isotope for permanent implant treatment of early stage prostate cancer, was generated via the 102 Pd(n,γ) 103 Pd reaction which relied on the availability of 1% naturally abundant 102 Pd in an enriched form and its moderately high neutron capture cross section. For the last 12 years, the accelerator production method for 103 Pd has been based on the irradiation of the rhodium metal with rather low energy protons via the reaction 103 Rh(p,n) 103 Pd. Big corporations from USA operate more than 10 dedicated accelerators to produce this nuclide. The prostate cancer market with 180,000 new cases reported annually justifies the effort for this radionuclide production. Recently, a manufacture in Europe also brought the USA patented type of 103 Pd seed implants on the world market. Our interest for this radioisotope production was started in 2000, as a result of the demand of two big hospitals from Bucharest and the opportunity to participate in a research programme (333-F2-RC 832) co-ordinated by the IAEA in Vienna. The U-120 Cyclotron, made in 1956 and brought from Russia, was quite a reliable machine. The accelerator is a classical cyclotron with adjustable energy. Now at the level of our technology, we can maintain it by ourselves and operate it quite independently. The experiments for the first year were focused on obtaining homemade data on cross-section, thick target yields and possible contaminants for the nuclear reaction 103 Rh (p,n) 103 Pb in the proton energy region 5-14 MeV. The experiments were performed at our Van de Graaff HV Tandem FN 15 accelerator (8 MV on terminal) by using proton beams up to 14 MeV with a current intensity of 100 nA. Design and adaptation of a dedicated beam line at IFIN-HH Cyclotron for the 103 production was a priority in our work planning for the first year
Photonuclear excitation of 103Rh by synchrotron radiation
International Nuclear Information System (INIS)
Yoshihara, Kenji; Kaji, Harumi; Sekine, Tsutomu; Mukoyama, Takeshi
1989-01-01
Photonuclear excitation of the 103 Rh nucleus was studied using synchrotron radiation. Formation of the excited state was confirmed by observing K X-rays emitted following the isomeric transition of the 103m Rh with a low-energy photon spectrometer. The intensity of induced activity due to 103 Rh(γ,γ') 103m Rh reaction was determined carefully by subtracting the fluorescent K X-rays due to natural background radiation. The integral cross-section for isomer production of 103m Rh by resonance absorption of photons at 295 keV is found to be (2.1±0.8) x 10 -28 cm 2 eV and is compared with that estimated from the previous experimental value for the 1277-keV level. (author)
Photonuclear excitation of 103Rh by synchrotron radiation
International Nuclear Information System (INIS)
Kaji, Harumi; Yoshihara, Kenji; Mukoyama, Takeshi; Nakajima, Tetsuo
1989-01-01
Photonuclear excitation of 103 Rh nucleus was studied by the use of synchrotron radiation at KEK. Formation of excited state was confirmed by observing Rh K X-rays emitted following the isomeric transition of 103m Rh with a low-energy photon spectrometer. The induced activity due to 103 Rh(γ,γ') 103m Rh reaction was determined carefully by subtracting the fluorescent K X-rays due to natural background radiation. The integral cross-section for 103m Rh by resonance absorption at 295 keV is found to be (1∼2)x10 -28 cm 2 ·eV and is compared with that estimated from the previous experimental value for the 1277-keV level and the calculated value
31 CFR 103.83 - Oral communications.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Oral communications. 103.83 Section... AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Administrative Rulings § 103.83 Oral communications... response to oral requests. Oral opinions or advice by Treasury, the Customs Service, the Internal Revenue...
24 CFR 954.103 - Housing strategy.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Housing strategy. 954.103 Section... INDIAN HOME PROGRAM Applying for Assistance § 954.103 Housing strategy. Grantees are not required to submit a housing strategy to receive HOME funds. However, the application must demonstrate how the...
International Nuclear Information System (INIS)
Wenzel, M.; Wu, Y.
1988-01-01
Ferrocene-Haloperidol was synthesized by N-alkylation of 4-(4'-chlorophenyl)-4-hydroxypiperidine with 1-ferrocenyl-4-chlor-butan-1-on. By heating the ferrocene-haloperidol with 103 RuCl 3 the 103 Ru-labelled ruthenocene-haloperidol was obtained. This compound showed a high affinity for lung but not for brain in rats and mice. The decay of the 103 Ru labelled compound results in the formation of the 103m Rh labelled rhodocene-haloperidol, which is rapidly oxidized by air to the corresponding rhodocinium-haloperidol. This compound can be separated by extraction and TLC. (author)
EIA publications directory 1997
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-04-01
This edition of the EIA Publications Directory contains 68 titles and abstracts of periodicals and one time reports produced by EIA from January through December 1997. The body of the Directory contains citations and abstracts arranged by broad subject categories; (1) MetaData, (2) Coal, (3) Oil (4) Natural gas, (5) Nuclear, (6) Electricity, (7) Renewable energy and Alternative fuels, (8) Multifuel, (9) End use consumption, (10) Models, and (11) Forecasts.
International Nuclear Information System (INIS)
Deigl, H.J.; Head, J.G.; Petesch, J.E.; Rogers, R.D.; Willits, B.W.
1984-03-01
Reactor utilization improved slightly from 1982 with increases seen in total number of irradiations, number of samples irradiated, and total experiment hours. Reactor operation of 94.6 MW-days for 1983 represents approximately a 1.4% increase over the previous year. Effective 1 September 1983 the operating schedule for the NSCR has been reduced to include only two fourteen hour shifts and three eight hour shifts per week unless special requests are made. An NSC Users Group has been created and meets periodically to discuss experimenter needs. Core VIII, established in December 1982, was used throughout 1983. Pulse operations were reinitiated in February 1983 for the first time since 1976, and a total of 75 pulses ($116.38 total pulse reactivity) were executed. A pulse test program to monitor peak core temperatures and to periodically inspect certain fuel elements was completed satisfactorily. Several major facility projects, modifications, and improvements were completed during the past year
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The 27 titles deal with a variety of topics, including the following: (1) instructional strategies in teaching synonyms, antonyms, classification, paraphrasing, and locating a main idea; (2) formal aspects of metaphor; (3) linguistic…
Energy Technology Data Exchange (ETDEWEB)
Haffmans, S.; De Lint, S.; Karsch, P. [Partners for Innovation, Amsterdam (Netherlands)
2012-02-15
The aim of the project 'Waste = Resource' is to give a boost to efficient and high-quality (re)use of raw materials and waste streams in the business sector of the harbor area of Amsterdam/Zaanstad, Netherlands. The objective was to set up at least four projects in the period 1 February 2011-31 January 2012. This final report summarizes the work performed, findings and results [Dutch] Het doel van het project 'Afval = Grondstof' is een impuls te geven aan een efficient en hoogwaardig (her)gebruik van grondstoffen en reststromen in het bedrijfsleven in de havenregio Amsterdam/Zaanstad. De doelstelling was om gedurende de projectperiode (1 februari 2011 - 31 januari 2012) minimaal vier projecten op te zetten, die passen binnen de doelstellingen van het programma en waarvan er minimaal twee met de realisatie gestart zijn. Dit eindrapport geeft een overzicht van de uitgevoerde werkzaamheden, bevindingen en de resultaten tot aan de einddatum van het project (eind januari 2012)
Materials of the 39 Polish Seminar on Nuclear Magnetic Resonance and Its Applications - Abstracts
International Nuclear Information System (INIS)
2006-01-01
The Report comprises abstracts of 78 communications presented during the 39 Polish Seminar on Nuclear Magnetic Resonance and Its Applications, held on November, 30 - December, 2006 in Cracow (PL). They cover a variety of research fields, including magnetic resonance imaging in vivo, applications of NMR spectroscopy to medical diagnosis, studies on molecular properties of different materials as well as quantum chemical calculations of NMR parameters
Tank 241-C-103 headspace flammability
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report
Tank 241-C-103 headspace flammability
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.
31 CFR 103.81 - Submitting requests.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Submitting requests. 103.81 Section 103.81 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING... which the request is made. (b) A request filed by a corporation shall be signed by a corporate officer...
19 CFR 191.103 - Additional requirements.
2010-04-01
... which the alcohol was withdrawn; (iv) Date of withdrawal; (v) Serial number of the tax-paid stamp or... 19 Customs Duties 2 2010-04-01 2010-04-01 false Additional requirements. 191.103 Section 191.103 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...
29 CFR 1918.103 - Head protection.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Head protection. 1918.103 Section 1918.103 Labor... must ensure that head protection complies with any of the following consensus standards: (i) ANSI Z89.1... as head protection devices that are constructed in accordance with one of the above consensus...
42 CFR 84.103 - Man tests; performance requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man tests; performance requirements. 84.103 Section 84.103 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Self-Contained Breathing Apparatus § 84.103 Man tests;...
7 CFR 762.103 - Full faith and credit.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Full faith and credit. 762.103 Section 762.103... AGRICULTURE SPECIAL PROGRAMS GUARANTEED FARM LOANS § 762.103 Full faith and credit. (a) Fraud and misrepresentation. The loan guarantee constitutes an obligation supported by the full faith and credit of the United...
From Abstract Art to Abstracted Artists
Directory of Open Access Journals (Sweden)
Romi Mikulinsky
2016-11-01
Full Text Available What lineage connects early abstract films and machine-generated YouTube videos? Hans Richter’s famous piece Rhythmus 21 is considered to be the first abstract film in the experimental tradition. The Webdriver Torso YouTube channel is composed of hundreds of thousands of machine-generated test patterns designed to check frequency signals on YouTube. This article discusses geometric abstraction vis-à-vis new vision, conceptual art and algorithmic art. It argues that the Webdriver Torso is an artistic marvel indicative of a form we call mathematical abstraction, which is art performed by computers and, quite possibly, for computers.
24 CFR 597.103 - Poverty rate.
2010-04-01
... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Poverty rate. 597.103 Section 597... Area Requirements § 597.103 Poverty rate. (a) General. The poverty rate shall be established in accordance with the following criteria: (1) In each census tract within a nominated urban area, the poverty...
Energy Technology Data Exchange (ETDEWEB)
Rowland, R. E.; Eddington, D. N. [eds.
1978-12-01
Ecological studies continue to focus on the determination of the effects of energy-related pollutants on planktonic species typical of the Great Lakes. Also included were experimental studies of the effects of enclosure size on the response of zooplankton to stress by cadmium. A new mobile field laboratory was constructed to support studies of the effects of water temperatures regimes on rates of accumulation by salmonid fishes of persistent organic contaminants such as PCB's. A significant new addition to the Great Lakes Research Program was marked by the arrival and formal acceptance of the new research vessel, the R/V Ekos. Descriptions of the Ekos and its research capabilities are included. A variety of studies of the behavior of transuranic elements conducted in environments as diverse as the Irish Sea, Great Slave Lake, the Great Miami River, and the Great Lakes, have focused on changes in the oxidation state of plutonium, and the effects these changes have on the behavior of this important element in the aquatic environment. Twenty-six sections of the report were abstracted and indexed individually for inclusion on ERA/EDB and those in scope for INIS. (JGB)
ERIC Clearinghouse on Reading and Communication Skills, Urbana, IL.
This collection of abstracts is part of a continuing series providing information on recent doctoral dissertations. The ten titles deal with the following topics: (1) an inductive method for teaching three skills necessary for reading narrative fiction; (2) the use of reading strategies in secondary level content area classrooms; (3) seventh grade…
Physics, Computer Science and Mathematics Division annual report, 1 January-31 December 1981
International Nuclear Information System (INIS)
Birge, R.W.
1982-12-01
This report summarizes the research performed in the Physics, Computer Science and Mathematics Division of the Lawrence Berkeley Laboratory during calendar year 1981. During the year under review the Division devoted roughly half its effort to the final construction stages of the Time Projection Chamber and other equipment for the PEP-4 facility at SLAC. The year was marked by the successful passage of milestone after milestone - the two-sector test of the TPC with cosmic rays in July 1981, the full TPC test in November 1981, and the roll-in onto the PEP beam line on 6 January 1982. In other e + e - experiments, the Mark II detector continued its productive data-taking at PEP. In other areas, the final stages of data analysis, particularly for the structure functions, proceeded for the inelastic muon scattering experiment performed at Fermilab, a muon polarimeter experiment was developed and mounted at TRIUMF to probe for the presence of right-handed currents in muon decay, and the design and then construction began of fine-grained hadron calorimeters for the end caps of the Colliding Detector Facility at Fermilab. The Particle Data Group intensified its activities, despite financial constraints, as it proceeded toward production of a new edition of its authoritative Review of Particle Properties early in 1982. During 1981 the Theoretical Physics Group pursued a diverse spectrum of research in its own right and also interacted effectively with the experimental program. Research and development continued on the segmented mirror for the ten-meter telescope proposed by the University of California. Activities in the Computer Science and Mathematics Department encompassed networking, database management, software engineering, and computer graphics, as well as basic research in nonlinear phenomena in combustion and fluid flow
Physics, Computer Science and Mathematics Division annual report, 1 January-31 December 1981
Energy Technology Data Exchange (ETDEWEB)
Birge, R.W.
1982-12-01
This report summarizes the research performed in the Physics, Computer Science and Mathematics Division of the Lawrence Berkeley Laboratory during calendar year 1981. During the year under review the Division devoted roughly half its effort to the final construction stages of the Time Projection Chamber and other equipment for the PEP-4 facility at SLAC. The year was marked by the successful passage of milestone after milestone - the two-sector test of the TPC with cosmic rays in July 1981, the full TPC test in November 1981, and the roll-in onto the PEP beam line on 6 January 1982. In other e/sup +/e/sup -/ experiments, the Mark II detector continued its productive data-taking at PEP. In other areas, the final stages of data analysis, particularly for the structure functions, proceeded for the inelastic muon scattering experiment performed at Fermilab, a muon polarimeter experiment was developed and mounted at TRIUMF to probe for the presence of right-handed currents in muon decay, and the design and then construction began of fine-grained hadron calorimeters for the end caps of the Colliding Detector Facility at Fermilab. The Particle Data Group intensified its activities, despite financial constraints, as it proceeded toward production of a new edition of its authoritative Review of Particle Properties early in 1982. During 1981 the Theoretical Physics Group pursued a diverse spectrum of research in its own right and also interacted effectively with the experimental program. Research and development continued on the segmented mirror for the ten-meter telescope proposed by the University of California. Activities in the Computer Science and Mathematics Department encompassed networking, database management, software engineering, and computer graphics, as well as basic research in nonlinear phenomena in combustion and fluid flow.
41 CFR 109-40.103-3 - International transportation.
2010-07-01
... transportation. 109-40.103-3 Section 109-40.103-3 Public Contracts and Property Management Federal Property..., TRANSPORTATION, AND MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.1-General Provision § 109-40.103-3 International transportation. See 4 CFR 52.2 for a certificate required in nonuse of U.S. flag vessels or U.S...
19 CFR 10.3 - Drawback; internal-revenue tax.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Drawback; internal-revenue tax. 10.3 Section 10.3... and Returned § 10.3 Drawback; internal-revenue tax. (a) Except as prescribed in § 10.1(f) or in... tax is imposed on the importation of like articles not previously exported from the United States or...