WorldWideScience

Sample records for absolute pitch ap

  1. Musical Activity Tunes Up Absolute Pitch Ability

    DEFF Research Database (Denmark)

    Dohn, Anders; Garza-Villarreal, Eduardo A.; Ribe, Lars Riisgaard

    2014-01-01

    Absolute pitch (AP) is the ability to identify or produce pitches of musical tones without an external reference. Active AP (i.e., pitch production or pitch adjustment) and passive AP (i.e., pitch identification) are considered to not necessarily coincide, although no study has properly compared...... that APs generally undershoot when adjusting musical pitch, a tendency that decreases when musical activity increases. Finally, APs are less accurate when adjusting the pitch to black key targets than to white key targets. Hence, AP ability may be partly practice-dependent and we speculate that APs may...

  2. Absolute pitch--electrophysiological evidence.

    Science.gov (United States)

    Barnea, A; Granot, R; Pratt, H

    1994-02-01

    People who have the ability to label or to produce notes without any reference are considered to possess Absolute Pitch (AP). Others, who need a reference in order to identify the notes, possess Relative Pitch (RP). The AP ability is assumed to reflect a unique, language-like representation of non-lexical musical notes in memory. The purpose of this study was to examine this assumption by comparing Event Related Potentials (ERP) of musicians with and without AP, to lexical and non-lexical representation of musical material. Subjects were eighteen young adult musicians. Seven were AP and eleven RP. Auditory stimuli, presented through earphones, were piano notes (non-lexical) or a voice saying the note's name (lexical). Visual stimuli, presented on a computer display were note symbols (non-lexical) or letters (lexical). Subjects performed a number of tasks, combining the two modalities (visual and auditory) and stimulus types (lexical and non-lexical), and reaction times (RT), performance accuracy and evoked potentials were recorded. The tasks forced the subjects to transfer mental representations of musical material from one mode to another. Our most important findings were the differences, between groups, in the scalp distribution of P300 amplitudes. We conclude that absolute pitch possessors use the same internal language as relative pitch possessors, when possible, but the distribution of the underlying brain activity is different between AP and RP subjects.

  3. The neurocognitive components of pitch processing: insights from absolute pitch.

    Science.gov (United States)

    Wilson, Sarah J; Lusher, Dean; Wan, Catherine Y; Dudgeon, Paul; Reutens, David C

    2009-03-01

    The natural variability of pitch naming ability in the population (known as absolute pitch or AP) provides an ideal method for investigating individual differences in pitch processing and auditory knowledge formation and representation. We have demonstrated the involvement of different cognitive processes in AP ability that reflects varying skill expertise in the presence of similar early age of onset of music tuition. These processes were related to different regions of brain activity, including those involved in pitch working memory (right prefrontal cortex) and the long-term representation of pitch (superior temporal gyrus). They reflected expertise through the use of context dependent pitch cues and the level of automaticity of pitch naming. They impart functional significance to structural asymmetry differences in the planum temporale of musicians and establish a neurobiological basis for an AP template. More generally, they indicate variability of knowledge representation in the presence of environmental fostering of early cognitive development that translates to differences in cognitive ability.

  4. A developmental study of latent absolute pitch memory.

    Science.gov (United States)

    Jakubowski, Kelly; Müllensiefen, Daniel; Stewart, Lauren

    2017-03-01

    The ability to recall the absolute pitch level of familiar music (latent absolute pitch memory) is widespread in adults, in contrast to the rare ability to label single pitches without a reference tone (overt absolute pitch memory). The present research investigated the developmental profile of latent absolute pitch (AP) memory and explored individual differences related to this ability. In two experiments, 288 children from 4 to12 years of age performed significantly above chance at recognizing the absolute pitch level of familiar melodies. No age-related improvement or decline, nor effects of musical training, gender, or familiarity with the stimuli were found in regard to latent AP task performance. These findings suggest that latent AP memory is a stable ability that is developed from as early as age 4 and persists into adulthood.

  5. Absolute Pitch: Effects of Timbre on Note-Naming Ability

    OpenAIRE

    Vanzella, Patr?cia; Schellenberg, E. Glenn

    2010-01-01

    Background Absolute pitch (AP) is the ability to identify or produce isolated musical tones. It is evident primarily among individuals who started music lessons in early childhood. Because AP requires memory for specific pitches as well as learned associations with verbal labels (i.e., note names), it represents a unique opportunity to study interactions in memory between linguistic and nonlinguistic information. One untested hypothesis is that the pitch of voices may be difficult for AP poss...

  6. Auditory working memory predicts individual differences in absolute pitch learning.

    Science.gov (United States)

    Van Hedger, Stephen C; Heald, Shannon L M; Koch, Rachelle; Nusbaum, Howard C

    2015-07-01

    Absolute pitch (AP) is typically defined as the ability to label an isolated tone as a musical note in the absence of a reference tone. At first glance the acquisition of AP note categories seems like a perceptual learning task, since individuals must assign a category label to a stimulus based on a single perceptual dimension (pitch) while ignoring other perceptual dimensions (e.g., loudness, octave, instrument). AP, however, is rarely discussed in terms of domain-general perceptual learning mechanisms. This is because AP is typically assumed to depend on a critical period of development, in which early exposure to pitches and musical labels is thought to be necessary for the development of AP precluding the possibility of adult acquisition of AP. Despite this view of AP, several previous studies have found evidence that absolute pitch category learning is, to an extent, trainable in a post-critical period adult population, even if the performance typically achieved by this population is below the performance of a "true" AP possessor. The current studies attempt to understand the individual differences in learning to categorize notes using absolute pitch cues by testing a specific prediction regarding cognitive capacity related to categorization - to what extent does an individual's general auditory working memory capacity (WMC) predict the success of absolute pitch category acquisition. Since WMC has been shown to predict performance on a wide variety of other perceptual and category learning tasks, we predict that individuals with higher WMC should be better at learning absolute pitch note categories than individuals with lower WMC. Across two studies, we demonstrate that auditory WMC predicts the efficacy of learning absolute pitch note categories. These results suggest that a higher general auditory WMC might underlie the formation of absolute pitch categories for post-critical period adults. Implications for understanding the mechanisms that underlie the

  7. Pitch and Plasticity: Insights from the Pitch Matching of Chords by Musicians with Absolute and Relative Pitch

    Directory of Open Access Journals (Sweden)

    Neil M. McLachlan

    2013-12-01

    Full Text Available Absolute pitch (AP is a form of sound recognition in which musical note names are associated with discrete musical pitch categories. The accuracy of pitch matching by non-AP musicians for chords has recently been shown to depend on stimulus familiarity, pointing to a role of spectral recognition mechanisms in the early stages of pitch processing. Here we show that pitch matching accuracy by AP musicians was also dependent on their familiarity with the chord stimulus. This suggests that the pitch matching abilities of both AP and non-AP musicians for concurrently presented pitches are dependent on initial recognition of the chord. The dual mechanism model of pitch perception previously proposed by the authors suggests that spectral processing associated with sound recognition primes waveform processing to extract stimulus periodicity and refine pitch perception. The findings presented in this paper are consistent with the dual mechanism model of pitch, and in the case of AP musicians, the formation of nominal pitch categories based on both spectral and periodicity information.

  8. The influence of music-elicited emotions and relative pitch on absolute pitch memory for familiar melodies.

    Science.gov (United States)

    Jakubowski, Kelly; Müllensiefen, Daniel

    2013-01-01

    Levitin's findings that nonmusicians could produce from memory the absolute pitches of self-selected pop songs have been widely cited in the music psychology literature. These findings suggest that latent absolute pitch (AP) memory may be a more widespread trait within the population than traditional AP labelling ability. However, it has been left unclear what factors may facilitate absolute pitch retention for familiar pieces of music. The aim of the present paper was to investigate factors that may contribute to latent AP memory using Levitin's sung production paradigm for AP memory and comparing results to the outcomes of a pitch labelling task, a relative pitch memory test, measures of music-induced emotions, and various measures of participants' musical backgrounds. Our results suggest that relative pitch memory and the quality and degree of music-elicited emotions impact on latent AP memory.

  9. Do individuals with Williams syndrome possess absolute pitch?

    Science.gov (United States)

    Martínez-Castilla, Pastora; Sotillo, María; Campos, Ruth

    2013-01-01

    Although absolute pitch (AP) is a rare skill in typical development, individuals with Williams syndrome (WS) are often referred to as possessing this musical ability. However, there is paucity of research on the topic. In this article, 2 studies were conducted to evaluate AP in WS. In Study 1, seven musically trained individuals with WS, 14 musically trained typically developing controls matched for chronological age, and 2 experienced musicians with AP completed a pitch-identification task. Although the task was a classical assessment of AP, it required participants to have musical knowledge, and the availability and accessibility of musically trained individuals with WS is very low. In Study 2, a paradigm suitable for evaluating AP in individuals without musical training was used, which made it possible to evaluate a larger group of participants with WS. A pitch memory test for isolated tones was presented to 27 individuals with WS, 54 typically developing peers matched for chronological age, and the 2 musicians with AP. Both individuals with WS and their controls obtained low results in the two studies. They showed an arbitrary pattern of response, and their performance was far from that of musicians with AP. Therefore, participants with WS did not appear to possess AP. Unlike what is usually claimed, results suggest that AP is not a remarkable ability in WS and that, as in the typically developing population, this musical ability is also rare in individuals with WS.

  10. Absolute pitch: effects of timbre on note-naming ability.

    Directory of Open Access Journals (Sweden)

    Patrícia Vanzella

    2010-11-01

    Full Text Available Absolute pitch (AP is the ability to identify or produce isolated musical tones. It is evident primarily among individuals who started music lessons in early childhood. Because AP requires memory for specific pitches as well as learned associations with verbal labels (i.e., note names, it represents a unique opportunity to study interactions in memory between linguistic and nonlinguistic information. One untested hypothesis is that the pitch of voices may be difficult for AP possessors to identify. A musician's first instrument may also affect performance and extend the sensitive period for acquiring accurate AP.A large sample of AP possessors was recruited on-line. Participants were required to identity test tones presented in four different timbres: piano, pure tone, natural (sung voice, and synthesized voice. Note-naming accuracy was better for non-vocal (piano and pure tones than for vocal (natural and synthesized voices test tones. This difference could not be attributed solely to vibrato (pitch variation, which was more pronounced in the natural voice than in the synthesized voice. Although starting music lessons by age 7 was associated with enhanced note-naming accuracy, equivalent abilities were evident among listeners who started music lessons on piano at a later age.Because the human voice is inextricably linked to language and meaning, it may be processed automatically by voice-specific mechanisms that interfere with note naming among AP possessors. Lessons on piano or other fixed-pitch instruments appear to enhance AP abilities and to extend the sensitive period for exposure to music in order to develop accurate AP.

  11. Absolute pitch: effects of timbre on note-naming ability.

    Science.gov (United States)

    Vanzella, Patrícia; Schellenberg, E Glenn

    2010-11-11

    Absolute pitch (AP) is the ability to identify or produce isolated musical tones. It is evident primarily among individuals who started music lessons in early childhood. Because AP requires memory for specific pitches as well as learned associations with verbal labels (i.e., note names), it represents a unique opportunity to study interactions in memory between linguistic and nonlinguistic information. One untested hypothesis is that the pitch of voices may be difficult for AP possessors to identify. A musician's first instrument may also affect performance and extend the sensitive period for acquiring accurate AP. A large sample of AP possessors was recruited on-line. Participants were required to identity test tones presented in four different timbres: piano, pure tone, natural (sung) voice, and synthesized voice. Note-naming accuracy was better for non-vocal (piano and pure tones) than for vocal (natural and synthesized voices) test tones. This difference could not be attributed solely to vibrato (pitch variation), which was more pronounced in the natural voice than in the synthesized voice. Although starting music lessons by age 7 was associated with enhanced note-naming accuracy, equivalent abilities were evident among listeners who started music lessons on piano at a later age. Because the human voice is inextricably linked to language and meaning, it may be processed automatically by voice-specific mechanisms that interfere with note naming among AP possessors. Lessons on piano or other fixed-pitch instruments appear to enhance AP abilities and to extend the sensitive period for exposure to music in order to develop accurate AP.

  12. Preservation of absolute pitch after right amygdalohippocampectomy for a pianist with TLE.

    Science.gov (United States)

    Suriadi, Meilia M; Usui, Keiko; Tottori, Takayasu; Terada, Kiyohito; Fujitani, Shigeru; Umeoka, Shuichi; Usui, Naotaka; Baba, Kouichi; Matsuda, Kazumi; Inoue, Yushi

    2015-01-01

    Absolute pitch (AP) ability is a rare musical phenomenon. In the literature, it has been suggested that the relative specialization for pitch processing is in the right temporal lobe in the non-AP population. Since the anatomic basis for absolute pitch is not fully understood and cases of temporal lobe epilepsy of AP possessors are extremely rare, applicability of resection as a treatment of epilepsy in this particular area should be evaluated with caution. In the present study, we examined an AP possessor who suffered from medically refractory temporal lobe epilepsy and underwent right selective amygdalohippocampectomy (SAH). The SAH procedure clearly avoided disturbing important structures for AP, inasmuch as postsurgically she preserved her AP ability and was seizure-free. She did well post-operatively in the test of pure sine wave tones with short reaction time, which could be identified as "true" absolute pitch. Copyright © 2014 Elsevier Inc. All rights reserved.

  13. A nonmusical paradigm for identifying absolute pitch possessors

    Science.gov (United States)

    Ross, David A.; Olson, Ingrid R.; Marks, Lawrence E.; Gore, John C.

    2004-09-01

    The ability to identify and reproduce sounds of specific frequencies is remarkable and uncommon. The etiology and defining characteristics of this skill, absolute pitch (AP), have been very controversial. One theory suggests that AP requires a specific type of early musical training and that the ability to encode and remember tones depends on these learned musical associations. An alternate theory argues that AP may be strongly dependent on hereditary factors and relatively independent of musical experience. To date, it has been difficult to test these hypotheses because all previous paradigms for identifying AP have required subjects to employ knowledge of musical nomenclature. As such, these tests are insensitive to the possibility of discovering AP in either nonmusicians or musicians of non-Western training. Based on previous literature in pitch memory, a paradigm is presented that is intended to distinguish between AP possessors and nonpossessors independent of the subjects' musical experience. The efficacy of this method is then tested with 20 classically defined AP possessors and 22 nonpossessors. Data from these groups strongly support the validity of the paradigm. The use of a nonmusical paradigm to identify AP may facilitate research into many aspects of this phenomenon.

  14. Left-hemisphere activation is associated with enhanced vocal pitch error detection in musicians with absolute pitch.

    Science.gov (United States)

    Behroozmand, Roozbeh; Ibrahim, Nadine; Korzyukov, Oleg; Robin, Donald A; Larson, Charles R

    2014-02-01

    The ability to process auditory feedback for vocal pitch control is crucial during speaking and singing. Previous studies have suggested that musicians with absolute pitch (AP) develop specialized left-hemisphere mechanisms for pitch processing. The present study adopted an auditory feedback pitch perturbation paradigm combined with ERP recordings to test the hypothesis whether the neural mechanisms of the left-hemisphere enhance vocal pitch error detection and control in AP musicians compared with relative pitch (RP) musicians and non-musicians (NM). Results showed a stronger N1 response to pitch-shifted voice feedback in the right-hemisphere for both AP and RP musicians compared with the NM group. However, the left-hemisphere P2 component activation was greater in AP and RP musicians compared with NMs and also for the AP compared with RP musicians. The NM group was slower in generating compensatory vocal reactions to feedback pitch perturbation compared with musicians, and they failed to re-adjust their vocal pitch after the feedback perturbation was removed. These findings suggest that in the earlier stages of cortical neural processing, the right hemisphere is more active in musicians for detecting pitch changes in voice feedback. In the later stages, the left-hemisphere is more active during the processing of auditory feedback for vocal motor control and seems to involve specialized mechanisms that facilitate pitch processing in the AP compared with RP musicians. These findings indicate that the left hemisphere mechanisms of AP ability are associated with improved auditory feedback pitch processing during vocal pitch control in tasks such as speaking or singing. Copyright © 2013 Elsevier Inc. All rights reserved.

  15. Audio-visual interactions uniquely contribute to resolution of visual conflict in people possessing absolute pitch.

    Directory of Open Access Journals (Sweden)

    Sujin Kim

    Full Text Available Individuals possessing absolute pitch (AP are able to identify a given musical tone or to reproduce it without reference to another tone. The present study sought to learn whether this exceptional auditory ability impacts visual perception under stimulus conditions that provoke visual competition in the form of binocular rivalry. Nineteen adult participants with 3-19 years of musical training were divided into two groups according to their performance on a task involving identification of the specific note associated with hearing a given musical pitch. During test trials lasting just over half a minute, participants dichoptically viewed a scrolling musical score presented to one eye and a drifting sinusoidal grating presented to the other eye; throughout the trial they pressed buttons to track the alternations in visual awareness produced by these dissimilar monocular stimuli. On "pitch-congruent" trials, participants heard an auditory melody that was congruent in pitch with the visual score, on "pitch-incongruent" trials they heard a transposed auditory melody that was congruent with the score in melody but not in pitch, and on "melody-incongruent" trials they heard an auditory melody completely different from the visual score. For both groups, the visual musical scores predominated over the gratings when the auditory melody was congruent compared to when it was incongruent. Moreover, the AP participants experienced greater predominance of the visual score when it was accompanied by the pitch-congruent melody compared to the same melody transposed in pitch; for non-AP musicians, pitch-congruent and pitch-incongruent trials yielded equivalent predominance. Analysis of individual durations of dominance revealed differential effects on dominance and suppression durations for AP and non-AP participants. These results reveal that AP is accompanied by a robust form of bisensory interaction between tonal frequencies and musical notation that boosts

  16. Intracortical myelination in musicians with absolute pitch: Quantitative morphometry using 7‐T MRI

    Science.gov (United States)

    Knösche, Thomas R.

    2016-01-01

    Abstract Absolute pitch (AP) is known as the ability to recognize and label the pitch chroma of a given tone without external reference. Known brain structures and functions related to AP are mainly of macroscopic aspects. To shed light on the underlying neural mechanism of AP, we investigated the intracortical myeloarchitecture in musicians with and without AP using the quantitative mapping of the longitudinal relaxation rates with ultra‐high‐field magnetic resonance imaging at 7 T. We found greater intracortical myelination for AP musicians in the anterior region of the supratemporal plane, particularly the medial region of the right planum polare (PP). In the same region of the right PP, we also found a positive correlation with a behavioral index of AP performance. In addition, we found a positive correlation with a frequency discrimination threshold in the anterolateral Heschl's gyrus in the right hemisphere, demonstrating distinctive neural processes of absolute recognition and relative discrimination of pitch. Regarding possible effects of local myelination in the cortex and the known importance of the anterior superior temporal gyrus/sulcus for the identification of auditory objects, we argue that pitch chroma may be processed as an identifiable object property in AP musicians. Hum Brain Mapp 37:3486–3501, 2016. © 2016 Wiley Periodicals, Inc. PMID:27160707

  17. Intracortical myelination in musicians with absolute pitch: Quantitative morphometry using 7-T MRI.

    Science.gov (United States)

    Kim, Seung-Goo; Knösche, Thomas R

    2016-10-01

    Absolute pitch (AP) is known as the ability to recognize and label the pitch chroma of a given tone without external reference. Known brain structures and functions related to AP are mainly of macroscopic aspects. To shed light on the underlying neural mechanism of AP, we investigated the intracortical myeloarchitecture in musicians with and without AP using the quantitative mapping of the longitudinal relaxation rates with ultra-high-field magnetic resonance imaging at 7 T. We found greater intracortical myelination for AP musicians in the anterior region of the supratemporal plane, particularly the medial region of the right planum polare (PP). In the same region of the right PP, we also found a positive correlation with a behavioral index of AP performance. In addition, we found a positive correlation with a frequency discrimination threshold in the anterolateral Heschl's gyrus in the right hemisphere, demonstrating distinctive neural processes of absolute recognition and relative discrimination of pitch. Regarding possible effects of local myelination in the cortex and the known importance of the anterior superior temporal gyrus/sulcus for the identification of auditory objects, we argue that pitch chroma may be processed as an identifiable object property in AP musicians. Hum Brain Mapp 37:3486-3501, 2016. © 2016 Wiley Periodicals, Inc. © 2016 The Authors Human Brain Mapping Published by Wiley Periodicals, Inc.

  18. Absolute pitch memory: its prevalence among musicians and dependence on the testing context.

    Science.gov (United States)

    Wong, Yetta Kwailing; Wong, Alan C-N

    2014-04-01

    Absolute pitch (AP) is widely believed to be a rare ability possessed by only a small group of gifted and special individuals (AP possessors). While AP has fascinated psychologists, neuroscientists, and musicians for more than a century, no theory can satisfactorily explain why this ability is so rare and difficult to learn. Here, we show that AP ability appears rare because of the methodological issues of the standard pitch-naming test. Specifically, the standard test unnecessarily poses a high decisional demand on AP judgments and uses a testing context that is highly inconsistent with one's musical training. These extra cognitive challenges are not central to AP memory per se and have thus led to consistent underestimation of AP ability in the population. Using the standard test, we replicated the typical findings that the accuracy for general violinists was low (12.38 %; chance level = 0 %). With identical stimuli, scoring criteria, and participants, violinists attained 25 % accuracy in a pitch verification test in which the decisional demand of AP judgment was reduced. When the testing context was increasingly similar to their musical experience, verification accuracy improved further and reached 39 %, three times higher than that for the standard test. Results were replicated with a separate group of pianists. Our findings challenge current theories about AP and suggest that the prevalence of AP among musicians has been highly underestimated in prior work. A multimodal framework is proposed to better explain AP memory.

  19. Bridging the gap between perceptual and cognitive perspectives on absolute pitch.

    Science.gov (United States)

    Elmer, Stefan; Rogenmoser, Lars; Kühnis, Jürg; Jäncke, Lutz

    2015-01-07

    Absolute pitch (AP) refers to the rare ability to identify the chroma of a tone or to produce a specific pitch without reference to keyality (e.g., G or C). Previously, AP has been proposed to rely on the distinctive functional-anatomical architecture of the left auditory-related cortex (ARC), this specific trait possibly enabling an optimized early "categorical perception". In contrast, currently prevailing models of AP postulate that cognitive rather than perceptual processes, namely "pitch labeling" mechanisms, more likely constitute the bearing skeleton of AP. This associative memory component has previously been proposed to be dependent, among other mechanisms, on the recruitment of the left dorsolateral prefrontal cortex (DLPFC) as well as on the integrity of the left arcuate fasciculus, a fiber bundle linking the posterior supratemporal plane with the DLPFC. Here, we attempted to integrate these two apparently conflicting perspectives on AP, namely early "categorical perception" and "pitch labeling". We used electroencephalography and evaluated resting-state intracranial functional connectivity between the left ARC and DLPFC in a sample of musicians with and without AP. Results demonstrate significantly increased left-hemispheric theta phase synchronization in AP compared with non-AP musicians. Within the AP group, this specific electrophysiological marker was predictive of absolute-hearing behavior and explained ∼30% of variance. Thus, we propose that in AP subjects the tonal inputs and the corresponding mnemonic representations are tightly coupled in such a manner that the distinctive electrophysiological signature of AP can saliently be detected in only 3 min of resting-state measurements. Copyright © 2015 the authors 0270-6474/15/350366-06$15.00/0.

  20. Diminished whole-brain but enhanced peri-sylvian connectivity in absolute pitch musicians.

    Science.gov (United States)

    Jäncke, Lutz; Langer, Nicolas; Hänggi, Jürgen

    2012-06-01

    Several anatomical studies have identified specific anatomical features within the peri-sylvian brain system of absolute pitch (AP) musicians. In this study we used graph theoretical analysis of cortical thickness covariations (as indirect indicator of connectivity) to examine whether AP musicians differ from relative pitch musicians and nonmusicians in small-world network characteristics. We measured "local connectedness" (local clustering = γ), "global efficiency of information transfer" (path length = λ), "small-worldness" (σ = γ/λ), and "degree" centrality as measures of connectivity. Although all groups demonstrated typical small-world features, AP musicians showed significant small-world alterations. "Degree" as a measure of interconnectedness was globally significantly decreased in AP musicians. These differences let us suggest that AP musicians demonstrate diminished neural integration (less connections) among distant brain regions. In addition, AP musicians demonstrated significantly increased local connectivity in peri-sylvian language areas of which the planum temporale, planum polare, Heschl's gyrus, lateral aspect of the superior temporal gyrus, STS, pars triangularis, and pars opercularis were hub regions. All of these brain areas are known to be involved in higher-order auditory processing, working or semantic memory processes. Taken together, whereas AP musicians demonstrate decreased global interconnectedness, the local connectedness in peri-sylvian brain areas is significantly higher than for relative pitch musicians and nonmusicians.

  1. Resting state functional connectivity of the ventral auditory pathway in musicians with absolute pitch.

    Science.gov (United States)

    Kim, Seung-Goo; Knösche, Thomas R

    2017-08-01

    Absolute pitch (AP) is the ability to recognize pitch chroma of tonal sound without external references, providing a unique model of the human auditory system (Zatorre: Nat Neurosci 6 () 692-695). In a previous study (Kim and Knösche: Hum Brain Mapp () 3486-3501), we identified enhanced intracortical myelination in the right planum polare (PP) in musicians with AP, which could be a potential site for perceptional processing of pitch chroma information. We speculated that this area, which initiates the ventral auditory pathway, might be crucially involved in the perceptual stage of the AP process in the context of the "dual pathway hypothesis" that suggests the role of the ventral pathway in processing nonspatial information related to the identity of an auditory object (Rauschecker: Eur J Neurosci 41 () 579-585). To test our conjecture on the ventral pathway, we investigated resting state functional connectivity (RSFC) using functional magnetic resonance imaging (fMRI) from musicians with varying degrees of AP. Should our hypothesis be correct, RSFC via the ventral pathway is expected to be stronger in musicians with AP, whereas such group effect is not predicted in the RSFC via the dorsal pathway. In the current data, we found greater RSFC between the right PP and bilateral anteroventral auditory cortices in musicians with AP. In contrast, we did not find any group difference in the RSFC of the planum temporale (PT) between musicians with and without AP. We believe that these findings support our conjecture on the critical role of the ventral pathway in AP recognition. Hum Brain Mapp 38:3899-3916, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  2. Enhancement of speech-relevant auditory acuity in absolute pitch possessors

    Directory of Open Access Journals (Sweden)

    Nobuo eMasataka

    2011-05-01

    Full Text Available AbstractAbsolute pitch (AP is the ability to identify the frequency or musical name of a specific tone, or to identify a tone without comparing it with any objective reference tone. While AP has recently been shown to be associated with morphological changes and neurophysiological adaptations in the planum temporale, a cortical area in the brain involved in speech perception processes, no behavioral evidence of speech-relevant auditory acuity in any AP possessors has hitherto been reported. In order to seek such evidence, in the present study, 15 professional musicians with AP and 14 without AP, all of whom had acquired Japanese as their first language, were asked to identify isolated Japanese syllables as quickly as possible after these syllables were presented auditorily. When the mean latency to the syllable identification was compared, it was significantly shorter in AP possessors than in non-AP possessors whether the presented syllables were those used as Japanese labels representing the 7 tones constituting an octave or not. The latency to hear the stimuli per se did not differ according to whether the participants were AP possessors or not. The results indicate the possibility that possessing AP provides one with extraordinarily enhanced acuity to individual syllables per se as fundamental units of a segmented word in the speech stream.

  3. Multiple coding strategies in the retention of musical tones by possessors of absolute pitch.

    Science.gov (United States)

    Zatorre, R J; Beckett, C

    1989-09-01

    Eighteen musicians with absolute pitch (AP) confirmed by screening tests participated in tonal and verbal short-term-retention tasks. In the tonal task, subjects identified three successive piano tones by their letter names. Recall of these note names after 18 sec of counting backwards was near perfect. Recall after an 18-sec delay filled with random piano tones was also near perfect. In contrast, the same subjects demonstrated significant forgetting when required to retain letter trigrams while counting backwards for 18 sec. These results were essentially replicated in a second experiment using longer (27 sec) retention intervals, a more demanding verbal interference task, and an active musical interference task (singing a descending scale). We interpret these results as indicating that retention of note names by possessors of AP is not limited to verbal encoding; rather, multiple codes (e.g., auditory, kinesthetic, and visual imagery) are probably used.

  4. Effects of musical training and absolute pitch ability on event-related activity in response to sine tones.

    Science.gov (United States)

    Wayman, J W; Frisina, R D; Walton, J P; Hantz, E C; Crummer, G C

    1992-06-01

    The neural correlates of music perception have received relatively little scientific attention. The neural activity of listeners without musical training (N = 11), highly trained musicians (N = 14), and musicians possessing "absolute pitch" (AP) ability (N = 10) have been measured. Major differences were observed in the P3, an endogenous event-related potential (ERP), which is thought to be a neurophysiological manifestation of working memory processing. The P3 was elicited using the classical "oddball" paradigm with a sine-tone series. Subjects' musical backgrounds were evaluated with a survey questionnaire. AP ability was verified with an objective pitch identification test. The P3 amplitude, latency and wave shape were evaluated along with each subjects' performance score and musical background. The AP subjects showed a significantly smaller P3 amplitude than either the musicians or nonmusicians, which were nearly identical. The P3 latency was shortest for the AP subjects, and was longer for the nonmusicians. Performance scores were uniformly high in all three groups. It is concluded that AP subjects do indeed exhibit P3 ERPs, albeit with smaller amplitudes and shorter latencies. The differences in neural activity between the musicians and AP subjects were not due to musical training, as the AP subjects had similar musical backgrounds to the musician group. It is also concluded that persons with the AP ability may have superior auditory sensitivity at cortical levels and/or use unique neuropsychological strategies when processing tones.

  5. Gray- and White-Matter Anatomy of Absolute Pitch Possessors

    DEFF Research Database (Denmark)

    Dohn, Anders; Garza-Villarreal, Eduardo A.; Chakravarty, Mallar

    2015-01-01

    structural differences in brains of musicians with and without AP, by means of whole brain vertex- wise cortical thickness analysis and tract-based spatial statistics (TBSS) analysis. AP possessors (APs) displayed increased cortical thickness in a number of areas including the left superior temporal gyrus...... studies indicating an increased left lateralized posterior superior temporal gyrus in APs, yet they differ from previous findings of thinner cortex for a number of areas in APs. Finally, we found a correlation between the white matter cluster and the right parahippocampal gyrus. This is a novel finding......, the left inferior frontal gyrus, and the right supramarginal gyrus. Furthermore, we found increased fractional anisotropy in APs within the path of the inferior fronto-occipital fasciculus, the uncinate fasciculus and the inferior longitudinal fasciculus. The findings in gray matter support previous...

  6. Absolute Pitch in Oral Transmission of Folk Tunes as Constrained Random Walks

    Directory of Open Access Journals (Sweden)

    Klaus Frieler

    2015-12-01

    Full Text Available In this commentary, I would like to add a few of our own, still unpublished, empirical observations concerning the possible role of absolute pitch memory (APM in the oral transmission of folksongs. This empirical data poses some questions about the likelihood of the observed inter-recording tonic pitch consistency of Olthof, Janssen & Honing (2015 and how these observations could come about. Based on simulations of absolute pitch class of tonics during oral transmission of folk songs, I argue that the interplay of melodic range and vocal range might actually be the main reason for the observed non-uniformity, in contrast to the conclusions presented in Olthof et al. (2015. However, this does not invalidate the therein-presented evidence, but makes the case more puzzling, consequently calling for more empirical research on the interaction of melodic and vocal range and latent APM as well as for more detailed modeling of oral transmission of folk songs.

  7. Conditional associative memory for musical stimuli in nonmusicians: implications for absolute pitch.

    Science.gov (United States)

    Bermudez, Patrick; Zatorre, Robert J

    2005-08-24

    A previous positron emission tomography (PET) study of musicians with and without absolute pitch put forth the hypothesis that the posterior dorsolateral prefrontal cortex is involved in the conditional associative aspect of the identification of a pitch. In the work presented here, we tested this hypothesis by training eight nonmusicians to associate each of four different complex musical sounds (triad chords) with an arbitrary number in a task designed to have limited analogy to absolute-pitch identification. Each subject under-went a functional magnetic resonance imaging scanning procedure both before and after training. Active condition (identification of chords)-control condition (amplitude-matched noise bursts) comparisons for the pretraining scan showed no significant activation maxima. The same comparison for the posttraining scan revealed significant peaks of activation in posterior dorsolateral prefrontal, ventrolateral prefrontal, and parietal areas. A conjunction analysis was performed to show that the posterior dorsolateral prefrontal activity in this study is similar to that observed in the aforementioned PET study. We conclude that the posterior dorsolateral prefrontal cortex is selectively involved in the conditional association aspect of our task, as it is in the attribution of a verbal label to a note by absolute-pitch musicians.

  8. Veridical mapping in savant abilities, absolute pitch, and synesthesia: An autism case study

    Directory of Open Access Journals (Sweden)

    Lucie eBouvet

    2014-02-01

    Full Text Available An enhanced role and autonomy of perception are prominent in autism. Furthermore, savant abilities, absolute pitch, and synesthesia are all more commonly found in autistic individuals than in the typical population. The mechanism of veridical mapping has been proposed to account for how enhanced perception in autism leads to the high prevalence of these three phenomena and their structural similarity. Veridical mapping entails functional rededication of perceptual brain regions to higher order cognitive operations, allowing the enhanced detection and memorization of isomorphisms between perceptual and non-perceptual structures across multiple scales. In this paper, we present FC, an autistic individual who possesses several savant abilities in addition to both absolute pitch and synesthesia-like associations. The co-occurrence in FC of abilities, some of them rare, which share the same structure, as well as FC’s own accounts of their development, together suggest the importance of veridical mapping in the atypical range and nature of abilities displayed by autistic people.

  9. Pitch memory and exposure effects.

    OpenAIRE

    Ben-Haim, Moshe Shay; Eitan, Zohar; Chajut, Eran

    2014-01-01

    Recent studies indicate that the ability to represent absolute pitch values in long-term memory (LTM), long believed to be the possession of a small minority of trained musicians endowed with "absolute pitch" (AP), is in fact shared to some extent by a considerable proportion of the population. The current study examined whether this newly-discovered ability affects aspects of music and auditory cognition, particularly pitch learning and evaluation. Our starting points are two well establishe...

  10. Do Musicians with Perfect Pitch Have More Autism Traits than Musicians without Perfect Pitch? An Empirical Study

    DEFF Research Database (Denmark)

    Dohn, Anders; Garza-Villarreal, Eduardo A.; Heaton, Pamela

    2012-01-01

    Perfect pitch, also known as absolute pitch (AP), refers to the rare ability to identify or produce a musical tone correctly without the benefit of an external reference. AP is often considered to reflect musical giftedness, but it has also been associated with certain disabilities due to increased...... (APs), 18 musicians without AP (non-APs), and 16 non-musicians. In addition, we measured AP ability by a pitch identification test with sine wave tones and piano tones. We found a significantly higher degree of autism traits in APs than in non-APs and non-musicians, and autism scores were significantly...

  11. Do musicians with perfect pitch have more autism traits than musicians without perfect pitch? An empirical study.

    Science.gov (United States)

    Dohn, Anders; Garza-Villarreal, Eduardo A; Heaton, Pamela; Vuust, Peter

    2012-01-01

    Perfect pitch, also known as absolute pitch (AP), refers to the rare ability to identify or produce a musical tone correctly without the benefit of an external reference. AP is often considered to reflect musical giftedness, but it has also been associated with certain disabilities due to increased prevalence of AP in individuals with sensory and developmental disorders. Here, we determine whether individual autistic traits are present in people with AP. We quantified subclinical levels of autism traits using the Autism-Spectrum Quotient (AQ) in three matched groups of subjects: 16 musicians with AP (APs), 18 musicians without AP (non-APs), and 16 non-musicians. In addition, we measured AP ability by a pitch identification test with sine wave tones and piano tones. We found a significantly higher degree of autism traits in APs than in non-APs and non-musicians, and autism scores were significantly correlated with pitch identification scores (r = .46, p = .003). However, our results showed that APs did not differ from non-APs on diagnostically crucial social and communicative domain scores and their total AQ scores were well below clinical thresholds for autism. Group differences emerged on the imagination and attention switching subscales of the AQ. Thus, whilst these findings do link AP with autism, they also show that AP ability is most strongly associated with personality traits that vary widely within the normal population.

  12. Pitch memory and exposure effects.

    Science.gov (United States)

    Ben-Haim, Moshe Shay; Eitan, Zohar; Chajut, Eran

    2014-02-01

    Recent studies indicate that the ability to represent absolute pitch values in long-term memory, long believed to be the possession of a small minority of trained musicians endowed with "absolute pitch," is in fact shared to some extent by a considerable proportion of the population. The current study examined whether this newly discovered ability affects aspects of music and auditory cognition, particularly pitch learning and evaluation. Our starting points are two well-established premises: (1) frequency of occurrence has an influence on the way we process stimuli; (2) in Western music, some pitches and musical keys are much more frequent than others. Based on these premises, we hypothesize that if absolute pitch values are indeed represented in long-term memory, pitch frequency of occurrence in music would significantly affect cognitive processes, in particular pitch learning and evaluation. Two experiments were designed to test this hypothesis in participants with no absolute pitch, most with little or no musical training. Experiment 1 demonstrated a faster response and a learning advantage for frequent pitches over infrequent pitches in an identification task. In Experiment 2, participants evaluated infrequent pitches as more pleasing than frequent pitches when presented in isolation. These results suggest that absolute pitch representation in memory may play a substantial, hitherto unacknowledged role in auditory (and specifically musical) cognition. PsycINFO Database Record (c) 2014 APA, all rights reserved.

  13. New insights into the effects of styrene-butadiene-styrene polymer modifier on the structure, properties, and performance of asphalt binder: The case of AP-5 asphalt and solvent deasphalting pitch

    Energy Technology Data Exchange (ETDEWEB)

    Nciri, Nader, E-mail: nader.nciri@koreatech.ac.kr [Department of Energy, Materials, and Chemical Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of); Kim, Namho [Department of Architectural Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of); Cho, Namjun, E-mail: njuncho@koreatech.ac.kr [Department of Energy, Materials, and Chemical Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of)

    2017-06-01

    This paper deals with the poorly understood effects of styrene-butadiene-styrene (SBS) copolymer on the bitumen performance. It focuses on determining the impact of various concentrations (e.g., 0, 4, 8, and 12 wt. %) of SBS on the attributes of two types of asphalt namely AP-5 asphalt and solvent deasphalting (SDA) pitch. The unmodified and modified binders were investigated in terms of their chemical compositions, microstructures, thermo-analytical behaviors, and physical properties. The intricate chemical compositions were evaluated by elemental analysis and thin layer chromatography-ionization detection (TLC-FID). Fourier transform infrared (FT-IR) and nuclear magnetic resonance (NMR) spectroscopies, scanning electron microscopy (SEM), and X-ray diffraction (XRD) were utilized to examine the microstructures. Whereas, thermal characteristics were evaluated by thermogravimetric analysis (TGA/DTGA) and differential scanning calorimetry (DSC). The physical behaviors were monitored through the softening point, penetration, viscosity, and ductility tests. The findings showed that the blending of asphalt with different amounts of SBS resulted into different rheological behaviors. This was reflected from the difference in the SARA (i.e., saturates, aromatics, resins, and asphaltenes) compositions and colloidal instability indexes of the modified asphalts. SEM exhibited a continuous asphalt phase with distributed SBS particles, a continuous polymer phase with distributed asphalt globules, or two interconnected continuous phases. FT-IR, {sup 1}H {sup 13}C NMR, and XRD data revealed that the AP-5 asphalt and SDA pitch experienced a number of distinct structural changes. TGA/DSC studies determined the occurrence of diverse events during thermal treatment. It is concluded that the degree of SBS modification depends strongly on SARA composition and polymer content. If the polymers are molded at higher concentrations along with aromatics-rich SDA pitches, then the mixtures

  14. Telling in-tune from out-of-tune: widespread evidence for implicit absolute intonation.

    Science.gov (United States)

    Van Hedger, Stephen C; Heald, Shannon L M; Huang, Alex; Rutstein, Brooke; Nusbaum, Howard C

    2017-04-01

    Absolute pitch (AP) is the rare ability to name or produce an isolated musical note without the aid of a reference note. One skill thought to be unique to AP possessors is the ability to provide absolute intonation judgments (e.g., classifying an isolated note as "in-tune" or "out-of-tune"). Recent work has suggested that absolute intonation perception among AP possessors is not crystallized in a critical period of development, but is dynamically maintained by the listening environment, in which the vast majority of Western music is tuned to a specific cultural standard. Given that all listeners of Western music are constantly exposed to this specific cultural tuning standard, our experiments address whether absolute intonation perception extends beyond AP possessors. We demonstrate that non-AP listeners are able to accurately judge the intonation of completely isolated notes. Both musicians and nonmusicians showed evidence for absolute intonation recognition when listening to familiar timbres (piano and violin). When testing unfamiliar timbres (triangle and inverted sine waves), only musicians showed weak evidence of absolute intonation recognition (Experiment 2). Overall, these results highlight a previously unknown similarity between AP and non-AP possessors' long-term musical note representations, including evidence of sensitivity to frequency.

  15. Functional role of delta and theta band oscillations for auditory feedback processing during vocal pitch motor control

    Directory of Open Access Journals (Sweden)

    Roozbeh eBehroozmand

    2015-03-01

    Full Text Available The answer to the question of how the brain incorporates sensory feedback and links it with motor function to achieve goal-directed movement during vocalization remains unclear. We investigated the mechanisms of voice pitch motor control by examining the spectro-temporal dynamics of EEG signals when non-musicians (NM, relative pitch (RP and absolute pitch (AP musicians maintained vocalizations of a vowel sound and received randomized ±100 cents pitch-shift stimuli in their auditory feedback. We identified a phase-synchronized (evoked fronto-central activation within the theta band (5-8 Hz that temporally overlapped with compensatory vocal responses to pitch-shifted auditory feedback and was significantly stronger in RP and AP musicians compared with non-musicians. A second component involved a non-phase-synchronized (induced frontal activation within the delta band (1-4 Hz that emerged at approximately 1 second after the stimulus onset. The delta activation was significantly stronger in the NM compared with RP and AP groups and correlated with the pitch rebound error (PRE, indicating the degree to which subjects failed to re-adjust their voice pitch to baseline after the stimulus offset. We propose that the evoked theta is a neurophysiological marker of enhanced pitch processing in musicians and reflects mechanisms by which humans incorporate auditory feedback to control their voice pitch. We also suggest that the delta activation reflects adaptive neural processes by which vocal production errors are monitored and used to update the state of sensory-motor networks for driving subsequent vocal behaviors. This notion is corroborated by our findings showing that larger PREs were associated with greater delta band activity in the NM compared with RP and AP groups. These findings provide new insights into the neural mechanisms of auditory feedback processing for vocal pitch motor control.

  16. Pitch Fork

    DEFF Research Database (Denmark)

    Williams, Peter Leslie; Overholt, Daniel

    2017-01-01

    Pitch Fork is a prototype of an alternate, actuated digital musical instrument (DMI). It uses 5 infra-red and 4 piezoelectric sensors to control an additive synthesis engine. Iron bars are used as the physical point of contact in interaction with the aim of using this materials natural acoustic...

  17. Got AP?

    Science.gov (United States)

    Digby, Joan

    2016-01-01

    Families, especially those considering sending their children to a private four-year university, need all the help they can get in funding college. Annmarie Guzy's essay "AP, Dual Enrollment, and the Survival of Honors Education" in this issue powerfully spells out the financial benefits that accrue from using AP courses to satisfy…

  18. Pitch memory, labelling and disembedding in autism.

    Science.gov (United States)

    Heaton, Pamela

    2003-05-01

    Autistic musical savants invariably possess absolute pitch ability and are able to disembed individual musical tones from chords. Enhanced pitch discrimination and memory has been found in non-savant individuals with autism who also show superior performance on visual disembedding tasks. These experiments investigate the extent that enhanced disembedding ability will be found within the musical domain in autism. High-functioning children with autism, together with age- and intelligence-matched controls, participated in three experiments testing pitch memory, labelling and chord disembedding. The findings from experiment 1 showed enhanced pitch memory and labelling in the autism group. In experiment 2, when subjects were pre-exposed to labelled individual tones, superior chord segmentation was also found. However, in experiment 3, when disembedding performance was less reliant on pitch memory, no group differences emerged and the children with autism, like controls, perceived musical chords holistically. These findings indicate that pitch memory and labelling is superior in autism and can facilitate performance on musical disembedding tasks. However, when task performance does not rely on long-term pitch memory, autistic children, like controls, succumb to the Gestalt qualities of chords.

  19. Timing matters: The processing of pitch relations

    Directory of Open Access Journals (Sweden)

    Annekathrin eWeise

    2014-06-01

    Full Text Available The human central auditory system can automatically extract abstract regularities from a variant auditory input. To this end, temporarily separated events need to be related. This study tested whether the timing between events, falling either within or outside the temporal window of integration (~350 ms, impacts the extraction of abstract feature relations. We utilized tone pairs for which tones within but not across pairs revealed a constant pitch relation (e.g. pitch of 2nd tone of a pair higher than pitch of 1st tone, while absolute pitch values varied across pairs. We measured the Mismatch Negativity (MMN; the brain’s error signal to auditory regularity violations to 2nd tones that rarely violated the pitch relation (e.g. pitch of 2nd tone lower. A Short condition in which tone duration (90 ms and stimulus onset asynchrony between the tones of a pair were short (110 ms was compared to two conditions, where this onset asynchrony was long (510 ms. In the Long Gap condition the tone durations were identical to Short (90 ms, but the silent interval was prolonged by 400 ms. In Long Tone the duration of the first tone was prolonged by 400 ms, while the silent interval was comparable to Short (20 ms. Results show a frontocentral MMN of comparable amplitude in all conditions. Thus, abstract pitch relations can be extracted even when the within-pair timing exceeds the integration period. Source analyses indicate MMN generators in the supratemporal cortex. Interestingly, they were located more anterior in Long Gap than in Short and Long Tone. Moreover, frontal generator activity was found for Long Gap and Long Tone. Thus, the way in which the system automatically registers irregular abstract pitch relations depends on the timing of the events to be linked. Pending that the current MMN data mirror established abstract rule representations coding the regular pitch relation, neural processes building these templates vary with timing.

  20. Absolute Summ

    Science.gov (United States)

    Phillips, Alfred, Jr.

    Summ means the entirety of the multiverse. It seems clear, from the inflation theories of A. Guth and others, that the creation of many universes is plausible. We argue that Absolute cosmological ideas, not unlike those of I. Newton, may be consistent with dynamic multiverse creations. As suggested in W. Heisenberg's uncertainty principle, and with the Anthropic Principle defended by S. Hawking, et al., human consciousness, buttressed by findings of neuroscience, may have to be considered in our models. Predictability, as A. Einstein realized with Invariants and General Relativity, may be required for new ideas to be part of physics. We present here a two postulate model geared to an Absolute Summ. The seedbed of this work is part of Akhnaton's philosophy (see S. Freud, Moses and Monotheism). Most important, however, is that the structure of human consciousness, manifest in Kenya's Rift Valley 200,000 years ago as Homo sapiens, who were the culmination of the six million year co-creation process of Hominins and Nature in Africa, allows us to do the physics that we do. .

  1. High coking value pitch

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Douglas J.; Chang, Ching-Feng; Lewis, Irwin C.; Lewis, Richard T.

    2014-06-10

    A high coking value pitch prepared from coal tar distillate and has a low softening point and a high carbon value while containing substantially no quinoline insolubles is disclosed. The pitch can be used as an impregnant or binder for producing carbon and graphite articles.

  2. Pitch Based Sound Classification

    DEFF Research Database (Denmark)

    Nielsen, Andreas Brinch; Hansen, Lars Kai; Kjems, U

    2006-01-01

    A sound classification model is presented that can classify signals into music, noise and speech. The model extracts the pitch of the signal using the harmonic product spectrum. Based on the pitch estimate and a pitch error measure, features are created and used in a probabilistic model with soft......-max output function. Both linear and quadratic inputs are used. The model is trained on 2 hours of sound and tested on publicly available data. A test classification error below 0.05 with 1 s classification windows is achieved. Further more it is shown that linear input performs as well as a quadratic...

  3. Consonance and pitch.

    Science.gov (United States)

    McLachlan, Neil; Marco, David; Light, Maria; Wilson, Sarah

    2013-11-01

    To date, no consensus exists in the literature as to theories of consonance and dissonance. Experimental data collected over the last century have raised questions about the dominant theories that are based on frequency relationships between the harmonics of music chords. This study provides experimental evidence that strongly challenges these theories and suggests a new theory of dissonance based on relationships between pitch perception and recognition. Experiment 1 shows that dissonance does not increase with increasing numbers of harmonics in chords as predicted by Helmholtz's (1863/1954) roughness theory, nor does it increase with fewer pitch-matching errors as predicted by Stumpf's (1898) tonal fusion theory. Dissonance was strongly correlated with pitch-matching error for chords, which in turn was reduced by chord familiarity and greater music training. This led to the proposition that long-term memory templates for common chords assist the perception of pitches in chords by providing an estimate of the chord intervals from spectral information. When recognition mechanisms based on these templates fail, the spectral pitch estimate is inconsistent with the period of the waveform, leading to cognitive incongruence and the negative affect of dissonance. The cognitive incongruence theory of dissonance was rigorously tested in Experiment 2, in which nonmusicians were trained to match the pitches of a random selection of 2-pitch chords. After 10 training sessions, they rated the chords they had learned to pitch match as less dissonant than the unlearned chords, irrespective of their tuning, providing strong support for a cognitive mechanism of dissonance. PsycINFO Database Record (c) 2013 APA, all rights reserved.

  4. AMENABILITY OF ap (S)

    OpenAIRE

    A.M. Aminpour; Mehrdad Seilani

    2013-01-01

    In this paper, we present an important new theorem for amenability of ap(S). The set of all almost periodic functions on S is denoted by ap(S). We develop the fundamental theory of almost periodic function on a general semitopological semigroup. The principal result is that ap(S) is amenable if and only if ap(S) = Sap(S) ⊕ F0 [Theorem 3.1]. Mathematical society classification:2010 MSC. 18340

  5. Wind turbine pitch optimization

    DEFF Research Database (Denmark)

    Biegel, Benjamin; Juelsgaard, Morten; Stoustrup, Jakob

    2011-01-01

    We consider a static wind model for a three-bladed, horizontal-axis, pitch-controlled wind turbine. When placed in a wind field, the turbine experiences several mechanical loads, which generate power but also create structural fatigue. We address the problem of finding blade pitch profiles......% compared to any constant pitch profile while sacrificing at most 7% of the maximum attainable output power. Using iterative learning, we show that very similar performance can be achieved by using only load measurements, with no knowledge of the wind field or wind turbine model....... for maximizing power production while simultaneously minimizing fatigue loads. In this paper, we show how this problem can be approximately solved using convex optimization. When there is full knowledge of the wind field, numerical simulations show that force and torque RMS variation can be reduced by over 96...

  6. Pitch features of environmental sounds

    Science.gov (United States)

    Yang, Ming; Kang, Jian

    2016-07-01

    A number of soundscape studies have suggested the need for suitable parameters for soundscape measurement, in addition to the conventional acoustic parameters. This paper explores the applicability of pitch features that are often used in music analysis and their algorithms to environmental sounds. Based on the existing alternative pitch algorithms for simulating the perception of the auditory system and simplified algorithms for practical applications in the areas of music and speech, the applicable algorithms have been determined, considering common types of sound in everyday soundscapes. Considering a number of pitch parameters, including pitch value, pitch strength, and percentage of audible pitches over time, different pitch characteristics of various environmental sounds have been shown. Among the four sound categories, i.e. water, wind, birdsongs, and urban sounds, generally speaking, both water and wind sounds have low pitch values and pitch strengths; birdsongs have high pitch values and pitch strengths; and urban sounds have low pitch values and a relatively wide range of pitch strengths.

  7. Vocal Pitch Shift in Congenital Amusia (Pitch Deafness)

    Science.gov (United States)

    Hutchins, Sean; Peretz, Isabelle

    2013-01-01

    We tested whether congenital amusics, who exhibit pitch perception deficits, nevertheless adjust the pitch of their voice in response to a sudden pitch shift applied to vocal feedback. Nine amusics and matched controls imitated their own previously-recorded speech or singing, while the online feedback they received was shifted mid-utterance by 25…

  8. Individuals with congenital amusia imitate pitches more accurately in singing than in speaking: implications for music and language processing.

    Science.gov (United States)

    Liu, Fang; Jiang, Cunmei; Pfordresher, Peter Q; Mantell, James T; Xu, Yi; Yang, Yufang; Stewart, Lauren

    2013-11-01

    In this study, we investigated the impact of congenital amusia, a disorder of musical processing, on speech and song imitation in speakers of a tone language, Mandarin. A group of 13 Mandarin-speaking individuals with congenital amusia and 13 matched controls were recorded while imitating a set of speech and two sets of song stimuli with varying pitch and rhythm patterns. The results indicated that individuals with congenital amusia were worse than controls in both speech and song imitation, in terms of both pitch matching (absolute and relative) and rhythm matching (relative time and number of time errors). Like the controls, individuals with congenital amusia achieved better absolute and relative pitch matching and made fewer pitch interval and contour errors in song than in speech imitation. These findings point toward domain-general pitch (and time) production deficits in congenital amusia, suggesting the presence of shared pitch production mechanisms but distinct requirements for pitch-matching accuracy in language and music processing.

  9. Lung studies with spiral CT. pitch 1 versus pitch 2

    International Nuclear Information System (INIS)

    Sartoni Galloni, S.; Miceli, M.; Lipparino, M.; Burzi, M.; Gigli, F.; Rossi, M.S.; Santoli, G.; Guidarelli, G.

    1999-01-01

    In Spiral CT, the pitch is the ratio of the distance to tabletop travels per 360 degrees rotation to nominal slice width, expressed in mm. Performing Spiral CT examination with pitch 2 allows to reduce examination time, exposure and contrast dose, and X-ray tube overload. The authors investigated the yield of pitch 2 in lung parenchyma studies, particular relative to diagnostic image quality [it

  10. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  11. Fast pitch softball injuries.

    Science.gov (United States)

    Meyers, M C; Brown, B R; Bloom, J A

    2001-01-01

    The popularity of fast pitch softball in the US and throughout the world is well documented. Along with this popularity, there has been a concomitant increase in the number of injuries. Nearly 52% of cases qualify as major disabling injuries requiring 3 weeks or more of treatment and 2% require surgery. Interestingly, 75% of injuries occur during away games and approximately 31% of traumas occur during nonpositional and conditioning drills. Injuries range from contusions and tendinitis to ligamentous disorders and fractures. Although head and neck traumas account for 4 to 12% of cases, upper extremity traumas account for 23 to 47% of all injuries and up to 19% of cases involve the knee. Approximately 34 to 42% of injuries occur when the athlete collides with another individual or object. Other factors involved include the quality of playing surface, athlete's age and experience level, and the excessive physical demands associated with the sport. Nearly 24% of injuries involve base running and are due to poor judgement, sliding technique, current stationary base design, unorthodox joint and extremity position during ground impact and catching of cleats. The increasing prevalence of overtraining syndrome among athletes has been attributed to an unclear definition of an optimal training zone, poor communication between player and coach, and the limited ability of bone and connective tissue to quickly respond to match the demands of the sport. This has led routinely to arm, shoulder and lumbar instability, chronic nonsteroidal anti-inflammatory drug (NSAID) use and time loss injuries in 45% of pitching staff during a single season. Specific attention to a safer playing environment, coaching and player education, and sport-specific training and conditioning would reduce the risk, rate and severity of fast pitch traumas. Padding of walls, backstops, rails and dugout areas, as well as minimising use of indoor facilities, is suggested to decrease the number of collision

  12. Absolute nuclear material assay

    Science.gov (United States)

    Prasad, Manoj K [Pleasanton, CA; Snyderman, Neal J [Berkeley, CA; Rowland, Mark S [Alamo, CA

    2010-07-13

    A method of absolute nuclear material assay of an unknown source comprising counting neutrons from the unknown source and providing an absolute nuclear material assay utilizing a model to optimally compare to the measured count distributions. In one embodiment, the step of providing an absolute nuclear material assay comprises utilizing a random sampling of analytically computed fission chain distributions to generate a continuous time-evolving sequence of event-counts by spreading the fission chain distribution in time.

  13. Absolute nuclear material assay

    Science.gov (United States)

    Prasad, Manoj K [Pleasanton, CA; Snyderman, Neal J [Berkeley, CA; Rowland, Mark S [Alamo, CA

    2012-05-15

    A method of absolute nuclear material assay of an unknown source comprising counting neutrons from the unknown source and providing an absolute nuclear material assay utilizing a model to optimally compare to the measured count distributions. In one embodiment, the step of providing an absolute nuclear material assay comprises utilizing a random sampling of analytically computed fission chain distributions to generate a continuous time-evolving sequence of event-counts by spreading the fission chain distribution in time.

  14. ABSOLUTE NEUTRINO MASSES

    DEFF Research Database (Denmark)

    Schechter, J.; Shahid, M. N.

    2012-01-01

    We discuss the possibility of using experiments timing the propagation of neutrino beams over large distances to help determine the absolute masses of the three neutrinos.......We discuss the possibility of using experiments timing the propagation of neutrino beams over large distances to help determine the absolute masses of the three neutrinos....

  15. Pitch perception beyond the traditional existence region of pitch

    DEFF Research Database (Denmark)

    Oxenham, Andrew J.; Micheyl, Christophe; Keebler, Michael V.

    2011-01-01

    Humans’ ability to recognize musical melodies is generally limited to pure-tone frequencies below 4 or 5 kHz. This limit coincides with the highest notes on modern musical instruments and is widely believed to reflect the upper limit of precise stimulusdriven spike timing in the auditory nerve. We...... tested the upper limits of pitch and melody perception in humans using pure and harmonic complex tones, such as those produced by the human voice and musical instruments, in melody recognition and pitchmatching tasks. We found that robust pitch perception can be elicited by harmonic complex tones...... with fundamental frequencies below 2 kHz, even when all of the individual harmonics are above 6 kHz—well above the currently accepted existence region of pitch and above the currently accepted limits of neural phase locking. The results suggest that the perception of musical pitch at high frequencies...

  16. Advanced Photon Source (APS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratoryprovides this nation's (in fact, this hemisphere's) brightest storage...

  17. NGS Absolute Gravity Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NGS Absolute Gravity data (78 stations) was received in July 1993. Principal gravity parameters include Gravity Value, Uncertainty, and Vertical Gradient. The...

  18. Decoherence at absolute zero

    OpenAIRE

    Sinha, Supurna

    2005-01-01

    We present an analytical study of the loss of quantum coherence at absolute zero. Our model consists of a harmonic oscillator coupled to an environment of harmonic oscillators at absolute zero. We find that for an Ohmic bath, the offdiagonal elements of the density matrix in the position representation decay as a power law in time at late times. This slow loss of coherence in the quantum domain is qualitatively different from the exponential decay observed in studies of high temperature envir...

  19. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  20. APS Science 2006

    International Nuclear Information System (INIS)

    Gibson, J.M.; Fenner, R.B.; Long, G.; Borland, M.; Decker, G.

    2007-01-01

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R and D. The ERL(at)APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged

  1. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  2. Pitch jnd and the tritone paradox: The linguistic nexus

    Science.gov (United States)

    Safari, Kourosh

    2002-11-01

    Previous research has shown a connection between absolute pitch (the ability to name a specific pitch in the absence of any reference) and native competence in a tone language (Deutsch, 1990). In tone languages, tone is one of the features which determines the lexical meaning of a word. This study investigates the relationship between native competence in a tone language and the just noticeable difference of pitch. Furthermore, the tritone paradox studies have shown that subjects hear two tritones (with bell-shaped spectral envelopes) as either ascending or descending depending on their linguistic backgrounds (Deutsch, 1987). It is hypothesized that the native speakers of tone languages have a higher JND for pitch, and hear the two tones of the tritone paradox as ascending, whereas, native speakers of nontone languages hear them as descending. This study will indicate the importance of early musical training for the development of acute tone sensitivity. It will also underline the importance of language and culture in the way it shapes our musical understanding. The significance of this study will be in the areas of music education and pedagogy.

  3. Disorders of pitch production in tone deafness

    Directory of Open Access Journals (Sweden)

    Simone eDalla Bella

    2011-07-01

    Full Text Available Singing is as natural as speaking for the majority of people. Yet some individuals (i.e., 10-15% are inaccurate singers, typically performing or imitating pitches and melodies inaccurately. This condition, commonly referred to as tone deafness, has been observed both in the presence and absence of deficient pitch perception. In this article we review the existing literature concerning normal singing, poor-pitch singing, and, briefly, the sources of this condition. Considering that pitch plays a prominent role in the structure of both music and speech we also focus on the possibility that pitch production (or imitation is similarly impaired in poor-pitch singers. Preliminary evidence from our laboratory on poor-pitch singing suggests that pitch imitation may be selectively inaccurate in the music domain without being affected in speech. This finding points to separability of mechanisms subserving pitch production in music and language.

  4. Difficulties with Pitch Discrimination Influences Pitch Memory Performance: Evidence from Congenital Amusia

    OpenAIRE

    Jiang, Cunmei; Lim, Vanessa K.; Wang, Hang; Hamm, Jeff P.

    2013-01-01

    Music processing is influenced by pitch perception and memory. Additionally these features interact, with pitch memory performance decreasing as the perceived distance between two pitches decreases. This study examined whether or not the difficulty of pitch discrimination influences pitch retention by testing individuals with congenital amusia. Pitch discrimination difficulty was equated by determining an individual's threshold with a two down one up staircase procedure and using this to crea...

  5. Autoantibody profiling in APS.

    Science.gov (United States)

    Roggenbuck, D; Somma, V; Schierack, P; Borghi, M O; Meroni, P L

    2014-10-01

    The international consensus for the classification of antiphospholipid syndrome (APS) requires clinical and laboratory criteria to be considered at an equal level for diagnosing APS. Thus, detection of antiphospholipid antibodies (aPL) being a hallmark of APS has been the object of intensive investigation over the past 40 years. However, appropriate detection of aPL still remains a laboratory challenge due to their heterogeneity comprising autoantibodies reactive to different phospholipid-binding plasma proteins, such as beta-2 glycoprotein I (β2GPI) and prothrombin. The relevance of aPL interacting with phospholipids other than cardiolipin (CL, diphosphatidylglycerol), such as phosphatidylserine (PS), remains elusive with regard to the diagnosis of APS. Recently, the concept of aPL profiling has been introduced to assess the risk of thrombotic complications in patients with APS. New assay techniques, apart from enzyme-linked immunosorbent assays (ELISAs) recommended by the international consensus for the classification of APS, have been proposed for multiplexing of aPL testing. Line immunoassays (LIAs) employing a novel hydrophobic solid phase for the simultaneous detection of different aPL seem to be an intriguing alternative. We evaluated a novel multiplex LIA employing a hydrophobic membrane coated with different phospholipid (PL)-binding proteins or PLs. The performance characteristics of this new multiplexing assay technique demonstrated its usefulness for aPL profiling. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  6. Reliable Fluid Power Pitch Systems

    DEFF Research Database (Denmark)

    Liniger, Jesper; Pedersen, Henrik Clemmensen; Soltani, Mohsen

    2015-01-01

    The key objectives of wind turbine manufactures and buyers are to reduce the Total Cost of Ownership and Total Cost of Energy. Among others, low downtime of a wind turbine is important to increase the amount of energy produced during its lifetime. Historical data indicate that pitch systems...... accounts for a substantial part of the downtime of wind turbines. With a focus on fluid power pitch systems; this paper presents an overview of methods relevant to assessing and increasing the reliability and availability of such systems. Four major areas are identified and covered; failure analysis...

  7. Calibration with Absolute Shrinkage

    DEFF Research Database (Denmark)

    Øjelund, Henrik; Madsen, Henrik; Thyregod, Poul

    2001-01-01

    In this paper, penalized regression using the L-1 norm on the estimated parameters is proposed for chemometric je calibration. The algorithm is of the lasso type, introduced by Tibshirani in 1996 as a linear regression method with bound on the absolute length of the parameters, but a modification...

  8. Approach to Absolute Zero

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 6. Approach to Absolute Zero 0.3 K. to a Few Milli-Kelvin. R Srinivasan. Series Article Volume 2 Issue 6 June 1997 pp 6-14. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/06/0006-0014 ...

  9. Approach to Absolute Zero

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 2. Approach to Absolute Zero From 4. 22 K. to 0. 3 K. R Srinivasan. Series Article Volume 2 Issue 2 February 1997 pp 8-16. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/02/0008-0016 ...

  10. Approach to Absolute Zero

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Approach to Absolute Zero Below 10 milli-Kelvin. R Srinivasan. Series Article Volume 2 Issue 10 October 1997 pp 8-16. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0008-0016 ...

  11. Approach to Absolute Zero

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Approach to Absolute Zero Below 10 milli-Kelvin. R Srinivasan. Series Article Volume 2 Issue 10 October 1997 pp 8-16. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/10/0008-0016 ...

  12. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  13. A Different Pitch to Slope

    Science.gov (United States)

    Wolbert, William

    2017-01-01

    The query "When are we ever going to use this?" is easily answered when discussing the slope of a line. The pitch of a roof, the grade of a road, and stair stringers are three applications of slope that are used extensively. The concept of slope, which is introduced fairly early in the mathematics curriculum has hands-on applications…

  14. APS SCIENCE 2016

    Energy Technology Data Exchange (ETDEWEB)

    Fenner, Richard B. [Argonne National Lab. (ANL), Argonne, IL (United States). Advanced Photon Source (APS)

    2017-05-01

    The Advanced Photon Source (APS) occupies an 80-acre site on the Argonne national laboratory campus, about 25 miles from downtown chicago, illinois. it shares the site with the center for nanoscale materials and the Advanced Protein characterization facility. for directions to Argonne, see http://www.anl.gov/directions-and-visitor-information. The APS, a national synchrotron radiation research facility operated by Argonne for the u.S. department of energy (doe) office of Science, provides this nation’s brightest high-energy x-ray beams for science. research by APS users extends from the center of the earth to outer space, from new information on combustion engines and microcircuits to new drugs and nanotechnologies whose scale is measured in billionths of a meter. The APS helps researchers illuminate answers to the challenges of our high-tech world, from developing new forms of energy, to sustaining our nation’s technological and economic competitiveness, to pushing back against the ravages of disease. research at the APS promises to have far-reaching

  15. Cross-Cultural Perspectives on Pitch Memory

    Science.gov (United States)

    Trehub, Sandra E.; Schellenberg, E. Glenn; Nakata, Takayuki

    2008-01-01

    We examined effects of age and culture on children's memory for the pitch level of familiar music. Canadian 9- and 10-year-olds distinguished the original pitch level of familiar television theme songs from foils that were pitch-shifted by one semitone, whereas 5- to 8-year-olds failed to do so (Experiment 1). In contrast, Japanese 5- and…

  16. Pitch perception prior to cortical maturation

    Science.gov (United States)

    Lau, Bonnie K.

    Pitch perception plays an important role in many complex auditory tasks including speech perception, music perception, and sound source segregation. Because of the protracted and extensive development of the human auditory cortex, pitch perception might be expected to mature, at least over the first few months of life. This dissertation investigates complex pitch perception in 3-month-olds, 7-month-olds and adults -- time points when the organization of the auditory pathway is distinctly different. Using an observer-based psychophysical procedure, a series of four studies were conducted to determine whether infants (1) discriminate the pitch of harmonic complex tones, (2) discriminate the pitch of unresolved harmonics, (3) discriminate the pitch of missing fundamental melodies, and (4) have comparable sensitivity to pitch and spectral changes as adult listeners. The stimuli used in these studies were harmonic complex tones, with energy missing at the fundamental frequency. Infants at both three and seven months of age discriminated the pitch of missing fundamental complexes composed of resolved and unresolved harmonics as well as missing fundamental melodies, demonstrating perception of complex pitch by three months of age. More surprisingly, infants in both age groups had lower pitch and spectral discrimination thresholds than adult listeners. Furthermore, no differences in performance on any of the tasks presented were observed between infants at three and seven months of age. These results suggest that subcortical processing is not only sufficient to support pitch perception prior to cortical maturation, but provides adult-like sensitivity to pitch by three months.

  17. Global distribution of the pitch canker fungus

    Science.gov (United States)

    L. David Dwinell

    1998-01-01

    The pitch canker fungus, Fusarium subglutinans f. sp. pini, causes diseases of pines in the United States, Haiti, Japan, Mexico, Spain, and South Africa. Pitch canker was first reported in Virginia pine in North Carolina in 1946. Although the disease was reported in Haitian pine in 1953, pitch canker was generally considered a...

  18. APS power supply controls

    International Nuclear Information System (INIS)

    Saunders, C.W.; Despe, O.D.

    1994-01-01

    The purpose of this document is to provide comprehensive coverage of the APS power supply control design. This includes application software, embedded controller software, networks, and hardware. The basic components will be introduced first, followed by the requirements driving the overall design. Subsequent sections will address each component of the design one by one. Latter sections will address specific applications

  19. Calibration with Absolute Shrinkage

    DEFF Research Database (Denmark)

    Øjelund, Henrik; Madsen, Henrik; Thyregod, Poul

    2001-01-01

    In this paper, penalized regression using the L-1 norm on the estimated parameters is proposed for chemometric je calibration. The algorithm is of the lasso type, introduced by Tibshirani in 1996 as a linear regression method with bound on the absolute length of the parameters, but a modification...... to the lasso. The lasso is applied both directly as a calibration method and as a method to select important variables/wave lengths. It is demonstrated that the lasso algorithm, in general, leads to parameter estimates of which some are zero while others are quite large (compared to e.g. the traditional PLS...

  20. Carbon fibers from SRC pitch

    Science.gov (United States)

    Greskovich, Eugene J.; Givens, Edwin N.

    1981-01-01

    This invention relates to an improved method of manufacturing carbon fibers from a coal derived pitch. The improvement resides in the use of a solvent refined coal which has been hydrotreated and subjected to solvent extraction whereby the hetero atom content in the resulting product is less than 4.0% by weight and the softening point is between about 100.degree.-250.degree. F.

  1. Aerodynamic control with passively pitching wings

    Science.gov (United States)

    Gravish, Nick; Wood, Robert

    Flapping wings may pitch passively under aerodynamic and inertial loads. Such passive pitching is observed in flapping wing insect and robot flight. The effect of passive wing pitch on the control dynamics of flapping wing flight are unexplored. Here we demonstrate in simulation and experiment the critical role wing pitching plays in yaw control of a flapping wing robot. We study yaw torque generation by a flapping wing allowed to passively rotate in the pitch axis through a rotational spring. Yaw torque is generated through alternating fast and slow upstroke and and downstroke. Yaw torque sensitively depends on both the rotational spring force law and spring stiffness, and at a critical spring stiffness a bifurcation in the yaw torque control relationship occurs. Simulation and experiment reveal the dynamics of this bifurcation and demonstrate that anomalous yaw torque from passively pitching wings is the result of aerodynamic and inertial coupling between the pitching and stroke-plane dynamics.

  2. Disorders of pitch production in tone deafness.

    Science.gov (United States)

    Bella, Simone Dalla; Berkowska, Magdalena; Sowiński, Jakub

    2011-01-01

    Singing is as natural as speaking for the majority of people. Yet some individuals (i.e., 10-15%) are poor singers, typically performing or imitating pitches and melodies inaccurately. This condition, commonly referred to as "tone deafness," has been observed both in the presence and absence of deficient pitch perception. In this article we review the existing literature concerning normal singing, poor-pitch singing, and, briefly, the sources of this condition. Considering that pitch plays a prominent role in the structure of both music and speech we also focus on the possibility that speech production (or imitation) is similarly impaired in poor-pitch singers. Preliminary evidence from our laboratory suggests that pitch imitation may be selectively inaccurate in the music domain without being affected in speech. This finding points to separability of mechanisms subserving pitch production in music and language.

  3. Absolute Gravimetry in Fennoscandia

    DEFF Research Database (Denmark)

    Pettersen, B. R; TImmen, L.; Gitlein, O.

    away from this central location. An oval shaped zero uplift isoline tracks the general western and northern coastline of Norway and the Kola peninsula. It returns southwest through Russian Karelia and touches the southern tip of Sweden and northern Denmark. The uplift area (as measured by present day...... motions) has its major axis in the direction of southwest to northeast and covers a distance of about 2000 km. Absolute gravimetry was made in Finland and Norway in 1976 with a rise-and fall instrument. A decade later the number of gravity stations was expanded by JILAg-5, in Finland from 1988, in Norway...... acquired by IfE (FG5-220), FGI (FG5-221), and UMB (FG5-226). New absolute gravity stations were established by the national mapping agencies in Denmark, Norway, and Sweden. The total number of prepared sites in Fennoscandia is now about 30. Most of them are co-located with permanent GPS, for many of which...

  4. Thermodynamics of negative absolute pressures

    International Nuclear Information System (INIS)

    Lukacs, B.; Martinas, K.

    1984-03-01

    The authors show that the possibility of negative absolute pressure can be incorporated into the axiomatic thermodynamics, analogously to the negative absolute temperature. There are examples for such systems (GUT, QCD) processing negative absolute pressure in such domains where it can be expected from thermodynamical considerations. (author)

  5. APS Science 2007

    International Nuclear Information System (INIS)

    2008-01-01

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience

  6. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  7. Difficulties with pitch discrimination influences pitch memory performance: evidence from congenital amusia.

    Science.gov (United States)

    Jiang, Cunmei; Lim, Vanessa K; Wang, Hang; Hamm, Jeff P

    2013-01-01

    Music processing is influenced by pitch perception and memory. Additionally these features interact, with pitch memory performance decreasing as the perceived distance between two pitches decreases. This study examined whether or not the difficulty of pitch discrimination influences pitch retention by testing individuals with congenital amusia. Pitch discrimination difficulty was equated by determining an individual's threshold with a two down one up staircase procedure and using this to create conditions where two pitches (the standard and the comparison tones) differed by 1x, 2x, and 3x the threshold setting. For comparison with the literature a condition that employed a constant pitch difference of four semitones was also included. The results showed that pitch memory performance improved as the discrimination between the standard and the comparison tones was made easier for both amusic and control groups, and more importantly, that amusics did not show any pitch retention deficits when the discrimination difficulty was equated. In contrast, consistent with previous literature, amusics performed worse than controls when the physical pitch distance was held constant at four semitones. This impaired performance has been interpreted as evidence for pitch memory impairment in the past. However, employing a constant pitch distance always makes the difference closer to the discrimination threshold for the amusic group than for the control group. Therefore, reduced performance in this condition may simply reflect differences in the perceptual difficulty of the discrimination. The findings indicate the importance of equating the discrimination difficulty when investigating memory.

  8. Difficulties with pitch discrimination influences pitch memory performance: evidence from congenital amusia.

    Directory of Open Access Journals (Sweden)

    Cunmei Jiang

    Full Text Available Music processing is influenced by pitch perception and memory. Additionally these features interact, with pitch memory performance decreasing as the perceived distance between two pitches decreases. This study examined whether or not the difficulty of pitch discrimination influences pitch retention by testing individuals with congenital amusia. Pitch discrimination difficulty was equated by determining an individual's threshold with a two down one up staircase procedure and using this to create conditions where two pitches (the standard and the comparison tones differed by 1x, 2x, and 3x the threshold setting. For comparison with the literature a condition that employed a constant pitch difference of four semitones was also included. The results showed that pitch memory performance improved as the discrimination between the standard and the comparison tones was made easier for both amusic and control groups, and more importantly, that amusics did not show any pitch retention deficits when the discrimination difficulty was equated. In contrast, consistent with previous literature, amusics performed worse than controls when the physical pitch distance was held constant at four semitones. This impaired performance has been interpreted as evidence for pitch memory impairment in the past. However, employing a constant pitch distance always makes the difference closer to the discrimination threshold for the amusic group than for the control group. Therefore, reduced performance in this condition may simply reflect differences in the perceptual difficulty of the discrimination. The findings indicate the importance of equating the discrimination difficulty when investigating memory.

  9. Renal involvement in the antiphospholipid syndrome (APS)-APS nephropathy.

    Science.gov (United States)

    Tektonidou, Maria G

    2009-06-01

    Although the kidney represents a major target organ in antiphospholipid syndrome (APS), renal involvement in APS was poorly recognized until recently. The most well-recognized renal manifestations of APS are the renal artery thrombosis/stenosis, renal infarction, hypertension, renal vein thrombosis, end-stage renal disease, increased allograft vascular thrombosis, some types of glomerular disease, and a small-vessel vaso-occlusive nephropathy, recently defined as APS nephropathy. APS nephropathy was first described in primary APS patients, characterized by acute thrombotic lesions in glomeruli and/or arterioles (thrombotic microangiopathy) and chronic vascular lesions such as fibrous intimal hyperplasia of arterioles and interlobular arteries, organized thrombi with or without recanalization, and fibrous arterial and arteriolar occlusions or focal cortical atrophy. APS nephropathy was also detected in further studies including patients with systemic lupus erythematosus (SLE)-related APS and SLE/non-APS patients with positive antiphospholipid antibodies, independently of lupus nephritis. The same histologic lesions, especially thrombotic mictroangiopathy, were also observed in patients with catastrophic APS. The most frequent clinical and laboratory characteristics of APS nephropathy in all the above groups of patients are hypertension (often severe), proteinuria (ranging from mild to nephrotic range), hematuria, and acute or chronic renal insufficiency.

  10. Uncovering phenotypes of poor-pitch singing: the Sung Performance Battery (SPB).

    Science.gov (United States)

    Berkowska, Magdalena; Dalla Bella, Simone

    2013-01-01

    Singing is as natural as speaking for humans. Increasing evidence shows that the layman can carry a tune (e.g., when asked to sing a well-known song or to imitate single pitches, intervals and short melodies). Yet, important individual differences exist in the general population with regard to singing proficiency. Some individuals are particularly inaccurate or imprecise in producing or imitating pitch information (poor-pitch singers), thus showing a variety of singing phenotypes. Unfortunately, so far there is not a standard set of tasks for assessing singing proficiency in the general population, allowing to uncover and characterize individual profiles of poor-pitch singing. Different tasks and analysis methods are typically used in various experiments, making the comparison of the results across studies arduous. To fill this gap we propose here a new tool for assessing singing proficiency (the Sung Performance Battery, SPB). The SPB starts from the assessment of participants' vocal range followed by five tasks: (1) single-pitch matching, (2) pitch-interval matching, (3) novel-melody matching, (4) singing from memory of familiar melodies (with lyrics and on a syllable), and (5) singing of familiar melodies (with lyrics and on a syllable) at a slow tempo indicated by a metronome. Data analysis via acoustical methods provides objective measures of pitch accuracy and precision in terms of absolute and relative pitch. The SPB has been tested in a group of 50 occasional singers. The results indicate that the battery is useful for characterizing proficient singing and for detecting cases of inaccurate and/or imprecise singing.

  11. Uncovering phenotypes of poor-pitch singing: The Sung Performance Battery (SPB

    Directory of Open Access Journals (Sweden)

    Magdalena eBerkowska

    2013-10-01

    Full Text Available Singing is as natural as speaking for humans. Increasing evidence shows that the layman can carry a tune (e.g., when asked to sing a well-known song or to imitate single pitches, intervals and short melodies. Yet, important individual differences exist in the general population with regard to singing proficiency. Some individuals are particularly inaccurate or imprecise in producing or imitating pitch information (poor-pitch singers, thus showing a variety of singing phenotypes. Unfortunately, so far there is not a standard set of tasks for assessing singing proficiency in the general population, allowing to uncover and characterize individual profiles of poor-pitch singing. Different tasks and analysis methods are typically used in various experiments, making the comparison of the results across studies arduous. To fill this gap we propose here a new tool for assessing singing proficiency (the Sung Performance Battery, SPB. The SPB starts from the assessment of participants’ vocal range followed by five tasks: 1 single-pitch matching, 2 pitch-interval matching, 3 novel-melody matching, 4 singing from memory of familiar melodies (with lyrics and on a syllable, and 5 singing of familiar melodies (with lyrics and on a syllable at a slow tempo indicated by a metronome. Data analysis via acoustical methods provides objective measures of pitch accuracy and precision in terms of absolute and relative pitch. The SPB has been tested in a group of 50 occasional singers. The results indicate that the battery is useful for characterizing proficient singing and for detecting cases of inaccurate and/or imprecise singing.

  12. Pitch perception in the first year of life: A comparison of lexical tones and musical pitch

    NARCIS (Netherlands)

    Chen, A.; Stevens, Catherine; Kager, R.W.J.

    2017-01-01

    Pitch variation is pervasive in speech, regardless of the language to which infants are exposed. Lexical tone is influenced by general sensitivity to pitch. We examined whether the development in lexical tone perception may develop in parallel with perception of pitch in other cognitive domains

  13. Parasites pitched against nature: Pitch Lake water protects guppies (Poecilia reticulata) from microbial and gyrodactylid infections.

    Science.gov (United States)

    Schelkle, Bettina; Mohammed, Ryan S; Coogan, Michael P; McMullan, Mark; Gillingham, Emma L; VAN Oosterhout, Cock; Cable, Joanne

    2012-11-01

    SUMMARY The enemy release hypothesis proposes that in parasite depleted habitats, populations will experience relaxed selection and become more susceptible (or less tolerant) to pathogenic infections. Here, we focus on a population of guppies (Poecilia reticulata) that are found in an extreme environment (the Pitch Lake, Trinidad) and examine whether this habitat represents a refuge from parasites. We investigated the efficacy of pitch in preventing microbial infections in Pitch Lake guppies, by exposing them to dechlorinated water, and reducing gyrodactylid infections on non-Pitch Lake guppies by transferring them to Pitch Lake water. We show that (i) natural prevalence of ectoparasites in the Pitch Lake is low compared to reference populations, (ii) Pitch Lake guppies transferred into aquarium water develop microbial infections, and (iii) experimentally infected guppies are cured of their gyrodactylid infections both by natural Pitch Lake water and by dechlorinated water containing solid pitch. These results indicate a role for Pitch Lake water in the defence of guppies from their parasites and suggest that Pitch Lake guppies might have undergone enemy release in this extreme environment. The Pitch Lake provides an ideal ecosystem for studies on immune gene evolution in the absence of parasites and long-term evolutionary implications of hydrocarbon pollution for vertebrates.

  14. Absolute risk, absolute risk reduction and relative risk

    Directory of Open Access Journals (Sweden)

    Jose Andres Calvache

    2012-12-01

    Full Text Available This article illustrates the epidemiological concepts of absolute risk, absolute risk reduction and relative risk through a clinical example. In addition, it emphasizes the usefulness of these concepts in clinical practice, clinical research and health decision-making process.

  15. Numeric aspects in pitch identification: an fMRI study

    Directory of Open Access Journals (Sweden)

    Schwenzer Michael

    2011-03-01

    Full Text Available Abstract Background Pitch identification had yielded unique response patterns compared to other auditory skills. Selecting one out of numerous pitches distinguished this task from detecting a pitch ascent. Encoding of numerous stimuli had activated the intraparietal sulcus in the visual domain. Therefore, we hypothesized that numerosity encoding during pitch identification activates the intraparietal sulcus as well. Methods To assess pitch identification, the participants had to recognize a single pitch from a set of four possible pitches in each trial. Functional magnetic resonance imaging (fMRI disentangled neural activation during this four-pitch-choice task from activation during pitch contour perception, tone localization, and pitch discrimination. Results Pitch identification induced bilateral activation in the intraparietal sulcus compared to pitch discrimination. Correct responses in pitch identification correlated with activation in the left intraparietal sulcus. Pitch contour perception activated the superior temporal gyrus conceivably due to the larger range of presented tones. The differentiation between pitch identification and tone localization failed. Activation in an ACC-hippocampus network distinguished pitch discrimination from pitch identification. Conclusion Pitch identification is distinguishable from pitch discrimination on the base of activation in the IPS. IPS activity during pitch identification may be the auditory counterpart of numerosity encoding in the visual domain.

  16. Individual Pitch Control Using LIDAR Measurements

    DEFF Research Database (Denmark)

    Mirzaei, Mahmood; Henriksen, Lars Christian; Poulsen, Niels Kjølstad

    2012-01-01

    In this work the problem of individual pitch control of a variable-speed variable-pitch wind turbine in the full load region is considered. Model predictive control (MPC) is used to solve the problem. However as the plant is nonlinear and time varying, a new approach is proposed to simplify...

  17. Low Earth orbit assessment of proton anisotropy using AP8 and AP9 trapped proton models.

    Science.gov (United States)

    Badavi, Francis F; Walker, Steven A; Santos Koos, Lindsey M

    2015-04-01

    pitch angle (PA) and east-west (EW) effects. Within SAA, the EW anisotropy results in different level of exposure to each side of the ISS Zvezda SM, allowing angular evaluation of the anisotropic proton spectrum. While the combined magnitude of PA and EW effects at LEO depends on a multitude of factors such as trapped proton energy, orientation and altitude of the spacecraft along the velocity vector, this paper draws quantitative conclusions on the combined anisotropic magnitude differences within ISS SM target point between AP8 and AP9 models. Copyright © 2015 The Committee on Space Research (COSPAR). All rights reserved.

  18. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  19. Thrombotic risk assessment in APS: the Global APS Score (GAPSS).

    Science.gov (United States)

    Sciascia, S; Bertolaccini, M L

    2014-10-01

    Recently, we developed a risk score for antiphospholipid syndrome (APS) (Global APS Score or GAPSS). This score derived from the combination of independent risk factors for thrombosis and pregnancy loss, taking into account the antiphospholipid antibodies (aPL) profile (criteria and non-criteria aPL), the conventional cardiovascular risk factors, and the autoimmune antibodies profile. We demonstrate that risk profile in APS can be successfully assessed, suggesting that GAPSS can be a potential quantitative marker of APS-related clinical manifestations. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  20. Effects of harmonic roving on pitch discrimination

    DEFF Research Database (Denmark)

    Santurette, Sébastien; de Kérangal, Mathilde le Gal; Joshi, Suyash Narendra

    2015-01-01

    Performance in pitch discrimination tasks is limited by variability intrinsic to listeners which may arise from peripheral auditory coding limitations or more central noise sources. Perceptual limitations may be characterized by measuring an observer’s change in performance when introducting...... external noise in the physical stimulus (Lu and Dosher, 2008). The present study used this approach to attempt to quantify the “internal noise” involved in pitch coding of harmonic complex tones by estimating the amount of harmonic roving required to impair pitch discrimination performance. It remains...... a matter of debate whether pitch perception of natural complex sounds mostly relies on either spectral excitation-based information or temporal periodicity information. Comparing the way internal noise affects the internal representations of such information to how it affects pitch discrimination...

  1. Enhanced Cortical Connectivity in Absolute Pitch Musicians: A Model for Local Hyperconnectivity

    Science.gov (United States)

    Loui, Psyche; Li, H. Charles; Hohmann, Anja; Schlaug, Gottfried

    2011-01-01

    Connectivity in the human brain has received increased scientific interest in recent years. Although connection disorders can affect perception, production, learning, and memory, few studies have associated brain connectivity with graded variations in human behavior, especially among normal individuals. One group of normal individuals who possess…

  2. Westinghouse AP1000 licensing maturity

    International Nuclear Information System (INIS)

    Schulz, T.; Vijuk, R.P.

    2005-01-01

    The Westinghouse AP1000 Program is aimed at making available a nuclear power plant that is economical in the U.S deregulated electrical power industry in the near-term. The AP1000 is two-loop 1000 MWe pressurizer water reactor (PWR). It is an up rated version of the AP600. The AP1000 uses passive safety systems to provide significant and measurable improvements in plant simplification, safety, reliability, investment protection and plant costs. The AP1000 uses proven technology, which builds on over 35 years of operating PWR experience. The AP1000 received Final Design Approval by the United States Nuclear Regulatory Commission (U.S. NRC) in September 2004. The AP1000 meets the US utility requirements. The AP1000 and its sister plant the AP600 have gone through a very through and complete licensing review. This paper describes the U.S. NRC review efforts of both the AP600 and the AP1000. The detail of the review and the independent calculations, evaluations and testing is discussed. The AP600 licensing documentation was submitted in 1992. The U.S. NRC granted Final Design Approval in 1999. During the intervening 7 years, the U.S. NRC asked thousands of questions, performed independent safety analysis, audited Westinghouse calculations and analysis, and performed independent testing. The more significant areas of discussion will be described. For the AP1000 Westinghouse first engaged the U.S. NRC in pre-certification discussions to define the extent of the review required, since the design is so similar to the AP600. The AP1000 licensing documentation was submitted in March 2002. The U.S. NRC granted Final Design Approval in September 2004. During the intervening 2 1/2 years, the U.S. NRC asked hundreds of questions, performed independent safety analysis, audited Westinghouse calculations and analysis, and performed independent testing. The more significant areas of discussion will be described. The implications of this review and approval on AP1000 applications in

  3. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  4. SEPTUM MAGNET DESIGN FOR THE APS-U

    Energy Technology Data Exchange (ETDEWEB)

    Abliz, M.; Jaski, M.; Xiao, A.; Wienands, U.; Cease, H.; Borland, M.; Decker, G.; Kerby, J.

    2017-06-25

    The Advanced Photon Source is in the process of upgrading its storage ring from a double-bend to a multi-bend lattice as part of the APS Upgrade Project (APS-U). A swap-out injection scheme is planned for the APS-U to keep a constant beam current and to enable a small dynamic aperture. A septum magnet with a minimum thickness of 2 mm and an injection field of 1.06 T has been designed, delivering the required total deflecting angle is 89 mrad with a ring energy of 6 GeV. The stored beam chamber has an 8 mm x 6 mm super-ellipsoidal aperture. The magnet is straight; however, it is tilted in yaw, roll, and pitch from the stored beam chamber to meet the on axis swap out injection requirements for the APS-U lattice. In order to minimize the leakage field inside the stored beam chamber, four different techniques were utilized in the design. As a result, the horizontal deflecting angle of the stored beam was held to only 5 µrad, and the integrated skew quadrupole inside the stored beam chamber was held to 0.09 T. The detailed techniques that were applied to the design, field multipoles, and resulting trajectories of the injected and stored beams are reported.

  5. Lateralization of the Huggins pitch

    Science.gov (United States)

    Zhang, Peter Xinya; Hartmann, William M.

    2004-05-01

    The lateralization of the Huggins pitch (HP) was measured using a direct estimation method. The background noise was initially N0 or Nπ, and then the laterality of the entire stimulus was varied with a frequency-independent interaural delay, ranging from -1 to +1 ms. Two versions of the HP boundary region were used, stepped phase and linear phase. When presented in isolation, without the broadband background, the stepped boundary can be lateralized on its own but the linear boundary cannot. Nevertheless, the lateralizations of both forms of HP were found to be almost identical functions both of the interaural delay and of the boundary frequency over a two-octave range. In a third experiment, the same listeners lateralized sine tones in quiet as a function of interaural delay. Good agreement was found between lateralizations of the HP and of the corresponding sine tones. The lateralization judgments depended on the boundary frequency according to the expected hyperbolic law except when the frequency-independent delay was zero. For the latter case, the dependence on boundary frequency was much slower than hyperbolic. [Work supported by the NIDCD grant DC 00181.

  6. AP1000 Design for Security

    International Nuclear Information System (INIS)

    Long, L.B.; Cummins, W.E.; Winters, J.W.

    2006-01-01

    Nuclear power plants are protected from potential security threats through a combination of robust structures around the primary system and other vital equipment, security systems and equipment, and defensive strategy. The overall objective for nuclear power plant security is to protect public health and safety by ensuring that attacks or sabotage do not challenge the ability to safely shutdown the plant or protect from radiological releases. In addition, plants have systems, features and operational strategies to cope with external conditions, such as loss of offsite power, which could be created as part of an attack. Westinghouse considered potential security threats during design of the AP1000 PWR. The differences in plant configuration, safety system design, and safe shutdown equipment between existing plants and AP1000 affect potential vulnerabilities. This paper provides an evaluation of AP1000 with respect to vulnerabilities to security threats. The AP1000 design differs from the design of operating PWRs in the US in the configuration and the functional requirements for safety systems. These differences are intentional departures from conventional PWR designs which simplify plant design and enhance overall safety. The differences between the AP1000 PWR and conventional PWRs can impact vulnerabilities to security threats. The NRC addressed security concerns as part of their reviews for AP1000 Design Certification, and did not identify any security issues of concern. However, much of the detailed security design information for the AP1000 was deferred to the combined Construction and Operating License (COL) phase as many of the security issues are site-specific. Therefore, NRC review of security issues related to the AP1000 is not necessarily complete. Further, since the AP1000 plant design differs from existing PWRs, it is not obvious that the analyses and assessments prepared for existing plants also apply to the AP1000. We conclude that, overall, the AP1000

  7. Development of carbon-carbon composites from solvent extracted pitch

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-06-24

    There are several methods used to fabricate carbon-carbon composites. One used extensively in the fabrication of aerospace components such as rocket nozzles and reentry vehicle nosetips, as well as commercial components for furnace fixturing and glass manufacturing, is the densification of a woven preform with molten pitch, and the subsequent conversion of the pitch to graphite through heat treatment. Two types of pitch are used in this process; coal tar pitch and petroleum pitch. The objective of this program was to determine if a pitch produced by the direct extraction of coal could be used as a substitute for these pitches in the fabrication of carbon-carbon composites. The program involved comparing solvent extracted pitch with currently accepted pitches and rigidizing a carbon-carbon preform with solvent extracted pitch for comparison with carbon-carbon fabricated with currently available pitch.

  8. AP1000. The PWR revisited

    International Nuclear Information System (INIS)

    The distinguishing features of Westinghouse's AP1000 advanced passive pressurized water reactor are highlighted. In particular, the AP1000's passive safety features are described as well as their implications for simplifying the design, construction, and operation of this design compared to currently operating plants, and significantly increasing safety margins over current plants as well. The AP1000 design specifically incorporates the knowledge acquired from the substantial accumulation of power reactor operating experience and benefits from the application of the Probabilistic Risk Assessment in the design process itself. The AP1000 design has been certified by the US Nuclear Regulatory Commission under its new rules for licensing new nuclear plants, 10 CFR Part 52, and is the subject of six combined Construction and Operating License applications now being developed. Currently the AP1000 design is being assessed against the EUR Rev C requirements for new nuclear power plants in Europe. (author)

  9. Pitch Synchronous Segmentation of Speech Signals

    Data.gov (United States)

    National Aeronautics and Space Administration — The Pitch Synchronous Segmentation (PSS) that accelerates speech without changing its fundamental frequency method could be applied and evaluated for use at NASA....

  10. Objective correlates of pitch salience using pupillometry

    DEFF Research Database (Denmark)

    Bianchi, Federica; Santurette, Sébastien; Wendt, Dorothea

    2014-01-01

    the frequency region and F 0 , were considered. Pupil size was measured for each condition, while the subjects’ task was to detect the deviants by pressing a response button. The expected trend was that pupil size would increase with decreasing salience. Results for musically trained listeners showed......Although objective correlates of pitch salience have been investigated in several neuroimaging studies, the results remain controversial. In the present study, a novel approach to objectively estimate pitch salience was used. Pupil dilation was measured as an indicator of the required effort...... in performing a pitch discrimination task for complex tones of varying pitch salience. It has been shown that cognitive processing demands of the task can be reflected in the pupil response, whereby pupil size dilates when cognitive load increases. The hypothesis was that pupil size would increase...

  11. Changes of oscillatory activity in pitch processing network and related tinnitus relief induced by acoustic CR neuromodulation

    Directory of Open Access Journals (Sweden)

    Ilya eAdamchic

    2012-04-01

    Full Text Available Chronic subjective tinnitus is characterized by abnormal neuronal synchronization in the central auditory system. As shown in a controlled clinical trial, acoustic coordinated reset (CR neuromodulation causes a significant relief of tinnitus symptoms along with a significant decrease of pathological oscillatory activity in a network comprising auditory and non-auditory brain areas, which is often accompanied with a significant tinnitus pitch change. Here, we studied if the tinnitus pitch change correlates with a reduction of tinnitus loudness and/or annoyance as assessed by visual analogue scale (VAS scores. Furthermore, we studied if the changes of the pattern of brain synchrony in tinnitus patients induced by 12 weeks of CR-therapy depend on whether or not the patients undergo a pronounced tinnitus pitch change. For this, we applied standardized low-resolution brain electromagnetic tomography (sLORETA to EEG recordings from two groups of patients with a sustained CR-induced relief of tinnitus symptoms with and without tinnitus pitch change. We found that absolute changes of VAS loudness and VAS annoyance scores significantly correlate with the modulus of the tinnitus pitch change. Moreover, as opposed to patients with weak or no pitch change we found a significantly stronger decrease in gamma power in patients with pronounced tinnitus pitch change in right parietal cortex (BA 1, 40, right frontal cortex (BA 8, 9, 46, and left frontal cortex (BA 4, 6, combined with a significantly stronger increase of alpha (10-12 Hz activity in the right anterior cingulate cortex (BA 32, 24. In addition, we revealed a significantly lower functional connectivity in the gamma band between the right dorsolateral prefrontal cortex (BA 9 and the right anterior cingulate cortex (BA 32 after 12 weeks of CR-therapy in patients with pronounced pitch change. Our results indicate a substantial, CR-induced reduction of tinnitus-related auditory binding in a pitch

  12. Major League Baseball pitch velocity and pitch type associated with risk of ulnar collateral ligament injury.

    Science.gov (United States)

    Keller, Robert A; Marshall, Nathan E; Guest, John-Michael; Okoroha, Kelechi R; Jung, Edward K; Moutzouros, Vasilios

    2016-04-01

    The number of Major League Baseball (MLB) pitchers requiring ulnar collateral ligament (UCL) reconstructions is increasing. Recent literature has attempted to correlate specific stresses placed on the throwing arm to risk for UCL injury, with limited results. Eighty-three MLB pitchers who underwent primary UCL reconstruction were evaluated. Pitching velocity and percent of pitch type thrown (fastball, curve ball, slider, and change-up) were evaluated 2 years before and after surgery. Data were compared with control pitchers matched for age, position, size, innings pitched, and experience. The evaluation of pitch velocity compared with matched controls found no differences in pre-UCL reconstruction pitch velocities for fastballs (91.5 vs. 91.2 miles per hour [mph], P = .69), curveballs (78.2 vs. 77.9 mph, P = .92), sliders (83.3 vs. 83.5 mph, P = .88), or change-ups (83.9 vs. 83.8 mph, P = .96). When the percentage of pitches thrown was evaluated, UCL reconstructed pitchers pitch significantly more fastballs than controls (46.7% vs. 39.4%, P = .035). This correlated to a 2% increase in risk for UCL injury for every 1% increase in fastballs thrown. Pitching more than 48% fastballs was a significant predictor of UCL injury, because pitchers over this threshold required reconstruction (P = .006). MLB pitchers requiring UCL reconstruction do not pitch at higher velocities than matched controls, and pitch velocity does not appear to be a risk factor for UCL reconstruction. However, MLB pitchers who pitch a high percentage of fastballs may be at increased risk for UCL injury because pitching a higher percent of fastballs appears to be a risk factor for UCL reconstruction. Copyright © 2016 Journal of Shoulder and Elbow Surgery Board of Trustees. Published by Elsevier Inc. All rights reserved.

  13. Interpreting English Pitch Contours in Context

    OpenAIRE

    Schloeder, Julian; Lascarides, Alex

    2015-01-01

    This paper presents a model of how pitch contours influence the illocutionary and perlocutionary effects of utterances in conversation. Our account is grounded in several insights from the prior literature. Our distinctive contribution is to replace earlier informal claims about the implicatures arising from intonation with logical derivations: we validate inferences in the SDRT framework that resolve the partial meaning we associate with a pitch contour to different specific interpretations ...

  14. Wavelet Scattering on the Pitch Spiral

    OpenAIRE

    Lostanlen, Vincent; Mallat, Stéphane

    2016-01-01

    We present a new representation of harmonic sounds that linearizes the dynamics of pitch and spectral envelope, while remaining stable to deformations in the time-frequency plane. It is an instance of the scattering transform, a generic operator which cascades wavelet convolutions and modulus nonlinearities. It is derived from the pitch spiral, in that convolutions are successively performed in time, log-frequency, and octave index. We give a closed-form approximation of spiral scattering coe...

  15. Effects of culture on musical pitch perception.

    Directory of Open Access Journals (Sweden)

    Patrick C M Wong

    Full Text Available The strong association between music and speech has been supported by recent research focusing on musicians' superior abilities in second language learning and neural encoding of foreign speech sounds. However, evidence for a double association--the influence of linguistic background on music pitch processing and disorders--remains elusive. Because languages differ in their usage of elements (e.g., pitch that are also essential for music, a unique opportunity for examining such language-to-music associations comes from a cross-cultural (linguistic comparison of congenital amusia, a neurogenetic disorder affecting the music (pitch and rhythm processing of about 5% of the Western population. In the present study, two populations (Hong Kong and Canada were compared. One spoke a tone language in which differences in voice pitch correspond to differences in word meaning (in Hong Kong Cantonese, /si/ means 'teacher' and 'to try' when spoken in a high and mid pitch pattern, respectively. Using the On-line Identification Test of Congenital Amusia, we found Cantonese speakers as a group tend to show enhanced pitch perception ability compared to speakers of Canadian French and English (non-tone languages. This enhanced ability occurs in the absence of differences in rhythmic perception and persists even after relevant factors such as musical background and age were controlled. Following a common definition of amusia (5% of the population, we found Hong Kong pitch amusics also show enhanced pitch abilities relative to their Canadian counterparts. These findings not only provide critical evidence for a double association of music and speech, but also argue for the reconceptualization of communicative disorders within a cultural framework. Along with recent studies documenting cultural differences in visual perception, our auditory evidence challenges the common assumption of universality of basic mental processes and speaks to the domain generality of

  16. Effects of culture on musical pitch perception.

    Science.gov (United States)

    Wong, Patrick C M; Ciocca, Valter; Chan, Alice H D; Ha, Louisa Y Y; Tan, Li-Hai; Peretz, Isabelle

    2012-01-01

    The strong association between music and speech has been supported by recent research focusing on musicians' superior abilities in second language learning and neural encoding of foreign speech sounds. However, evidence for a double association--the influence of linguistic background on music pitch processing and disorders--remains elusive. Because languages differ in their usage of elements (e.g., pitch) that are also essential for music, a unique opportunity for examining such language-to-music associations comes from a cross-cultural (linguistic) comparison of congenital amusia, a neurogenetic disorder affecting the music (pitch and rhythm) processing of about 5% of the Western population. In the present study, two populations (Hong Kong and Canada) were compared. One spoke a tone language in which differences in voice pitch correspond to differences in word meaning (in Hong Kong Cantonese, /si/ means 'teacher' and 'to try' when spoken in a high and mid pitch pattern, respectively). Using the On-line Identification Test of Congenital Amusia, we found Cantonese speakers as a group tend to show enhanced pitch perception ability compared to speakers of Canadian French and English (non-tone languages). This enhanced ability occurs in the absence of differences in rhythmic perception and persists even after relevant factors such as musical background and age were controlled. Following a common definition of amusia (5% of the population), we found Hong Kong pitch amusics also show enhanced pitch abilities relative to their Canadian counterparts. These findings not only provide critical evidence for a double association of music and speech, but also argue for the reconceptualization of communicative disorders within a cultural framework. Along with recent studies documenting cultural differences in visual perception, our auditory evidence challenges the common assumption of universality of basic mental processes and speaks to the domain generality of culture

  17. Perceptual pitch deficits coexist with pitch production difficulties in music but not Mandarin speech.

    Science.gov (United States)

    Yang, Wu-Xia; Feng, Jie; Huang, Wan-Ting; Zhang, Cheng-Xiang; Nan, Yun

    2013-01-01

    Congenital amusia is a musical disorder that mainly affects pitch perception. Among Mandarin speakers, some amusics also have difficulties in processing lexical tones (tone agnosics). To examine to what extent these perceptual deficits may be related to pitch production impairments in music and Mandarin speech, eight amusics, eight tone agnosics, and 12 age- and IQ-matched normal native Mandarin speakers were asked to imitate music note sequences and Mandarin words of comparable lengths. The results indicated that both the amusics and tone agnosics underperformed the controls on musical pitch production. However, tone agnosics performed no worse than the amusics, suggesting that lexical tone perception deficits may not aggravate musical pitch production difficulties. Moreover, these three groups were all able to imitate lexical tones with perfect intelligibility. Taken together, the current study shows that perceptual musical pitch and lexical tone deficits might coexist with musical pitch production difficulties. But at the same time these perceptual pitch deficits might not affect lexical tone production or the intelligibility of the speech words that were produced. The perception-production relationship for pitch among individuals with perceptual pitch deficits may be, therefore, domain-dependent.

  18. Determination of football pitch locations from video footage and official pitch markings.

    Science.gov (United States)

    Alcock, Alison; Hunter, Adam; Brown, Nicholas

    2009-06-01

    The ability to determine a specific location on a football (soccer) pitch from television footage would provide a cost-effective method of obtaining competition-specific information on many professional and international teams. This study presents the accuracy and reliability of a new method of calculating ball location from simulated television coverage and known pitch markings. The coordinates of 99 markers of known location on a football pitch were digitized from video. An intersection point was determined from the equations of two lines that form pitch markings and the relationship from this point to other known pitch coordinates was calculated using a curve-fitting based method. Average error between known and reconstructed measures was 0.21 m for pitch width and 0.11 m for pitch length from a view simulating television coverage. Inter- and intra-rater reliability analyses showed researchers could consistently reconstruct pitch locations to within less than half a metre. The accuracy and reliability of this method will be sufficient for most practical uses in an applied sport environment, although the level of accuracy required will depend on the specific application. This method could be applied to other sports to determine specific locations on a pitch or court or to improve current competition analysis systems.

  19. Perceptual Pitch Deficits Coexist with Pitch Production Difficulties in Music but Not Mandarin Speech

    Directory of Open Access Journals (Sweden)

    Wu-xia eYang

    2014-01-01

    Full Text Available Congenital amusia is a musical disorder that mainly affects pitch perception. Among Mandarin speakers, some amusics also have difficulties in processing lexical tones (tone agnosics. To examine to what extent these perceptual deficits may be related to pitch production impairments in music and Mandarin speech, 8 amusics, 8 tone agnosics, and 12 age- and IQ-matched normal native Mandarin speakers were asked to imitate music note sequences and Mandarin words of comparable lengths. The results indicated that both the amusics and tone agnosics underperformed the controls on musical pitch production. However, tone agnosics performed no worse than the amusics, suggesting that lexical tone perception deficits may not aggravate musical pitch production difficulties. Moreover, these three groups were all able to imitate lexical tones with perfect intelligibility. Taken together, the current study shows that perceptual musical pitch and lexical tone deficits might coexist with musical pitch production difficulties. But at the same time these perceptual pitch deficits might not affect lexical tone production or the intelligibility of the speech words that were produced. The perception-production relationship for pitch among individuals with perceptual pitch deficits may be, therefore, domain-dependent.

  20. Familiarity and preference for pitch probability profiles.

    Science.gov (United States)

    Cui, Anja-Xiaoxing; Collett, Meghan J; Troje, Niko F; Cuddy, Lola L

    2015-05-01

    We investigated familiarity and preference judgments of participants toward a novel musical system. We exposed participants to tone sequences generated from a novel pitch probability profile. Afterward, we either asked participants to identify more familiar or we asked participants to identify preferred tone sequences in a two-alternative forced-choice task. The task paired a tone sequence generated from the pitch probability profile they had been exposed to and a tone sequence generated from another pitch probability profile at three levels of distinctiveness. We found that participants identified tone sequences as more familiar if they were generated from the same pitch probability profile which they had been exposed to. However, participants did not prefer these tone sequences. We interpret this relationship between familiarity and preference to be consistent with an inverted U-shaped relationship between knowledge and affect. The fact that participants identified tone sequences as even more familiar if they were generated from the more distinctive (caricatured) version of the pitch probability profile which they had been exposed to suggests that the statistical learning of the pitch probability profile is involved in gaining of musical knowledge.

  1. Absolute Memory for Tempo in Musicians and Non-Musicians.

    Science.gov (United States)

    Gratton, Irene; Brandimonte, Maria A; Bruno, Nicola

    2016-01-01

    The ability to remember tempo (the perceived frequency of musical pulse) without external references may be defined, by analogy with the notion of absolute pitch, as absolute tempo (AT). Anecdotal reports and sparse empirical evidence suggest that at least some individuals possess AT. However, to our knowledge, no systematic assessments of AT have been performed using laboratory tasks comparable to those assessing absolute pitch. In the present study, we operationalize AT as the ability to identify and reproduce tempo in the absence of rhythmic or melodic frames of reference and assess these abilities in musically trained and untrained participants. We asked 15 musicians and 15 non-musicians to listen to a seven-step `tempo scale' of metronome beats, each associated to a numerical label, and then to perform two memory tasks. In the first task, participants heard one of the tempi and attempted to report the correct label (identification task), in the second, they saw one label and attempted to tap the correct tempo (production task). A musical and visual excerpt was presented between successive trials as a distractor to prevent participants from using previous tempi as anchors. Thus, participants needed to encode tempo information with the corresponding label, store the information, and recall it to give the response. We found that more than half were able to perform above chance in at least one of the tasks, and that musical training differentiated between participants in identification, but not in production. These results suggest that AT is relatively wide-spread, relatively independent of musical training in tempo production, but further refined by training in tempo identification. We propose that at least in production, the underlying motor representations are related to tactus, a basic internal rhythmic period that may provide a body-based reference for encoding tempo.

  2. Effect of Tube Pitch on Pool Boiling Heat Transfer of Vertical Tube Bundle

    International Nuclear Information System (INIS)

    Kang, Myeong Gie

    2016-01-01

    Summarizing the previous results it can be stated that heat transfer coefficients are highly dependent on the tube pitch and the heat flux of the relevant tube. The published results are mostly about the horizontal tubes. However, there are many heat exchangers consisting of vertical tubes like AP600. Therefore, the focus of the present study is an identification of the effects of a tube pitch as well as the heat flux of a relevant tube on the heat transfer of a tube bundle installed vertically. When the heat flux is increased many bubbles are generating due to the increase of the nucleation sites. The bubbles become coalescing with the nearby bubbles and generates big bunches of bubbles on the tube surface. This prevents the access of the liquid to the surface and deteriorates heat transfer. The bubble coalescence is competing with the mechanisms enhancing heat transfer. The pitch was varied from 28.5 mm to 95 mm and the heat flux of the nearby tube was changed from 0 to 90kW/m 2 . The enhancement of the heat transfer is clearly observed when the heat flux of the nearby tube becomes larger and the heat flux of the upper tube is less than 40kW/m 2 . The effect of the tube pitch on heat transfer is negligible as the value of DP/ is increased more than 4.

  3. Meet the APS Editors Reception

    Science.gov (United States)

    2014-03-01

    The APS Journal Editors invite you to join them for conversation and light refreshments. The Editors will be available to answer questions, discuss your ideas, and listen to your comments about the journals. All are welcome to attend.

  4. AP1000TM plant modularization

    International Nuclear Information System (INIS)

    Cantarero L, C.; Demetri, K. J.; Quintero C, F. P.

    2016-09-01

    The AP1000 TM plant is an 1100 M We pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. Modules are used extensively in the design of the AP1000 plant nuclear island. The AP1000 plant uses modern, modular-construction techniques for plant construction. The design incorporates vendor-designed skids and equipment packages, as well as large, multi-ton structural modules and special equipment modules. Modularization allows traditionally sequential construction tasks to be completed simultaneously. Factory-built modules can be installed at the site in a planned construction schedule. The modularized AP1000 plant allows many more construction activities to proceed in parallel. This reduces plant construction calendar time, thus lowering the costs of plant financing. Furthermore, performing less work onsite significantly reduces the amount of skilled field-craft labor, which costs more than shop labor. In addition to labor cost savings, doing more welding and fabrication in a factory environment raises the quality of work, allowing more scheduling flexibility and reducing the amount of specialized tools required onsite. The site layout for the AP1000 plant has been established to support modular construction and efficient operations during construction. The plant layout is compact, using less space than previous conventional plant layouts. This paper provides and overview of the AP1000 plant modules with an emphasis on structural modules. Currently the Westinghouse AP1000 plant has four units under construction in China and four units under construction in the United States. All have shown successful fabrication and installation of various AP1000 plant modules. (Author)

  5. Adaptive back-stepping pitch angle control for wind turbine based on a new electro-hydraulic pitch system

    Science.gov (United States)

    Yin, Xiu-xing; Lin, Yong-gang; Li, Wei; Gu, Ya-jing; Lei, Peng-fei; Liu, Hong-wei

    2015-11-01

    A new electro-hydraulic pitch system is proposed to smooth the output power and drive-train torque fluctuations for wind turbine. This new pitch system employs a servo-valve-controlled hydraulic motor to enhance pitch control performances. This pitch system is represented by a state-space model with parametric uncertainties and nonlinearities. An adaptive back-stepping pitch angle controller is synthesised based on this state-space model to accurately achieve the desired pitch angle control regardless of such uncertainties and nonlinearities. This pitch angle controller includes a back-stepping procedure and an adaption law to deal with such uncertainties and nonlinearities and hence to improve the final pitch control performances. The proposed pitch system and the designed pitch angle controller have been validated for achievable and efficient power and torque regulation performances by comparative experimental results under various operating conditions.

  6. Pitch-verticality and pitch-size cross-modal interactions

    DEFF Research Database (Denmark)

    Bonetti, Leonardo; Costa, Marco

    2017-01-01

    Two studies were conducted on cross-modal matching between pitch and sound source localization on the vertical axis, and pitch and size. In the first study 100 Hz, 200 Hz, 600 Hz, and 800 Hz tones were emitted by a loudspeaker positioned 60 cm above or below to the participant’s ear level. Using...

  7. Memory for pitch in congenital amusia: beyond a fine-grained pitch discrimination problem.

    Science.gov (United States)

    Williamson, Victoria Jane; Stewart, Lauren

    2010-08-01

    Congenital amusia is a disorder that affects the perception and production of music. While amusia has been associated with deficits in pitch discrimination, several reports suggest that memory deficits also play a role. The present study investigated short-term memory span for pitch-based and verbal information in 14 individuals with amusia and matched controls. Analogous adaptive-tracking procedures were used to generate tone and digit spans using stimuli that exceeded psychophysically measured pitch perception thresholds. Individuals with amusia had significantly smaller tone spans, whereas their digits spans were a similar size to those of controls. An automated operation span task was used to determine working memory capacity. Working memory deficits were seen in only a small subgroup of individuals with amusia. These findings support the existence of a pitch-specific component within short-term memory and suggest that congenital amusia is more than a disorder of fine-grained pitch discrimination.

  8. Method of producing pitch (distillation residue)

    Energy Technology Data Exchange (ETDEWEB)

    Stepanenko, M.A.; Belkina, T.V.; Krysin, V.P.

    1979-08-15

    A method is proposed for producing pitch by mixing hard coal pitch with anthracene fraction and thermal treatment of the mixture. The method is distinguished in that in order to increase the quality of the pitch, the anthracene fraction is subjected to thermal treatment at 250-300/sup 0/ for 10-13 hours in the presence of air. This duration of heat treatment allows one to build up in the anthracene fraction up to 20-24% of material which is not soluble and toluene, without the formation of products which are not soluble in quinoline. The fraction prepared in this manner is inserted into the initial pitch in the ratio 1:2 up to 1:9, the mixture is subject to heat treatment at temperature 360-380/sup 0/ and air consumption 7-91/kgX hours until the production of pitch with softening temperature of 85-90/sup 0/. As the initial raw material we used pitch with softening temperature of 60/sup 0/, content of substances which are not soluble in quinoline, 2.0% which are not soluble and toluene 20.6% and coking residue of 49.2%. Example. 80 grams of anthracene fraction is added to 320 grams of pitch. The anthracene fraction is subjected previously to heat treatment at 300/sup 0/ for 13 hours in the presence of air, supplied in the amount of 9 liters per hour. As a result of the heat treatment of the content of materials which are not soluble in toluence in the anthracene fraction is 24.0%, in quinoline it is 0.1%. The ratio of a pitch and thermally treated anthracene fraction in the mixture was 4:l. The produced mixture was subjected to heat treatment at 360/sup 0/ for 1.5 hours with air supply in the amount of 7 liters/ kilograms/hours. Pitch is produced with the following characteristics: softening temperature 88/sup 0/, content of substances which are not soluble in toluene 32.5%, in quinilone, 6.0%, coking residue, 56.7%. The invention can be used in the chemical coking and petrochemical industry.

  9. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (I): catastrophic APS, APS nephropathy and heart valve lesions.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyse the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analysed on the catastrophic APS, APS nephropathy and heart valve lesions, and presents the recommendations elaborated by the Task Force after this analysis.

  10. Pitch perception deficits in nonverbal learning disability.

    Science.gov (United States)

    Fernández-Prieto, I; Caprile, C; Tinoco-González, D; Ristol-Orriols, B; López-Sala, A; Póo-Argüelles, P; Pons, F; Navarra, J

    2016-12-01

    The nonverbal learning disability (NLD) is a neurological dysfunction that affects cognitive functions predominantly related to the right hemisphere such as spatial and abstract reasoning. Previous evidence in healthy adults suggests that acoustic pitch (i.e., the relative difference in frequency between sounds) is, under certain conditions, encoded in specific areas of the right hemisphere that also encode the spatial elevation of external objects (e.g., high vs. low position). Taking this evidence into account, we explored the perception of pitch in preadolescents and adolescents with NLD and in a group of healthy participants matched by age, gender, musical knowledge and handedness. Participants performed four speeded tests: a stimulus detection test and three perceptual categorization tests based on colour, spatial position and pitch. Results revealed that both groups were equally fast at detecting visual targets and categorizing visual stimuli according to their colour. In contrast, the NLD group showed slower responses than the control group when categorizing space (direction of a visual object) and pitch (direction of a change in sound frequency). This pattern of results suggests the presence of a subtle deficit at judging pitch in NLD along with the traditionally-described difficulties in spatial processing. Copyright © 2016. Published by Elsevier Ltd.

  11. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  12. [Apheresis in antiphospholipid syndrome (APS)].

    Science.gov (United States)

    De Silvestro, Giustina; Tison, Tiziana; Marson, Piero

    2012-01-01

    Antiphospholipid syndrome (APS) is a rare clinical disorder characterized by thromboembolic manifestations and/or obstetric complications. Along with the clinical symptoms and signs, serum antiphospholipid antibodies have to be detected. APS can be primary, i.e., without any concomitant disorders, or secondary to other autoimmune diseases, particularly systemic lupus erythematosus. Criteria for the diagnosis of APS have been clearly established. Hyperacute APS (or catastrophic antiphospholipid syndrome), often with a poor prognosis, must meet four criteria: involvement of three or more organs, rapid evolution of clinical manifestations, microangiopathic occlusion of small blood vessels at biopsy, and presence of antiphospholipid antibodies. The rationale for apheresis treatment is the removal of pathogenetic antibodies involved in the development of tissue damage. Our experience includes 23 patients, in particular 15 women treated for 19 pregnancies. According to the National Guidelines Program, the effectiveness of apheresis in catastrophic syndrome has a level of evidence of V/VI, with a strength of recommendation A; in highrisk pregnancy it has a level of evidence of V with a strength of recommendation B. It will be necessary to better define the prognosis of various categories of pregnant patients with APS, as well as useful laboratory parameters to monitor its clinical course and anticipate any complications of pregnancy.

  13. AP Human Geography and Success on the AP Test

    Science.gov (United States)

    Roncone, John; Newhalfen, Nate

    2013-01-01

    Classroom projects that explore culture and globalization enhance the curriculum and help students see how geography directly connects to their lives. These authors contend that a project-based approach can supplement the teaching of an AP Human Geography course, and visualize this course as an essential tool for students to truly understand how…

  14. Effects of harmonic roving on pitch discrimination

    DEFF Research Database (Denmark)

    Santurette, Sébastien; de Kérangal, Mathilde le Gal; Joshi, Suyash Narendra

    2015-01-01

    to impair pitch discrimination performance. Fundamental-frequency difference limens (F0DLs) were obtained in normal-hearing listeners with and without musical training for complex tones filtered between 1.5 and 3.5 kHz with F0s of 300 Hz (resolved harmonics) and 75 Hz (unresolved harmonics). The harmonicity...

  15. Control Engineering Analysis of Mechanical Pitch Systems

    Science.gov (United States)

    Bernicke, Olaf; Gauterin, Eckhard; Schulte, Horst; Zajac, Michal

    2014-12-01

    With the help of a local stability analysis the coefficient range of a discrete damper, used for centrifugal forced, mechanical pitch system of small wind turbines (SWT), is gained for equilibrium points. - By a global stability analysis the gained coefficient range can be validated. An appropriate approach by Takagi-Sugeno is presented in the paper.

  16. Coal Tar and Coal-Tar Pitch

    Science.gov (United States)

    Learn about coal-tar products, which can raise your risk of skin cancer, lung cancer, and other types of cancer. Examples of coal-tar products include creosote, coal-tar pitch, and certain preparations used to treat skin conditions such as eczema, psoriasis, and dandruff.

  17. Adaptive pitch control for variable speed wind turbines

    Science.gov (United States)

    Johnson, Kathryn E [Boulder, CO; Fingersh, Lee Jay [Westminster, CO

    2012-05-08

    An adaptive method for adjusting blade pitch angle, and controllers implementing such a method, for achieving higher power coefficients. Average power coefficients are determined for first and second periods of operation for the wind turbine. When the average power coefficient for the second time period is larger than for the first, a pitch increment, which may be generated based on the power coefficients, is added (or the sign is retained) to the nominal pitch angle value for the wind turbine. When the average power coefficient for the second time period is less than for the first, the pitch increment is subtracted (or the sign is changed). A control signal is generated based on the adapted pitch angle value and sent to blade pitch actuators that act to change the pitch angle of the wind turbine to the new or modified pitch angle setting, and this process is iteratively performed.

  18. APS beamline standard components handbook

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.

    1992-01-01

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction.

  19. APS beamline standard components handbook

    International Nuclear Information System (INIS)

    Kuzay, T.M.

    1992-01-01

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

  20. Contour identification with pitch and loudness cues using cochlear implants

    OpenAIRE

    Luo, Xin; Masterson, Megan E.; Wu, Ching-Chih

    2013-01-01

    Different from speech, pitch and loudness cues may or may not co-vary in music. Cochlear implant (CI) users with poor pitch perception may use loudness contour cues more than normal-hearing (NH) listeners. Contour identification was tested in CI users and NH listeners; the five-note contours contained either pitch cues alone, loudness cues alone, or both. Results showed that NH listeners' contour identification was better with pitch cues than with loudness cues; CI users performed similarly w...

  1. Absolute metrology for space interferometers

    Science.gov (United States)

    Salvadé, Yves; Courteville, Alain; Dändliker, René

    2017-11-01

    The crucial issue of space-based interferometers is the laser interferometric metrology systems to monitor with very high accuracy optical path differences. Although classical high-resolution laser interferometers using a single wavelength are well developed, this type of incremental interferometer has a severe drawback: any interruption of the interferometer signal results in the loss of the zero reference, which requires a new calibration, starting at zero optical path difference. We propose in this paper an absolute metrology system based on multiplewavelength interferometry.

  2. Dynamic characteristics of peripheral jet ACV. II - Pitching motion

    Science.gov (United States)

    Mori, T.; Maeda, H.

    The dynamic pitching characteristics of peripheral jet ACV (Air Cushion Vehicle) which have a stability curtain are investigated analytically and experimentally. The measured values of moment, lift and cushion pressure are compared with numerical results noting applicability to the pitching motion. The response of ACV to the sinusoidal pitching oscillation of the ground is also studied.

  3. Characterization of Graphitization in Coal Tar and Petroleum Pitches.

    Science.gov (United States)

    1985-08-01

    oven gas," composed mainly of hydrogen and methane. Some organic material still remains in the coal after the coke - oven gas is - driven off. Further...we will be concentrating on coal -tar and petroleum pitch sources (1). Pyrolysis Pyrolyzation, or pitch-to- coke transformation, takes place very...4 Pitch...........................6 Pyrolysis ..................................... 7 Coke ..........................................17 Carbonization

  4. Radiation effects on active pixel sensors (APS)

    International Nuclear Information System (INIS)

    Cohen, M.; David, J.P.

    1999-01-01

    Active pixel sensor (APS) is a new generation of image sensors which presents several advantages relatively to charge coupled devices (CCDs) particularly for space applications (APS requires only 1 voltage to operate which reduces considerably current consumption). Irradiation was performed using 60 Co gamma radiation at room temperature and at a dose rate of 150 Gy(Si)/h. 2 types of APS have been tested: photodiode-APS and photoMOS-APS. The results show that photoMOS-APS is more sensitive to radiation effects than photodiode-APS. Important parameters of image sensors like dark currents increase sharply with dose levels. Nevertheless photodiode-APS sensitivity is one hundred time lower than photoMOS-APS sensitivity

  5. Absolute MR thermometry using nanocarriers.

    Science.gov (United States)

    Deckers, Roel; Sprinkhuizen, Sara M; Crielaard, Bart J; Ippel, Johannes H; Boelens, Rolf; Bakker, Chris J G; Storm, Gert; Lammers, Twan; Bartels, Lambertus W

    2014-01-01

    Accurate time-resolved temperature mapping is crucial for the safe use of hyperthermia-mediated drug delivery. We here propose a magnetic resonance imaging temperature mapping method in which drug delivery systems serve not only to improve tumor targeting, but also as an accurate and absolute nano-thermometer. This method is based on the temperature-dependent chemical shift difference between water protons and the protons in different groups of drug delivery systems. We show that the chemical shift of the protons in the ethylene oxide group in polyethylene glycol (PEG) is temperature-independent, whereas the proton resonance of water decreases with increasing temperature. The frequency difference between both resonances is linear and does not depend on pH and physiological salt conditions. In addition, we show that the proton resonance of the methyl group in N-(2-hydroxypropyl)-methacrylamide (HPMA) is temperature-independent. Therefore, PEGylated liposomes, polymeric mPEG-b-pHPMAm-Lac2 micelles and HPMA copolymers can provide a temperature-independent reference frequency for absolute magnetic resonance (MR) thermometry. Subsequently, we show that multigradient echo MR imaging with PEGylated liposomes in situ allows accurate, time-resolved temperature mapping. In conclusion, nanocarrier materials may serve as highly versatile tools for tumor-targeted drug delivery, acting not only as hyperthermia-responsive drug delivery systems, but also as accurate and precise nano-thermometers. Copyright © 2014 John Wiley & Sons, Ltd.

  6. Early processing of pitch in the human auditory system.

    Science.gov (United States)

    Alho, Kimmo; Grimm, Sabine; Mateo-León, Sabina; Costa-Faidella, Jordi; Escera, Carles

    2012-10-01

    Middle-latency auditory evoked potentials, indicating early cortical processing, elicited by pitch changes and repetitions in pure tones and by complex tones with a missing-fundamental pitch were recorded in healthy adults ignoring the sounds while watching a silenced movie. Both for the pure and for the missing-fundamental tones, the Nb middle-latency response was larger for pitch changes (tones preceded by tones of different pitch) than for pitch repetitions (tones preceded by tones of the same pitch). This Nb enhancement was observed even for missing-fundamental tones preceded by repeated tones that had a different missing-fundamental pitch but included all harmonics of the subsequent tone with another missing-fundamental pitch. This finding rules out the possibility that the Nb enhancement in response to a change in missing-fundamental pitch was simply attributable to the activity of auditory cortex neurons responding specifically to the harmonics of missing-fundamental tones. The Nb effect presumably indicates pitch processing at or near the primary auditory cortex, and it was followed by a change-related enhancement of the N1 response, presumably generated in the secondary auditory cortex. This N1 enhancement might have been caused by a mismatch negativity response overlapping with the N1 response. Processing of missing-fundamental pitch was also reflected by the distribution of Nb responses. Tones with a higher missing-fundamental pitch elicited more frontally dominant Nb responses than tones with a lower missing-fundamental pitch. This effect of pitch, not seen for the pure tones, might indicate that the exact location of the Nb generator source in the auditory cortex depends on the missing-fundamental pitch of the eliciting tone. © 2012 The Authors. European Journal of Neuroscience © 2012 Federation of European Neuroscience Societies and Blackwell Publishing Ltd.

  7. Attending to pitch information inhibits processing of pitch information: the curious case of amusia.

    Science.gov (United States)

    Zendel, Benjamin Rich; Lagrois, Marie-Élaine; Robitaille, Nicolas; Peretz, Isabelle

    2015-03-04

    In normal listeners, the tonal rules of music guide musical expectancy. In a minority of individuals, known as amusics, the processing of tonality is disordered, which results in severe musical deficits. It has been shown that the tonal rules of music are neurally encoded, but not consciously available in amusics. Previous neurophysiological studies have not explicitly controlled the level of attention in tasks where participants ignored the tonal structure of the stimuli. Here, we test whether access to tonal knowledge can be demonstrated in congenital amusia when attention is controlled. Electric brain responses were recorded while asking participants to detect an individually adjusted near-threshold click in a melody. In half the melodies, a note was inserted that violated the tonal rules of music. In a second task, participants were presented with the same melodies but were required to detect the tonal deviation. Both tasks required sustained attention, thus conscious access to the rules of tonality was manipulated. In the click-detection task, the pitch deviants evoked an early right anterior negativity (ERAN) in both groups. In the pitch-detection task, the pitch deviants evoked an ERAN and P600 in controls but not in amusics. These results indicate that pitch regularities are represented in the cortex of amusics, but are not consciously available. Moreover, performing a pitch-judgment task eliminated the ERAN in amusics, suggesting that attending to pitch information interferes with perception of pitch. We propose that an impaired top-down frontotemporal projection is responsible for this disorder. Copyright © 2015 the authors 0270-6474/15/353815-10$15.00/0.

  8. Airfoil Pitch Control Using Trapped Vorticity Concentrations

    Science.gov (United States)

    Brzozowski, Daniel; Culp, John; Glezer, Ari

    2007-11-01

    Closed-loop feedback control of the attitude of a free pitching airfoil is effected without moving control surfaces by alternate actuation of nominally-symmetric trapped vorticity concentrations on the suction and pressure surfaces near the trailing edge. The pitching moment is varied with minimal lift and drag penalties over a broad range of angles of attack when the baseline flow is fully attached. Accumulation (trapping) and regulation of vorticity is managed by integrated hybrid actuators (each comprised of a miniature [O(0.01c)] obstruction and a synthetic jet actuator). In the present work, the model is trimmed using a position feedback loop and a servo motor actuator. Once the model is trimmed, the position feedback loop is opened and the servo motor acts like an inner loop control to alter the model's dynamic characteristics. Position control of the model is achieved using a reference model-based outer loop controller.

  9. Voice pitch influences perceptions of sexual infidelity.

    Science.gov (United States)

    O'Connor, Jillian J M; Re, Daniel E; Feinberg, David R

    2011-02-28

    Sexual infidelity can be costly to members of both the extra-pair and the paired couple. Thus, detecting infidelity risk is potentially adaptive if it aids in avoiding cuckoldry or loss of parental and relationship investment. Among men, testosterone is inversely related to voice pitch, relationship and offspring investment, and is positively related to the pursuit of short-term relationships, including extra-pair sex. Among women, estrogen is positively related to voice pitch, attractiveness, and the likelihood of extra-pair involvement. Although prior work has demonstrated a positive relationship between men's testosterone levels and infidelity, this study is the first to investigate attributions of infidelity as a function of sexual dimorphism in male and female voices. We found that men attributed high infidelity risk to feminized women's voices, but not significantly more often than did women. Women attributed high infidelity risk to masculinized men's voices at significantly higher rates than did men. These data suggest that voice pitch is used as an indicator of sexual strategy in addition to underlying mate value. The aforementioned attributions may be adaptive if they prevent cuckoldry and/or loss of parental and relationship investment via avoidance of partners who may be more likely to be unfaithful.

  10. Voice Pitch Influences Perceptions of Sexual Infidelity

    Directory of Open Access Journals (Sweden)

    Jillian J.M. O'Connor

    2011-01-01

    Full Text Available Sexual infidelity can be costly to members of both the extra-pair and the paired couple. Thus, detecting infidelity risk is potentially adaptive if it aids in avoiding cuckoldry or loss of parental and relationship investment. Among men, testosterone is inversely related to voice pitch, relationship and offspring investment, and is positively related to the pursuit of short-term relationships, including extra-pair sex. Among women, estrogen is positively related to voice pitch, attractiveness, and the likelihood of extra-pair involvement. Although prior work has demonstrated a positive relationship between men's testosterone levels and infidelity, this study is the first to investigate attributions of infidelity as a function of sexual dimorphism in male and female voices. We found that men attributed high infidelity risk to feminized women's voices, but not significantly more often than did women. Women attributed high infidelity risk to masculinized men's voices at significantly higher rates than did men. These data suggest that voice pitch is used as an indicator of sexual strategy in addition to underlying mate value. The aforementioned attributions may be adaptive if they prevent cuckoldry and/or loss of parental and relationship investment via avoidance of partners who may be more likely to be unfaithful.

  11. Analysis of pitch system data for condition monitoring

    DEFF Research Database (Denmark)

    Nielsen, Jannie Sønderkær; van de Pieterman, René P.; Sørensen, John Dalsgaard

    2014-01-01

    Measurements of pitch motor torque and current give indirect information about the condition of the pitch system and can therefore potentially be used for condition-based maintenance. This paper presents an analysis of these measurements for a wind turbine, and the measurements are compared...... at a constant pitch velocity, but the 10 min maximum values are only approximately proportional, because the maximum values occur during acceleration and not simultaneously. These findings are important to consider, if using the pitch motor current or torque as an indicator for the pitch system health...... with a theoretical model based on aeroelastic simulations. The blade moment is found to have only minor influence on the friction in the blade bearing. The main factors affecting the static friction are the temperature and time after the latest pitch movement. Pitch motor current and torque are proportional...

  12. A perceptual pitch boundary in a non-human primate

    Directory of Open Access Journals (Sweden)

    Olivier eJoly

    2014-09-01

    Full Text Available Pitch is an auditory percept critical to the perception of music and speech, and for these harmonic sounds, pitch is closely related to the repetition rate of the acoustic wave. This paper reports a test of the assumption that non-human primates and especially rhesus monkeys perceive the pitch of these harmonic sounds much as humans do. A new procedure was developed to train macaques to discriminate the pitch of harmonic sounds and thereby demonstrate that the lower limit for pitch perception in macaques is close to 30 Hz, as it is in humans. Moreover, when the phases of successive harmonics are alternated to cause a pseudo-doubling of the repetition rate, the lower pitch boundary in macaques decreases substantially, as it does in humans. The results suggest that both species use neural firing times to discriminate pitch, at least for sounds with relatively low repetition rates.

  13. "Absolute" sterility and "absolute" freedom from particle contamination.

    Science.gov (United States)

    Knapp, J Z

    1998-01-01

    Until the recent past, sterility of an injectable product was only discussed in absolute terms. Any description of sterility other than as an absolute could simply not be envisioned. While dealing in absolute yes/no statements is philosophically satisfying, these yes/no statements can't accommodate all real world scientific problems. Among these problems is the sterility problems faced in the mass production of injectable compounds. Many descriptions of procedures employed to achieve sterility in parenteral production batches were reported in the literature. The theoretical framework that could unite the widespread observations and practices into practical methodology was missing until recently. Production line control of the sterility of injectable products was essentially based on gut evaluations. The present achievement of rational, production line control of product sterility is based on the recognition that product sterility could not be simply regarded as a sharply edged yes/no affair. The present rational control is based on the fact that the sterility of a product is determined by the degree of contamination in the product prior to sterilization and to the parameters of the sterilization process. The end result of the sterilization process is now described as a probabalistic reduction of the initial contamination. The essential laboratory measurements on which this conclusion was based is due to Pflug (1-3). He assembled a theoretical framework, based on experimental data, that characterizes the sterility achieved in an injectable product with a single number. The end result of the sterilization process is now described as a probabalistic reduction of the initial contamination. As in many disciplines, the ability to achieve an objective evaluation of this important attribute provided the basis for scientific analysis, improved control and thus improved production and reduced cost. An equivalent framework is essential for the communication and

  14. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  15. Molecular evolution of the AP2 subfamily.

    Science.gov (United States)

    Shigyo, Mikao; Hasebe, Mitsuyasu; Ito, Motomi

    2006-02-01

    The AP2 (APETALA2)/EREBP (Ethylene Responsive Element Binding Protein) multigene family includes developmentally and physiologically important transcription factors. AP2/EREBP genes are divided into two subfamilies: AP2 genes with two AP2 domains and EREBP genes with a single AP2/ERF (Ethylene Responsive Element Binding Factor) domain. Based on previous phylogenetic analyses, AP2 genes can be divided into two clades, AP2 and ANT groups. To clarify the molecular evolution of the AP2 subfamily, we isolated and sequenced genes with two AP2 domains from three gymnosperms, Cycas revoluta, Ginkgo biloba, and Gnetum parvifolium,as well as from the moss Physcomitrella patens. Expressions of AP2-like genes, including AP2, in Arabidopsis thaliana are regulated by the microRNA miR172. We found that the target site of miR172 is significantly conserved in gymnosperm AP2 homologs, suggesting that regulatory mechanisms of gene expression using microRNA have been conserved over the three hundred million years since the divergence of gymnosperm and flowering plant lineages. We inferred a phylogenetic relationship of these genes with the green alga Chlamydomonas reinhardtii and seed-plant genes available in public DNA databases. The phylogenetic tree showed that the AP2 subfamily diverged into the AP2 and ANT groups before the last common ancestor of land plants and after C. reinhardtii diverged from the land-plant lineage. The tree also indicated that each AP2 and ANT group further diverged into several clades through gene duplications prior to the divergence of gymnosperms and angiosperms.

  16. Fellow's Apéro

    CERN Document Server

    Staff Association

    2017-01-01

    Let's get together, meet each other, exchange experiences and ideas, and share useful information on CERN and the Staff Association. Join us for Fellow's Apéro, organised by the Staff Association on Tuesday 21 February at 16.30 in Restaurant 1. There will be drinks and snacks for everybody! We look forward to seeing you there! Please confirm your participation on Doodle http://doodle.com/poll/skvm7ucm2z78i6bt or alternatively on Facebook https://www.facebook.com/events/1862757017340069/. Your delegates in the Staff Association, Barbora & Jiri

  17. [Factors influencing the pitch and loudness of tinnitus].

    Science.gov (United States)

    Ueda, S; Asoh, S; Watanabe, Y

    1992-11-01

    Pitch match and loudness balance tests were given to 397 cases with tinnitus. The factors which influenced tinnitus pitch and loudness were analyzed statistically from the clinical point of view. The results obtained were as follows: 1) Onomatopoeia of tinnitus, either [Keeeen] or [Jeeeen], were observed in a majority of cases. 2) Significantly sharp sounding onomatopoeia such as [Keeeen] or [Meeeen] had high pitches, over 4kHz, and dull sounds like [Gooooh] or [Buuuun] had low pitches, below 500Hz. 3) Acute stage tinnitus, within one month of onset, had a significantly depressed pitch and walked loudness, above 6dB. 4) The pitches observed in cases with Meniere's disease and chronic otitis media were distributed evenly from low frequencies to high. In other cases, especially presbyacusis and noise deafness, high pitch tinnitus (above 4kHz) was frequently noted. The loudness of tinnitus without hearing loss was significantly greater than in other diseases. 5) As a rule the more deteriorated the hearing level was, the lower the frequency of the pitch, and the smaller the loudness in tinnitus. 6) A high pitch of tinnitus nearly corresponded with hearing type, that is, the pitch of tinnitus was also in accordance with the disturbed frequency in the hearing threshold.

  18. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  19. High accuracy absolute distance metrology

    Science.gov (United States)

    Swinkels, Bas L.; Bhattacharya, Nandini; Verlaan, Ad L.; Braat, Joseph J. M.

    2017-11-01

    One of ESA's future missions is the Darwin Space Interferometer, which aims to detect planets around nearby stars using optical aperture synthesis with free-flying telescopes. Since this involves interfering white (infra-red) light over large distances, the mission is not possible without a complex metrology system that monitors various speeds, distances and angles between the satellites. One of its sub-systems should measure absolute distances with an accuracy of around 70 micrometer over distances up to 250 meter. To enable such measurements, we are investigating a technique called frequency sweeping interferometry, in which a single laser is swept over a large known frequency range. Central to our approach is the use of a very stable, high finesse Fabry-Ṕerot cavity, to which the laser is stabilized at the endpoints of the frequency sweep. We will discuss the optical set-up, the control system that controls the fast sweeping, the calibration and the data analysis. We tested the system using long fibers and achieved a repeatability of 50 micrometers at a distance of 55 meters. We conclude with some recommendations for further improvements and the adaption for use in space.

  20. Finger forces in fastball baseball pitching.

    Science.gov (United States)

    Kinoshita, Hiroshi; Obata, Satoshi; Nasu, Daiki; Kadota, Koji; Matsuo, Tomoyuki; Fleisig, Glenn S

    2017-08-01

    Forces imparted by the fingers onto a baseball are the final, critical aspects for pitching, however these forces have not been quantified previously as no biomechanical technology was available. In this study, an instrumented baseball was developed for direct measurement of ball reaction force by individual fingers and used to provide fundamental information on the forces during a fastball pitch. A tri-axial force transducer with a cable having an easily-detachable connector were installed in an official baseball. Data were collected from 11 pitchers who placed the fingertip of their index, middle, ring, or thumb on the transducer, and threw four-seam fastballs to a target cage from a flat mound. For the index and middle fingers, resultant ball reaction force exhibited a bimodal pattern with initial and second peaks at 38-39ms and 6-7ms before ball release, and their amplitudes were around 97N each. The ring finger and thumb produced single-peak forces of approximately 50 and 83N, respectively. Shear forces for the index and middle fingers formed distinct peak at 4-5ms before release, and the peaks summed to 102N; a kinetic source for backspin on the ball. An additional experiment with submaximal pitching effort showed a linear relationship of peak forces with ball velocity. The peak ball reaction force for fastballs exceeded 80% of maximum finger strength measured, suggesting that strengthening of the distal muscles is important both for enhancing performance and for avoiding injuries. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. How to pitch a brilliant idea.

    Science.gov (United States)

    Elsbach, Kimberly D

    2003-09-01

    Coming up with creative ideas is easy; selling them to strangers is hard. Entrepreneurs, sales executives, and marketing managers often go to great lengths to demonstrate how their new concepts are practical and profitable--only to be rejected by corporate decision makers who don't seem to understand the value of the ideas. Why does this happen? Having studied Hollywood executives who assess screenplay pitches, the author says the person on the receiving end--the "catcher"--tends to gauge the pitcher's creativity as well as the proposal itself. An impression of the pitcher's ability to come up with workable ideas can quickly and permanently overshadow the catcher's feelings about an idea's worth. To determine whether these observations apply to business settings beyond Hollywood, the author attended product design, marketing, and venture-capital pitch sessions and conducted interviews with executives responsible for judging new ideas. The results in those environments were similar to her observations in Hollywood, she says. Catchers subconsciously categorize successful pitchers as showrunners (smooth and professional), artists (quirky and unpolished), or neophytes (inexperienced and naive). The research also reveals that catchers tend to respond well when they believe they are participating in an idea's development. As Oscar-winning writer, director, and producer Oliver Stone puts it, screen-writers pitching an idea should "pull back and project what he needs onto your idea in order to make the story whole for him." To become a successful pitcher, portray yourself as one of the three creative types and engage your catchers in the creative process. By finding ways to give your catchers a chance to shine, you sell yourself as a likable collaborator.

  2. APS high heat load monochromator

    International Nuclear Information System (INIS)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach

  3. APS high heat load monochromator

    Energy Technology Data Exchange (ETDEWEB)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach.

  4. Tiles CMUT dies with pitch uniformity

    OpenAIRE

    Sudol, W.; Dirksen, P.; Henneken, V.A.; Dekker, R.; Louwerse, M.C.

    2016-01-01

    A large aperture CMUT transducer array is formed of a plurality of adjacently located tiles of CMUT cells. The adjacent edges of the tiles are formed by an anisotropic etch process, preferably a deep reactive ion etching process which is capable of cutting through the die and its substrate while maintaining vertical edges in close proximity to the CMUT cells at the edge of the tile. This enables the CMUT cells of continuous rows or columns to exhibit a constant pitch over multiple CMUT cell t...

  5. Analysis of Pitch Gear Deterioration using Indicators

    DEFF Research Database (Denmark)

    Nielsen, Jannie Jessen; Sørensen, John Dalsgaard

    2011-01-01

    of the damage, and can be used for Bayesian updating of a damage model used for risk-based decision making. For this decision problem, the risk of failure should be compared to the cost of preventive maintenance. The hypothesis that the maximum pitch motor torque is an indicator of the damage size is supported...... by results from a measurement campaign where measurements are available both before and after maintenance was performed. The loads dramatically decreased after the maintenance. However, after a few more months of measurements, and by including data from the SCADA system, it became obvious that seasonal...

  6. Relating binaural pitch perception to the individual listener's auditory profile

    DEFF Research Database (Denmark)

    Santurette, Sébastien; Dau, Torsten

    2012-01-01

    The ability of eight normal-hearing listeners and fourteen listeners with sensorineural hearing loss to detect and identify pitch contours was measured for binaural-pitch stimuli and salience-matched monaurally detectable pitches. In an effort to determine whether impaired binaural pitch perception...... was linked to a specific deficit, the auditory profiles of the individual listeners were characterized using measures of loudness perception, cognitive ability, binaural processing, temporal fine structure processing, and frequency selectivity, in addition to common audiometric measures. Two of the listeners...... sensation coexisted with a loss of a binaural signal-detection advantage in noise, without implying reduced cognitive function. Auditory filter bandwidths did not correlate with the difference in pitch identification scores between binaural and monaural pitches. However, subjects with impaired binaural...

  7. Robust Pitch Estimation Using an Optimal Filter on Frequency Estimates

    DEFF Research Database (Denmark)

    Karimian-Azari, Sam; Jensen, Jesper Rindom; Christensen, Mads Græsbøll

    2014-01-01

    In many scenarios, a periodic signal of interest is often contaminated by different types of noise that may render many existing pitch estimation methods suboptimal, e.g., due to an incorrect white Gaussian noise assumption. In this paper, a method is established to estimate the pitch of such sig......In many scenarios, a periodic signal of interest is often contaminated by different types of noise that may render many existing pitch estimation methods suboptimal, e.g., due to an incorrect white Gaussian noise assumption. In this paper, a method is established to estimate the pitch...... against different noise situations. The simulation results confirm that the proposed MVDR method outperforms the state-of-the-art weighted least squares (WLS) pitch estimator in colored noise and has robust pitch estimates against missing harmonics in some time-frames....

  8. Target pitch angle for the microburst escape maneuver

    Science.gov (United States)

    Mulgund, Sandeep S.; Stengel, Robert F.

    1992-01-01

    Recovery performance of a commuter-type aircraft in a microburst encounter is studied using a constant-pitch-attitude strategy and flight path optimization. Results obtained indicate that the pitch attitude which maximized climb rate in a wind shear condition is strongly dependent on whether the aircraft is subjected to a horizontal shear or a downdraft. The pitch attitude which maximizes ground clearance depends on the altitude of the encounter, the strength of the microburst, and the initial position of the aircraft with respect to the downburst core. Best results are obtained at relatively low target pitch angles, in severe wind shear encounters at very low altitudes. A technique for maximizing ground clearance involves maintaining a low pitch attitude early in the encounter, followed by a gradual pitch-up that ceases when the wind shear has been excited.

  9. Pitch-Responsive Cortical Regions in Congenital Amusia.

    Science.gov (United States)

    Norman-Haignere, Sam V; Albouy, Philippe; Caclin, Anne; McDermott, Josh H; Kanwisher, Nancy G; Tillmann, Barbara

    2016-03-09

    Congenital amusia is a lifelong deficit in music perception thought to reflect an underlying impairment in the perception and memory of pitch. The neural basis of amusic impairments is actively debated. Some prior studies have suggested that amusia stems from impaired connectivity between auditory and frontal cortex. However, it remains possible that impairments in pitch coding within auditory cortex also contribute to the disorder, in part because prior studies have not measured responses from the cortical regions most implicated in pitch perception in normal individuals. We addressed this question by measuring fMRI responses in 11 subjects with amusia and 11 age- and education-matched controls to a stimulus contrast that reliably identifies pitch-responsive regions in normal individuals: harmonic tones versus frequency-matched noise. Our findings demonstrate that amusic individuals with a substantial pitch perception deficit exhibit clusters of pitch-responsive voxels that are comparable in extent, selectivity, and anatomical location to those of control participants. We discuss possible explanations for why amusics might be impaired at perceiving pitch relations despite exhibiting normal fMRI responses to pitch in their auditory cortex: (1) individual neurons within the pitch-responsive region might exhibit abnormal tuning or temporal coding not detectable with fMRI, (2) anatomical tracts that link pitch-responsive regions to other brain areas (e.g., frontal cortex) might be altered, and (3) cortical regions outside of pitch-responsive cortex might be abnormal. The ability to identify pitch-responsive regions in individual amusic subjects will make it possible to ask more precise questions about their role in amusia in future work. Copyright © 2016 the authors 0270-6474/16/362986-09$15.00/0.

  10. Perception of words and pitch patterns in song and speech

    Directory of Open Access Journals (Sweden)

    Julia eMerrill

    2012-03-01

    Full Text Available This fMRI study examines shared and distinct cortical areas involved in the auditory perception of song and speech at the level of their underlying constituents: words, pitch and rhythm. Univariate and multivariate analyses were performed on the brain activity patterns of six conditions, arranged in a subtractive hierarchy: sung sentences including words, pitch and rhythm; hummed speech prosody and song melody containing only pitch patterns and rhythm; as well as the pure musical or speech rhythm.Systematic contrasts between these balanced conditions following their hierarchical organization showed a great overlap between song and speech at all levels in the bilateral temporal lobe, but suggested a differential role of the inferior frontal gyrus (IFG and intraparietal sulcus (IPS in processing song and speech. The left IFG was involved in word- and pitch-related processing in speech, the right IFG in processing pitch in song.Furthermore, the IPS showed sensitivity to discrete pitch relations in song as opposed to the gliding pitch in speech. Finally, the superior temporal gyrus and premotor cortex coded for general differences between words and pitch patterns, irrespective of whether they were sung or spoken. Thus, song and speech share many features which are reflected in a fundamental similarity of brain areas involved in their perception. However, fine-grained acoustic differences on word and pitch level are reflected in the activity of IFG and IPS.

  11. Context effects on pitch perception in musicians and nonmusicians

    DEFF Research Database (Denmark)

    Brattico, E; Naatanen, R; Tervaniemi, M

    2001-01-01

    Behavioral evidence indicates that musical context facilitates pitch discrimination. In the present study, we sought to determine whether pitch context and its familiarity might affect brain responses to pitch change even at the preattentive level. Ten musicians and 10 nonmusicians, while...... concentrating on reading a book, were presented with sound stimuli that had an infrequent (p = 15 %) pitch shift of 144 Hz. In the familiar condition, the infrequent third-position deviant changed the mode (major vs. minor) of the five-tone pattern. In the unfamiliar condition, patterns were formed from five...

  12. Impaired short-term memory for pitch in congenital amusia.

    Science.gov (United States)

    Tillmann, Barbara; Lévêque, Yohana; Fornoni, Lesly; Albouy, Philippe; Caclin, Anne

    2016-06-01

    Congenital amusia is a neuro-developmental disorder of music perception and production. The hypothesis is that the musical deficits arise from altered pitch processing, with impairments in pitch discrimination (i.e., pitch change detection, pitch direction discrimination and identification) and short-term memory. The present review article focuses on the deficit of short-term memory for pitch. Overall, the data discussed here suggest impairments at each level of processing in short-term memory tasks; starting with the encoding of the pitch information and the creation of the adequate memory trace, the retention of the pitch traces over time as well as the recollection and comparison of the stored information with newly incoming information. These impairments have been related to altered brain responses in a distributed fronto-temporal network, associated with decreased connectivity between these structures, as well as in abnormalities in the connectivity between the two auditory cortices. In contrast, amusic participants׳ short-term memory abilities for verbal material are preserved. These findings show that short-term memory deficits in congenital amusia are specific to pitch, suggesting a pitch-memory system that is, at least partly, separated from verbal memory. This article is part of a Special Issue entitled SI: Auditory working memory. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Pitch discrimination associated with phonological awareness: Evidence from congenital amusia.

    Science.gov (United States)

    Sun, Yanan; Lu, Xuejing; Ho, Hao Tam; Thompson, William Forde

    2017-03-13

    Research suggests that musical skills are associated with phonological abilities. To further investigate this association, we examined whether phonological impairments are evident in individuals with poor music abilities. Twenty individuals with congenital amusia and 20 matched controls were assessed on a pure-tone pitch discrimination task, a rhythm discrimination task, and four phonological tests. Amusic participants showed deficits in discriminating pitch and discriminating rhythmic patterns that involve a regular beat. At a group level, these individuals performed similarly to controls on all phonological tests. However, eight amusics with severe pitch impairment, as identified by the pitch discrimination task, exhibited significantly worse performance than all other participants in phonological awareness. A hierarchical regression analysis indicated that pitch discrimination thresholds predicted phonological awareness beyond that predicted by phonological short-term memory and rhythm discrimination. In contrast, our rhythm discrimination task did not predict phonological awareness beyond that predicted by pitch discrimination thresholds. These findings suggest that accurate pitch discrimination is critical for phonological processing. We propose that deficits in early-stage pitch discrimination may be associated with impaired phonological awareness and we discuss the shared role of pitch discrimination for processing music and speech.

  14. Endoscopic laryngeal web formation for pitch elevation.

    Science.gov (United States)

    Anderson, Jennifer

    2007-02-01

    Endoscopic laryngeal web formation has been used to elevate the speaking voice, primarily in male to female transsexuals as part of gender reassignment intervention. The goal of this article is to review the literature regarding surgical treatment for pitch elevation and to describe a novel method of laryngeal web formation. The results of this technique are also reported in a series of six patients. All patients were assessed and treated at the St. Michael's Hospital Voice Disorders Clinic, a tertiary referral centre for voice disorders. Pre- and postoperative voice recordings, acoustic analysis, and videostroboscopic examinations were performed in this series. The acoustic data collected included isolated vowel samples, a reading task, and a modified voice range profile. The patients all underwent successful endoscopic web formation with a Gelfoam augmentation technique. The voice results collected at least 6 months after vocal fold web formation demonstrate a dramatic increase in the habitual speaking fundamental frequency. This new modification for endoscopic web formation has been shown to be a successful procedure for permanent elevation of pitch with little or no morbidity.

  15. Representational momentum in memory for pitch.

    Science.gov (United States)

    Freyd, J J; Kelly, M H; DeKay, M L

    1990-11-01

    When a visual pattern is displayed at successively different orientations such that a rotation or translation is implied, an observer's memory for the final position is displaced forward. This phenomenon of representational momentum shares some similarities with physical momentum. For instance, the amount of memory shift is proportional to the implied velocity of the inducing display; representational momentum is specifically proportional to the final, not the average, velocity; representational momentum follows a continuous stopping function for the first 250 ms or so of the retention interval. In a previous paper (Kelly & Freyd, 1987) we demonstrated a forward memory asymmetry using implied changes in pitch, for subjects without formal musical training. In the current paper we replicate our earlier finding and show that the forward memory asymmetry occurs for subjects with formal musical training as well (Experiment 1). We then show the structural similarity between representational momentum in memory for pitch with previous reports of parametric effects using visual stimuli. We report a velocity effect for auditory momentum (Experiment 2), we demonstrate specifically that the velocity effect depends on the implied acceleration (Experiment 3), and we show that the stopping function for auditory momentum is qualitatively the same as that for visual momentum (Experiment 4). We consider the implications of these results for theories of mental representation.

  16. Pitch Correlogram Clustering for Fast Speaker Identification

    Directory of Open Access Journals (Sweden)

    Nitin Jhanwar

    2004-12-01

    Full Text Available Gaussian mixture models (GMMs are commonly used in text-independent speaker identification systems. However, for large speaker databases, their high computational run-time limits their use in online or real-time speaker identification situations. Two-stage identification systems, in which the database is partitioned into clusters based on some proximity criteria and only a single-cluster GMM is run in every test, have been suggested in literature to speed up the identification process. However, most clustering algorithms used have shown limited success, apparently because the clustering and GMM feature spaces used are derived from similar speech characteristics. This paper presents a new clustering approach based on the concept of a pitch correlogram that captures frame-to-frame pitch variations of a speaker rather than short-time spectral characteristics like cepstral coefficient, spectral slopes, and so forth. The effectiveness of this two-stage identification process is demonstrated on the IVIE corpus of 110 speakers. The overall system achieves a run-time advantage of 500% as well as a 10% reduction of error in overall speaker identification.

  17. Submitting to the APS Journals

    Science.gov (United States)

    Hall, Donavan; Johnson, Brant; Kim-Zajonz, Julie; Ucko, Daniel

    2006-03-01

    This session will contain a short presentation of policies, practices and general advice for authors submitting to APS journals. For both the Physical Review and Physical Review Letters, it will focus on such things as the importance of a properly written introduction; our current drive for increased accessibility in the Phys. Rev. journals; how a well written cover letter and how suggesting referees will aid your manuscript in the review process. We shall also discuss responding to referees and offer advice on resubmitting your manuscript. In addition there will be information on technical details such as web submission and the Author Status Information Service (ASIS). The presentation will then be followed by a moderated panel discussion, where editors from PRL, PRB and PRE will answer questions from the audience on author issues.

  18. APS: Lighting up the future

    International Nuclear Information System (INIS)

    Potent, V.J.

    1993-01-01

    Work on the Advanced Photon Source (APS) at Argonne National Laboratory (ANL) involves the construction and supporting research and development for a national user facility for synchrotron radiation research in the x-ray region. The facility, when operational in 1997, will provide super-intense x-ray beams for many areas of basic research and will serve the entire US x-ray research community of several thousand users. This paper describes the pertinent features of the design, construction and planned operation of the facility; and the impact quality has had in these areas. In addition, the introduction of several quality management techniques such as total quality management, reliability/availability planning, and user interface are discussed concerning their status and success

  19. Pumping Capacity of Pitched Blade Impellers in a Tall Vessel with a Draught Tube

    Directory of Open Access Journals (Sweden)

    J. Brož

    2004-01-01

    Full Text Available A study was made of the pumping capacity of pitched blade impellers (two, three, four, five and six blade pitched blade impellers with pitch angles α = 35° and 45° coaxially located in a cylindrical pilot plant vessel with cylindrical draught tube provided with a standard dished bottom. The draught tube was equipped with four equally spaced radial baffles above the impeller pumping liquid upwards towards the liquid surface. In all investigated cases the liquid aspect ratio H/T = 1.2 - 1.5, the draught tube / vessel diameter ratios DT /T = 0.2 and 0.4 and the impeller / draught tube diameter ratio D/DT = 0.875. The pumping capacity of the impeller was calculated from the radial profile of the axial component of the mean velocity in the draught tube below the impeller at such an axial distance from the impeller that the rotor does not affect the vorticity of the flow. The mean velocity was measured using a laser Doppler anemometer with forward scatter mode in a transparent draught tube and a transparent vessel of diameter T = 400 mm. Two series of experiments were performed, both of them under a turbulent regime of flow of the agitated liquid. First, the optimum height of the dished bottom was sought, and then the dependences of the dimensionless flow rate criterion and the impeller power number on the number of impeller blades were determined for both pitch angles tested under conditions of optimum ratio HT /DT. It follows from the results of the experiments that the optimum ratio HT /DT = 0.25 when the cross sectional areas of the horizontal flow around the bottom and the vertical inflow to the draught tube are the same. For all the tested pitched blade impellers the impeller power number when α = 45° exceeds the value of this quantity when pitch angle α  =   35°, while the flow rate number when α = 35° exceeds this quantity when α = 45°. On the other hand, the absolute values of the impeller power number when the draught tube was

  20. Pixel-based absolute surface metrology by three flat test with shifted and rotated maps

    Science.gov (United States)

    Zhai, Dede; Chen, Shanyong; Xue, Shuai; Yin, Ziqiang

    2018-03-01

    In traditional three flat test, it only provides the absolute profile along one surface diameter. In this paper, an absolute testing algorithm based on shift-rotation with three flat test has been proposed to reconstruct two-dimensional surface exactly. Pitch and yaw error during shift procedure is analyzed and compensated in our method. Compared with multi-rotation method proposed before, it only needs a 90° rotation and a shift, which is easy to carry out especially in condition of large size surface. It allows pixel level spatial resolution to be achieved without interpolation or assumption to the test surface. In addition, numerical simulations and optical tests are implemented and show the high accuracy recovery capability of the proposed method.

  1. Native experience with a tone language enhances pitch discrimination and the timing of neural responses to pitch change

    Directory of Open Access Journals (Sweden)

    Ryan J Giuliano

    2011-08-01

    Full Text Available Native tone language experience has been linked with alterations in the production and perception of pitch in language, as well as with the brain response to linguistic and non-linguistic tones. Here we use two experiments to address whether these changes apply to the discrimination of simple pitch changes and pitch intervals. ERPs were recorded from native Mandarin speakers and a control group during a same/different task with pairs of pure tones differing only in pitch height, and with pure tone pairs differing only in interval distance. Behaviorally, Mandarin speakers were more accurate than controls at detecting both pitch and interval changes, showing a sensitivity to small pitch changes and interval distances that was absent in the control group. Converging evidence from ERPs obtained during the same tasks revealed an earlier response to change relative to no-change trials in Mandarin speakers, as well as earlier differentiation of trials by change direction relative to controls. These findings illustrate the cross-domain influence of language experience on the perception of pitch, suggesting that the native use of tonal pitch contours in language leads to a general enhancement in the acuity of pitch representations.

  2. Auditory deficits in amusia extend beyond poor pitch perception.

    Science.gov (United States)

    Whiteford, Kelly L; Oxenham, Andrew J

    2017-05-01

    Congenital amusia is a music perception disorder believed to reflect a deficit in fine-grained pitch perception and/or short-term or working memory for pitch. Because most measures of pitch perception include memory and segmentation components, it has been difficult to determine the true extent of pitch processing deficits in amusia. It is also unclear whether pitch deficits persist at frequencies beyond the range of musical pitch. To address these questions, experiments were conducted with amusics and matched controls, manipulating both the stimuli and the task demands. First, we assessed pitch discrimination at low (500Hz and 2000Hz) and high (8000Hz) frequencies using a three-interval forced-choice task. Amusics exhibited deficits even at the highest frequency, which lies beyond the existence region of musical pitch. Next, we assessed the extent to which frequency coding deficits persist in one- and two-interval frequency-modulation (FM) and amplitude-modulation (AM) detection tasks at 500Hz at slow (f m =4Hz) and fast (f m =20Hz) modulation rates. Amusics still exhibited deficits in one-interval FM detection tasks that should not involve memory or segmentation. Surprisingly, amusics were also impaired on AM detection, which should not involve pitch processing. Finally, direct comparisons between the detection of continuous and discrete FM demonstrated that amusics suffer deficits in both coding and segmenting pitch information. Our results reveal auditory deficits in amusia extending beyond pitch perception that are subtle when controlling for memory and segmentation, and are likely exacerbated in more complex contexts such as musical listening. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Absolutely summing multilinear operators: a Panorama | Pellegrino ...

    African Journals Online (AJOL)

    This paper has a twofold purpose: to present an overview of the theory of absolutely summing operators and its different generalizations for the multilinear setting, and to sketch the beginning of a research project related to an objective search of “perfect” multilinear extensions of the ideal of absolutely summing operators.

  4. MEAN OF MEDIAN ABSOLUTE DERIVATION TECHNIQUE MEAN ...

    African Journals Online (AJOL)

    eobe

    The accurate estimation of noise variance in an image is the first important stage ... lung image was lung image was developed. developed. developed. The development of mean of median absolute derivation technique development of mean of median absolute .... that are non-real numbers during initial processing.

  5. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  6. [Type 2 autoimmune polyendocrine syndromes (APS-2)].

    Science.gov (United States)

    Vialettes, Bernard; Dubois-Leonardon, Noémie

    2013-01-01

    Type 2 autoimmune polyendocrine syndromes (APS-2) are the most frequent disorders associating several organ-specific autoimmune diseases. Their high prevalence is due to the fact that the main manifestations of APS-2, such as thyroidal autoimmunity, type 1 diabetes, autoimmune gastric atrophy and vitiligo, are common diseases. APS-2 represents a clinical model that can serve to help unravel the mechanisms underlying autoimmunity. Diagnosis of APS-2 is a challenge for the clinician, especially in poorly symptomatic forms, and may require systematic screening based on measurement of autoantibodies and functional markers.

  7. Quantum nonequilibrium equalities with absolute irreversibility

    Science.gov (United States)

    Funo, Ken; Murashita, Yûto; Ueda, Masahito

    2015-07-01

    We derive quantum nonequilibrium equalities in absolutely irreversible processes. Here by absolute irreversibility we mean that in the backward process the density matrix does not return to the subspace spanned by those eigenvectors that have nonzero weight in the initial density matrix. Since the initial state of a memory and the postmeasurement state of the system are usually restricted to a subspace, absolute irreversibility occurs during the measurement and feedback processes. An additional entropy produced in absolutely irreversible processes needs to be taken into account to derive nonequilibrium equalities. We discuss a model of a feedback control on a qubit system to illustrate the obtained equalities. By introducing N heat baths each composed of a qubit and letting them interact with the system, we show how the entropy reduction via feedback control can be converted into work. An explicit form of extractable work in the presence of absolute irreversibility is given.

  8. Consumo de antimicrobianos en APS

    Directory of Open Access Journals (Sweden)

    María Cristina Lara Bastanzuri

    2003-08-01

    Full Text Available Con el propósito de describir el patrón de uso de los medicamentos para el tratamiento con antimicrobianos en APS en Cuba en el período de 1989 al 2000, se diseñó un estudio descriptivo, observacional y retrospectivo clasificado dentro de los estudios de utilización de medicamentos como de consumo. Para ello se calcularon las dosis diarias definidas cada día de determinado fármaco de los grupos clasificados según ATC como tetraciclinas, anfenicoles, penicilinas de amplio espectro, cefalosporinas, sulfonamidas y trimetoprim, macrólidos, estreptomicinas y quinolonas. Además, se tomaron las cifras de pacientes inscriptos a penicilina benzatínica y se comparó con la población expuesta obtenida a partir de las DHD. Las penicilinas son las de mayor consumo con tendencia al aumento, igual que los aminoglucósidos, mientras que la tetraciclina presenta cifras mayores de DHD. La tendencia del cloranfenicol es a disminuir. La población expuesta está muy por debajo de los pacientes inscriptos en penicilina benzatínica y las líneas de tendencia no son similares. Excepto la docixiclina, el resto de los antimicrobianos recomendados en la Guía Terapéutica para APS se encuentran en el Listado Básico de Medicamentos del país para el nivel primario de atención médica.With the objective of describing the pattern of drug use in antimicrobial-based treatment in the primary health care in Cuba from 1989 to 2000, we designed a retrospective descriptive and observational study, classified into the study of drug use as consumption. To this end, the daily doses of certain drugs from the ATC-classified groups were calculated, which included tetracycline, amphenicols, broad spectrum penicilins, cephalosporins, sulfonamides, trimethoprim, macrolides, streptomycin and quinolones. Also, the number of patients registered as benzathine peniciline consumers was taken and compared to the exposed population data obtained from the DHD. Penicillins are the

  9. The Association Between Pitch Conditions and the Incidence of ...

    African Journals Online (AJOL)

    Background: Environmental conditions have been shown to influence incidence of rugby injuries. Harsh weather conditions and detrimental effect on poor Kenyan rugby pitches create a unique environment for injury exposure. We conducted a whole population prospective cohort study to determine the association of pitch ...

  10. Pixel size and pitch measurements of liquid crystal spatial light ...

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 65; Issue 2. Pixel size and pitch ... Liquid crystal displays; spatial light modulator; optical diffraction. Abstract. We present a simple technique for the determination of pixel size and pitch of liquid crystal (LC) based spatial light modulator (SLM). The proposed method is ...

  11. Global and Local Pitch Perception in Children with Developmental Dyslexia

    Science.gov (United States)

    Ziegler, Johannes C.; Pech-Georgel, Catherine; George, Florence; Foxton, Jessica M.

    2012-01-01

    This study investigated global versus local pitch pattern perception in children with dyslexia aged between 8 and 11 years. Children listened to two consecutive 4-tone pitch sequences while performing a same/different task. On the different trials, sequences either preserved the contour (local condition) or they violated the contour (global…

  12. The Association Between Pitch Conditions and the Incidence of ...

    African Journals Online (AJOL)

    shown to influence incidence of rugby injuries. Harsh weather conditions and detrimental effect on poor Kenyan rugby pitches create a unique environment for injury exposure. We conducted a whole population prospective cohort study to determine the association of pitch conditions with injury incidence and severity.

  13. Pitch Systems and Curwen Hand Signs: A Review of Literature

    Science.gov (United States)

    Frey-Clark, Marta

    2017-01-01

    Learning to sing from notation is a complex task, and accurately performing pitches without an external reference can be particularly challenging. As such, the use of mnemonic devices to reinforce tonal relationships is a long-standing practice among musicians. Chief among these mnemonic devices are pitch syllable systems and Curwen hand signs.…

  14. Stochastic wind turbine modeling for individual pitch control

    DEFF Research Database (Denmark)

    Thomsen, Sven Creutz; Niemann, Hans Henrik; Poulsen, Niels Kjølstad

    2009-01-01

    and a simplified description of the aerodynamics with sufficient detail to design model-based individual pitch controllers. Combined with a simplified model of the wind turbine, we exemplify how to use the model elements to systematically design an individual pitch controller. The design is investigated...

  15. Pitch Perception, Working Memory, and Second-Language Phonological Production

    Science.gov (United States)

    Posedel, James; Emery, Lisa; Souza, Benjamin; Fountain, Catherine

    2012-01-01

    Previous research has suggested that training on a musical instrument is associated with improvements in working memory and musical pitch perception ability. Good working memory and musical pitch perception ability, in turn, have been linked to certain aspects of language production. The current study examines whether working memory and/or pitch…

  16. Thrust generation and wake structure for flow across a pitching ...

    Indian Academy of Sciences (India)

    In this work, we present detailed particle image velocimetry (PIV) based investigation of wake structure of a pitching airfoil. PIV measurements have been carried out for NACA0015 airfoil at Re = 2900 with reduced frequency range of 1.82–10.92 and pitching angle of 5°. Two different wake structures (reverse Kármán ...

  17. Shoulder joint velocity during fastball pitching in baseball

    NARCIS (Netherlands)

    Gasparutto, X.; van der Graaff, E; van der Helm, F.C.T.; Veeger, H.E.J.; Colloud, F.; Domalain, M.; Monnet, T.

    2015-01-01

    The purpose of this study was to assess the rotation and translation velocity of the shoulder complex during fastball pitching in baseball. 8 pitchers from the Dutch AAA team performed each 3 fastball pitches. Their motion was recorded by an opto-electronic device. Kinematic computation was

  18. Mathematical Precision of Pitch Gaps in Tribal Tonal

    African Journals Online (AJOL)

    SOCIAL PATHOLOGY OF CLEFT PALATE IN THE AFRICAN: MATHEMATICAL PRECISION OF PITCH GAPS IN TRIBAL TONAL ... with Tonic Solfa precision. I have done this both in tribal tonal linguistics and in ... in English. My native ear enables me to hear 4 pitches in the word “Agriculture” in Queen's English [high.

  19. Contamination of Pine Seeds by the Pitch Canker Fungus

    Science.gov (United States)

    L. David Dwinell; S.W. Fraedrich

    1999-01-01

    The pitch canker fungus, Fusarium subglutinans f. sp. pini, has been identified as a significant problem in man pine seed orchards and nursuries in the South. THe fungus causes strobilus mortality, seed deterioation, and cankers on the main stem, branches, and shoots of pines Dwinell and others 1985). The pitche canker fungus...

  20. Pitch height modulates visual and haptic bisection performance in musicians

    Directory of Open Access Journals (Sweden)

    Carlotta eLega

    2014-04-01

    Full Text Available Consistent evidence suggests that pitch height may be represented in a spatial format, having both a vertical and an horizontal representation. The spatial representation of pitch height results into response compatibility effects for which high pitch tones are preferentially associated to up-right responses, and low pitch tones are preferentially associated to down-left responses (i.e., the SMARC effect, with the strength of these associations depending on individuals’ musical skills. In this study we investigated whether listening to tones of different pitch affects the representation of external space, as assessed in a visual and haptic line bisection paradigm, in musicians and non musicians. Low and high pitch tones affected the bisection performance in musicians differently, both when pitch was relevant and irrelevant for the task, and in both the visual and the haptic modality. No effect of pitch height was observed on the bisection performance of non musicians. Moreover, our data also show that musicians present a (supramodal rightward bisection bias in both the visual and the haptic modality, extending previous findings limited to the visual modality, and consistent with the idea that intense practice with musical notation and bimanual instrument training affects hemispheric lateralization.

  1. Estimates of pitch strength for musicians and nonmusicians

    Science.gov (United States)

    Clarkson, Marsha G.; Zettler, Cynthia M.; Follmer, Michelle J.; Faulk, Margaret; Takagi, Michael J.

    2003-04-01

    To measure the strength of the pitch of iterated rippled noise (IRN), 19 adults were tested in an operant conditioning procedure. Seven adults had music training and currently played an instrument; 12 adults had no training and did not currently play an instrument. To generate IRN, a 500-ms Gaussian noise stimulus was delayed by 5 or 6 ms (pitches of 200 or 166 Hz) and added to the original for 16 iterations. IRN stimuli having one delay were presented repeatedly. On signal trials the delay changed for 6 s. Stimulus level roved from 63-67 dBA (background of 28 dBA). Adults learned to press a button when the stimulus changed. Testing started with IRN stimuli having 0-dB attenuation (i.e., maximal pitch strength). Stimuli having weaker pitches (i.e., progressively greater attenuation applied to the delayed noise) followed. Strength of pitch was quantified as the maximum attenuation for which pitch was discerned. For each subject, threshold attenuation for pitch strength was extrapolated as the 71% point on a psychometric function depicting percent correct performance as a function of attenuation. Mean thresholds revealed that the pitch percept was similar for both nonmusically trained (18.70 dB) and musically trained adults (18.73 dB).

  2. Pitch Ability as an Aptitude for Tone Learning

    Science.gov (United States)

    Bowles, Anita R.; Chang, Charles B.; Karuzis, Valerie P.

    2016-01-01

    Tone languages such as Mandarin use voice pitch to signal lexical contrasts, presenting a challenge for second/foreign language (L2) learners whose native languages do not use pitch in this manner. The present study examined components of an aptitude for mastering L2 lexical tone. Native English speakers with no previous tone language experience…

  3. Autistic Traits and Enhanced Perceptual Representation of Pitch and Time

    Science.gov (United States)

    Stewart, Mary E.; Griffiths, Timothy D.; Grube, Manon

    2018-01-01

    Enhanced basic perceptual discrimination has been reported for pitch in individuals with autism spectrum conditions. We test whether there is a correlational pattern of enhancement across the broader autism phenotype and whether this correlation occurs for the discrimination of pitch, time and loudness. Scores on the Autism-Spectrum Quotient…

  4. Wing-pitching mechanism of hovering Ruby-throated hummingbirds.

    Science.gov (United States)

    Song, Jialei; Luo, Haoxiang; Hedrick, Tyson L

    2015-01-19

    In hovering flight, hummingbirds reverse the angle of attack of their wings through pitch reversal in order to generate aerodynamic lift during both downstroke and upstroke. In addition, the wings may pitch during translation to further enhance lift production. It is not yet clear whether these pitching motions are caused by the wing inertia or actuated through the musculoskeletal system. Here we perform a computational analysis of the pitching dynamics by incorporating the realistic wing kinematics to determine the inertial effects. The aerodynamic effect is also included using the pressure data from a previous three-dimensional computational fluid dynamics simulation of a hovering hummingbird. The results show that like many insects, pitch reversal of the hummingbird is, to a large degree, caused by the wing inertia. However, actuation power input at the root is needed in the beginning of pronation to initiate a fast pitch reversal and also in mid-downstroke to enable a nose-up pitching motion for lift enhancement. The muscles on the wing may not necessarily be activated for pitching of the distal section. Finally, power analysis of the flapping motion shows that there is no requirement for substantial elastic energy storage or energy absorption at the shoulder joint.

  5. Wing-pitching mechanism of hovering Ruby-throated hummingbirds

    International Nuclear Information System (INIS)

    Song, Jialei; Luo, Haoxiang; Hedrick, Tyson L

    2015-01-01

    In hovering flight, hummingbirds reverse the angle of attack of their wings through pitch reversal in order to generate aerodynamic lift during both downstroke and upstroke. In addition, the wings may pitch during translation to further enhance lift production. It is not yet clear whether these pitching motions are caused by the wing inertia or actuated through the musculoskeletal system. Here we perform a computational analysis of the pitching dynamics by incorporating the realistic wing kinematics to determine the inertial effects. The aerodynamic effect is also included using the pressure data from a previous three-dimensional computational fluid dynamics simulation of a hovering hummingbird. The results show that like many insects, pitch reversal of the hummingbird is, to a large degree, caused by the wing inertia. However, actuation power input at the root is needed in the beginning of pronation to initiate a fast pitch reversal and also in mid-downstroke to enable a nose-up pitching motion for lift enhancement. The muscles on the wing may not necessarily be activated for pitching of the distal section. Finally, power analysis of the flapping motion shows that there is no requirement for substantial elastic energy storage or energy absorption at the shoulder joint. (paper)

  6. Pulping Variables, Storage Time and Pitch Deposit | Ogunwusi ...

    African Journals Online (AJOL)

    Pulp resin is also influenced by effective alkali concentration of the pulping medium. With increase in effective alkali concentration from 13% to 15%, pulp pitch is reduced. The interaction effect of storage and effective alkali concentration was not significant indicating that reduction in pulp pitch caused by effective alkali ...

  7. Sparse Multi-Pitch and Panning Estimation of Stereophonic Signals

    DEFF Research Database (Denmark)

    Kronvall, Ted; Jakobsson, Andreas; Hansen, Martin Weiss

    2016-01-01

    In this paper, we propose a novel multi-pitch estimator for stereophonic mixtures, allowing for pitch estimation on multi-channel audio even if the amplitude and delay panning parameters are unknown. The presented method does not require prior knowledge of the number of sources present in the mix...

  8. H-Darrieus Wind Turbine with Blade Pitch Control

    Directory of Open Access Journals (Sweden)

    I. Paraschivoiu

    2009-01-01

    Full Text Available A procedure for computing the optimal variation of the blades' pitch angle of an H-Darrieus wind turbine that maximizes its torque at given operational conditions is proposed and presented along with the results obtained on a 7 kW prototype. The CARDAAV code, based on the “Double-Multiple Streamtube” model developed by the first author, is used to determine the performances of the straight-bladed vertical axis wind turbine. This was coupled with a genetic algorithm optimizer. The azimuthal variation of the blades' pitch angle is modeled with an analytical function whose coefficients are used as variables in the optimization process. Two types of variations were considered for the pitch angle: a simple sinusoidal one and one which is more general, relating closely the blades' pitch to the local flow conditions along their circular path. A gain of almost 30% in the annual energy production was obtained with the polynomial optimal pitch control.

  9. Wind turbine pitch control using ICPSO-PID algorithm

    DEFF Research Database (Denmark)

    Xu, Chang; Tian, Qiangqiang; Shen, Wen Zhong

    2013-01-01

    , a pitch controller was designed based on power and wind speed and by considering the inertia and delay characteristics of a pitch-control system to achieve a constant power output when a wind speed was beyond the rated one. A novel ICPSO-PID control algorithm was proposed based on a combination...... of improved cooperative particle swarm optimization (ICPSO) and PID, subsequently, it was used to tune the pitch controller parameters; thus the difficulty in PID tuning was removed when a wind speed was above the rated speed. It was indicated that the proposed optimization algorithm can tune the pitch...... controller parameters quickly; and the feed-forward controller for wind speed can improve dynamics of a pitch-control system; additionally the power controller can allow a wind turbine to have a constant power output as a wind speed is over the rated one. Compared with a conventional PID, the controller...

  10. Complex-tone pitch representations in the human auditory system

    DEFF Research Database (Denmark)

    Bianchi, Federica

    ) listeners and the effect of musical training for pitch discrimination of complex tones with resolved and unresolved harmonics. Concerning the first topic, behavioral and modeling results in listeners with sensorineural hearing loss (SNHL) indicated that temporal envelope cues of complex tones...... discrimination to that of NH listeners. In the second part of this work, behavioral and objective measures of pitch discrimination were carried out in musicians and non-musicians. Musicians showed an increased pitch-discrimination performance relative to non-musicians for both resolved and unresolved harmonics...... for the individual pitch-discrimination abilities, the musically trained listeners still allocated lower processing effort than did the non-musicians to perform the task at the same performance level. This finding suggests an enhanced pitch representation along the auditory system in musicians, possibly as a result...

  11. Two LQRI based Blade Pitch Controls for Wind Turbines

    Directory of Open Access Journals (Sweden)

    Yoonsu Nam

    2012-06-01

    Full Text Available As the wind turbine size has been increasing and their mechanical components are built lighter, the reduction of the structural loads becomes a very important task of wind turbine control in addition to maximum wind power capture. In this paper, we present a separate set of collective and individual pitch control algorithms. Both pitch control algorithms use the LQR control technique with integral action (LQRI, and utilize Kalman filters to estimate system states and wind speed. Compared to previous works in this area, our pitch control algorithms can control rotor speed and blade bending moments at the same time to improve the trade-off between rotor speed regulation and load reduction, while both collective and individual pitch controls can be designed separately. Simulation results show that the proposed collective and individual pitch controllers achieve very good rotor speed regulation and significant reduction of blade bending moments.

  12. Task-dependent activations of human auditory cortex during pitch discrimination and pitch memory tasks.

    Science.gov (United States)

    Rinne, Teemu; Koistinen, Sonja; Salonen, Oili; Alho, Kimmo

    2009-10-21

    The functional organization of auditory cortex (AC) is still poorly understood. Previous studies suggest segregation of auditory processing streams for spatial and nonspatial information located in the posterior and anterior AC, respectively (Rauschecker and Tian, 2000; Arnott et al., 2004; Lomber and Malhotra, 2008). Furthermore, previous studies have shown that active listening tasks strongly modulate AC activations (Petkov et al., 2004; Fritz et al., 2005; Polley et al., 2006). However, the task dependence of AC activations has not been systematically investigated. In the present study, we applied high-resolution functional magnetic resonance imaging of the AC and adjacent areas to compare activations during pitch discrimination and n-back pitch memory tasks that were varied parametrically in difficulty. We found that anterior AC activations were increased during discrimination but not during memory tasks, while activations in the inferior parietal lobule posterior to the AC were enhanced during memory tasks but not during discrimination. We also found that wide areas of the anterior AC and anterior insula were strongly deactivated during the pitch memory tasks. While these results are consistent with the proposition that the anterior and posterior AC belong to functionally separate auditory processing streams, our results show that this division is present also between tasks using spatially invariant sounds. Together, our results indicate that activations of human AC are strongly dependent on the characteristics of the behavioral task.

  13. Advanced APS Impacts on Vehicle Payloads

    Science.gov (United States)

    Schneider, Steven J.; Reed, Brian D.

    1989-01-01

    Advanced auxiliary propulsion system (APS) technology has the potential to both, increase the payload capability of earth-to-orbit (ETO) vehicles by reducing APS propellant mass, and simplify ground operations and logistics by reducing the number of fluids on the vehicle and eliminating toxic, corrosive propellants. The impact of integrated cryogenic APS on vehicle payloads is addressed. In this system, launch propulsion system residuals are scavenged from integral launch propulsion tanks for use in the APS. Sufficient propellant is preloaded into the APS to return to earth with margin and noncomplete scavenging assumed. No propellant conditioning is required by the APS, but ambient heat soak is accommodated. High temperature rocket materials enable the use of the unconditioned hydrogen/oxygen in the APS and are estimated to give APS rockets specific impulse of up to about 444 sec. The payload benefits are quantified and compared with an uprated monomethyl hydrazine/nitrogen tetroxide system in a conservative fashion, by assuming a 25.5 percent weight growth for the hydrogen/oxygen system and a 0 percent weight growth for the uprated system. The combination and scavenging and high performance gives payload impacts which are highly mission specific. A payload benefit of 861 kg (1898 lbm) was estimated for a Space Station Freedom rendezvous mission and 2099 kg (4626 lbm) for a sortie mission, with payload impacts varying with the amount of launch propulsion residual propellants. Missions without liquid propellant scavenging were estimated to have payload penalties, however, operational benefits were still possible.

  14. Coaching Strategies for AP: Building a Successful AP European History Program

    Science.gov (United States)

    Fornaciari, Jim

    2014-01-01

    The October 2013 special issue of "Social Education" dealt with almost all AP social studies subjects, but omitted AP European History. This is one of the most fascinating AP subjects for students and teachers alike. In this article, the author shares his experiences since hewas given the responsibility of building his school's Advanced…

  15. The absolute environmental performance of buildings

    DEFF Research Database (Denmark)

    Brejnrod, Kathrine Nykjær; Kalbar, Pradip; Petersen, Steffen

    2017-01-01

    sustainability for the standard house were proposed focusing on three measures: minimizing environmental impacts from building construction, minimizing impacts from energy consumption during use phase, and reducing the living area per person. In an intermediate path, absolute sustainability can be obtained...... by reducing the impacts from construction by 89%, use phase energy consumption by 80%, and the living area by 60%.......Our paper presents a novel approach for absolute sustainability assessment of a building's environmental performance. It is demonstrated how the absolute sustainable share of the earth carrying capacity of a specific building type can be estimated using carrying capacity based normalization factors...

  16. ELECTROCHEMICAL CORROSION TESTING OF TANKS 241-AN-102 & 241-AP-107 & 241-AP-108 IN SUPPORT OF ULTRASONIC TESTING

    Energy Technology Data Exchange (ETDEWEB)

    WYRWAS RB; DUNCAN JB

    2008-11-20

    This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.

  17. ASTEROID ABSOLUTE MAGNITUDES V10.0

    Data.gov (United States)

    National Aeronautics and Space Administration — Absolute magnitudes and slopes, mostly IAU-adopted with exceptions noted, for all asteroids numbered as of the 2006 March 14 batch of Minor Planet Circulars.

  18. ASTEROID ABSOLUTE MAGNITUDES V11.0

    Data.gov (United States)

    National Aeronautics and Space Administration — Absolute magnitudes and slopes, mostly IAU-adopted with exceptions noted, for all asteroids numbered as of the 2007 April 2 batch of Minor Planet Circulars.

  19. ASTEROID ABSOLUTE MAGNITUDES V12.0

    Data.gov (United States)

    National Aeronautics and Space Administration — Absolute magnitudes and slopes, mostly IAU-adopted with exceptions noted, for all asteroids numbered as of the 2008 April 20 batch of Minor Planet Circulars.

  20. ASTEROID ABSOLUTE MAGNITUDES V7.0

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set tabulates the IAU-adopted absolute V magnitude and slope parameter for all numbered asteroids as of the given stop date. The data set is updated yearly.

  1. ASTEROID ABSOLUTE MAGNITUDES V9.0

    Data.gov (United States)

    National Aeronautics and Space Administration — Absolute magnitudes and slopes, mostly IAU-adopted with exceptions noted, for all asteroids numbered as of the 2005 April 7 batch of Minor Planet Circulars.

  2. ASTEROID ABSOLUTE MAGNITUDES V8.0

    Data.gov (United States)

    National Aeronautics and Space Administration — Absolute magnitudes and slopes, mostly IAU-adopted with exceptions noted, for all asteroids numbered as of the 2004 April 15 batch of Minor Planet Circulars

  3. Absolutely uniform illumination of laser fusion pellets

    International Nuclear Information System (INIS)

    Schmitt, A.J.

    1984-01-01

    Absolutely uniform illumination of spherical laser fusion pellets is possible when the energy deposition from a single beam is given by a simple cos 2 theta distribution. Conditions can be derived for which the laser beam targeting angles allow this absolute illumination uniformity. Configurations based upon the cube and higher order Platonic solids satisfy the constraints, as well as an infinite class of other less symmetric configurations

  4. Absolutely uniform illumination of laser fusion pellets

    International Nuclear Information System (INIS)

    Schmitt, A.J.

    1984-01-01

    Absolutely uniform illumination of spherical laser fusion pellets is possible when the energy deposition from a single laser beam is given by a simple cos 2 theta distribution. Conditions can be derived for which the laser beam targeting angles allow this absolute illumination uniformity. Configurations based upon the cube and higher order Platonic solids satisfy the constraints, as well as infinite class of other less symmetric configurations

  5. Absolute spectrophotometry of Nova Cygni 1975

    International Nuclear Information System (INIS)

    Kontizas, E.; Kontizas, M.; Smyth, M.J.

    1976-01-01

    Radiometric photoelectric spectrophotometry of Nova Cygni 1975 was carried out on 1975 August 31, September 2, 3. α Lyr was used as reference star and its absolute spectral energy distribution was used to reduce the spectrophotometry of the nova to absolute units. Emission strengths of Hα, Hβ, Hγ (in W cm -2 ) were derived. The Balmer decrement Hα:Hβ:Hγ was compared with theory, and found to deviate less than had been reported for an earlier nova. (author)

  6. Discriminating male and female voices: differentiating pitch and gender.

    Science.gov (United States)

    Latinus, Marianne; Taylor, Margot J

    2012-04-01

    Gender is salient, socially critical information obtained from faces and voices, yet the brain processes underlying gender discrimination have not been well studied. We investigated neural correlates of gender processing of voices in two ERP studies. In the first, ERP differences were seen between female and male voices starting at 87 ms, in both spatial-temporal and peak analyses, particularly the fronto-central N1 and P2. As pitch differences may drive gender differences, the second study used normal, high- and low-pitch voices. The results of these studies suggested that differences in pitch produced early effects (27-63 ms). Gender effects were seen on N1 (120 ms) with implicit pitch processing (study 1), but were not seen with manipulations of pitch (study 2), demonstrating that N1 was modulated by attention. P2 (between 170 and 230 ms) discriminated male from female voices, independent of pitch. Thus, these data show that there are two stages in voice gender processing; a very early pitch or frequency discrimination and a later more accurate determination of gender at the P2 latency.

  7. A New Approach to Model Pitch Perception Using Sparse Coding.

    Directory of Open Access Journals (Sweden)

    Oded Barzelay

    2017-01-01

    Full Text Available Our acoustical environment abounds with repetitive sounds, some of which are related to pitch perception. It is still unknown how the auditory system, in processing these sounds, relates a physical stimulus and its percept. Since, in mammals, all auditory stimuli are conveyed into the nervous system through the auditory nerve (AN fibers, a model should explain the perception of pitch as a function of this particular input. However, pitch perception is invariant to certain features of the physical stimulus. For example, a missing fundamental stimulus with resolved or unresolved harmonics, or a low and high-level amplitude stimulus with the same spectral content-these all give rise to the same percept of pitch. In contrast, the AN representations for these different stimuli are not invariant to these effects. In fact, due to saturation and non-linearity of both cochlear and inner hair cells responses, these differences are enhanced by the AN fibers. Thus there is a difficulty in explaining how pitch percept arises from the activity of the AN fibers. We introduce a novel approach for extracting pitch cues from the AN population activity for a given arbitrary stimulus. The method is based on a technique known as sparse coding (SC. It is the representation of pitch cues by a few spatiotemporal atoms (templates from among a large set of possible ones (a dictionary. The amount of activity of each atom is represented by a non-zero coefficient, analogous to an active neuron. Such a technique has been successfully applied to other modalities, particularly vision. The model is composed of a cochlear model, an SC processing unit, and a harmonic sieve. We show that the model copes with different pitch phenomena: extracting resolved and non-resolved harmonics, missing fundamental pitches, stimuli with both high and low amplitudes, iterated rippled noises, and recorded musical instruments.

  8. Mismatch negativity to pitch pattern deviants in schizophrenia.

    Science.gov (United States)

    Haigh, Sarah M; Matteis, Mario De; Coffman, Brian A; Murphy, Timothy K; Butera, Christiana D; Ward, Kayla L; Leiter-McBeth, Justin R; Salisbury, Dean F

    2017-09-01

    Simple mismatch negativity (MMN) to infrequent pitch deviants is impaired in individuals with long-term schizophrenia (Sz). The complex MMN elicited by pattern deviance often manifes is cut from here]->ts later after deviant onset than simple MMN and can ascertain deficits in abstracting relationships between stimuli. Sz exhibit reduced complex MMN, but so far this has only been measured when deviance detection relies on a grouping rule. We measured MMN to deviants in pitch-based rules to see whether MMN is also abnormal in Sz under these conditions. Three experiments were conducted. Twenty-seven Sz and 28 healthy matched controls (HC) participated in Experiments 1 and 2, and 24 Sz and 26 HC participated in Experiment 3. Experiment 1 was a standard pitch MMN task, and Sz showed the expected MMN reduction (~ 115 ms) in the simple pitch deviant compared to HC. Experiment 2 comprised standard groups of six tones that ascended in pitch, and deviant groups where the last tone descended in pitch. Complex MMN was late (~ 510 ms) and significantly blunted in Sz. Experiment 3 comprised standard groups of 12 tones (six tones ascending in pitch followed by six tones descending in pitch, like a scale), and deviant groups containing two repetitions of six ascending tones (the scale restarted midstream). Complex MMN was also late (~ 460 ms) and significantly blunted in Sz. These results identify a late pitch pattern deviance-related MMN that is deficient in schizophrenia. This suggests specific deficits in later more complex deviance detection in schizophrenia for abstract patterns. © 2017 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

  9. Antiphospholipid syndrome (APS) nephropathy in catastrophic, primary, and systemic lupus erythematosus-related APS.

    Science.gov (United States)

    Tektonidou, Maria G; Sotsiou, Flora; Moutsopoulos, Haralampos M

    2008-10-01

    Renal involvement in antiphospholipid syndrome (APS) has been poorly recognized. A renal small-vessel vasculopathy, defined as APS nephropathy, has recently been observed in small series of patients with primary APS (PAPS) and systemic lupus erythematosus (SLE)-APS. We examined the renal histologic, clinical, and laboratory characteristics of different groups of patients with APS including catastrophic APS (CAPS). Our study included all CAPS (n=6), PAPS (n=8), and SLE-APS (n=23) patients with biopsy-proven renal involvement who were referred to our departments. The kidney biopsy specimens were retrospectively examined by the same renal pathologist. APS nephropathy was diagnosed as previously described. Demographic, clinical, and laboratory data were recorded. All patients with CAPS had acute and chronic renal vascular lesions compatible with diagnosis of APS nephropathy. Thrombotic microangiopathy (TMA), the acute lesion, was observed in all CAPS patients. Fibrous intimal hyperplasia of interlobular arteries (FIH) and focal cortical atrophy (FCA) were the most common chronic vascular lesions, occurring in 4 of 6 (66.7%) and 3 of 6 (50%) patients with CAPS, respectively. TMA was detected in 3 of 8 (37.5%) patients with PAPS and in 8 of 23 (35%) patients with SLE-APS, while FIH and FCA were found with similar frequencies in all 3 groups. Hypertension, proteinuria, hematuria, and renal insufficiency were the most common renal manifestations of all APS groups. Acute and chronic APS nephropathy lesions were detected in all 3 APS groups. Acute lesions were more prominent in CAPS, while chronic lesions were found with similar frequencies in all groups. Hypertension, proteinuria, hematuria, and renal insufficiency were the most common renal manifestations of all APS groups.

  10. Processing of Binaural Pitch Stimuli in Hearing-Impaired Listeners

    DEFF Research Database (Denmark)

    Santurette, Sébastien; Dau, Torsten

    2009-01-01

    Binaural pitch is a tonal sensation produced by introducing a frequency-dependent interaural phase shift in binaurally presented white noise. As no spectral cues are present in the physical stimulus, binaural pitch perception is assumed to rely on accurate temporal fine structure coding and intact...... level differences and binaural intelligibility level differences than subjects from group 1, but did not necessarily show reduced scores in a lexical decision task and a reading span test. Overall, these findings confirm that binaural pitch perception is either immediate or absent in hearing...

  11. The pitch-heave dynamics of transportation vehicles

    Science.gov (United States)

    Sweet, L. M.; Richardson, H. H.

    1975-01-01

    The analysis and design of suspensions for vehicles of finite length using pitch-heave models is presented. Dynamic models for the finite length vehicle include the spatial distribution of the guideway input disturbance over the vehicle length, as well as both pitch and heave degrees-of-freedom. Analytical results relate the vehicle front and rear accelerations to the pitch and heave natural frequencies, which are functions of vehicle suspension geometry and mass distribution. The effects of vehicle asymmetry and suspension contact area are evaluated. Design guidelines are presented for the modification of vehicle and suspension parameters to meet alternative ride quality criteria.

  12. Context effects on pitch perception in musicians and nonmusicians

    DEFF Research Database (Denmark)

    Brattico, E; Naatanen, R; Tervaniemi, M

    2001-01-01

    Behavioral evidence indicates that musical context facilitates pitch discrimination. In the present study, we sought to determine whether pitch context and its familiarity might affect brain responses to pitch change even at the preattentive level. Ten musicians and 10 nonmusicians, while...... is generally enhanced in a familiar context. Moreover, the latency of the mismatch negativity was shorter for musicians than for nonmusicians in both the familiar and unfamiliar conditions, whereas no difference between groups was observed in the no-context condition. This finding indicates that, in response...

  13. Tonal Scales and Minimal Simple Pitch Class Cycles

    DEFF Research Database (Denmark)

    Meredith, David

    2011-01-01

    Numerous studies have explored the special mathematical properties of the diatonic set. However, much less attention has been paid to the sets associated with the other scales that play an important rôle in Western tonal music, such as the harmonic minor scale and ascending melodic minor scale....... This paper focuses on the special properties of the class, T, of sets associated with the major and minor scales (including the harmonic major scale). It is observed that T is the set of pitch class sets associated with the shortest simple pitch class cycles in which every interval between consecutive pitch...

  14. Fault Detection and Isolation for Wind Turbine Electric Pitch System

    DEFF Research Database (Denmark)

    Zhu, Jiangsheng; Ma, Kuichao; Hajizadeh, Amin

    2017-01-01

    This paper presents a model-based fault detection and isolation scheme applied on electric pitch system of wind turbines. Pitch system is one of the most critical components due to its effect on the operational safety and the dynamics of wind turbines. Faults in this system should be precisely...... detected to prevent failures and decrease downtime. To detect faults of electric pitch actuators and sensors, an extended kalman filter (EKF) based multiple model adaptive estimation (MMAE) designed to estimate the states of the system. The proposed method is demonstrated in case studies. The simulation...... results show that the proposed method detects different fault scenarios of wind turbines under the stochastic external condition....

  15. AP1000 Containment Design and Safety Assessment

    International Nuclear Information System (INIS)

    Wright, Richard F.; Ofstun, Richard P.; Bachere, Sebastien

    2002-01-01

    The AP1000 is an up-rated version of the AP600 passive plant design that recently received final design certification from the US NRC. Like AP600, the AP1000 is a two-loop, pressurized water reactor featuring passive core cooling and passive containment safety systems. One key safety feature of the AP1000 is the passive containment cooling system which maintains containment integrity in the event of a design basis accident. This system utilizes a high strength, steel containment vessel inside a concrete shield building. In the event of a pipe break inside containment, a high pressure signal actuates valves which allow water to drain from a storage tank atop the shield building. Water is applied to the top of the containment shell, and evaporates, thereby removing heat. An air flow path is formed between the shield building and the containment to aid in the evaporation and is exhausted through a chimney at the top of the shield building. Extensive testing and analysis of this system was performed as part of the AP600 design certification process. The AP1000 containment has been designed to provide increased safety margin despite the increased reactor power. The containment volume was increased to accommodate the larger steam generators, and to provide increased margin for containment pressure response to design basis events. The containment design pressure was increased from AP600 by increasing the shell thickness and by utilizing high strength steel. The passive containment cooling system water capacity has been increased and the water application rate has been scaled to the higher decay heat level. The net result is higher margins to the containment design pressure limit than were calculated for AP600 for all design basis events. (authors)

  16. Polyphonic pitch detection and instrument separation

    Science.gov (United States)

    Bay, Mert; Beauchamp, James W.

    2005-09-01

    An algorithm for polyphonic pitch detection and musical instrument separation is presented. Each instrument is represented as a time-varying harmonic series. Spectral information is obtained from a monaural input signal using a spectral peak tracking method. Fundamental frequencies (F0s) for each time frame are estimated from the spectral data using an Expectation Maximization (EM) algorithm with a Gaussian mixture model representing the harmonic series. The method first estimates the most predominant F0, suppresses its series in the input, and then the EM algorithm is run iteratively to estimate each next F0. Collisions between instrument harmonics, which frequently occur, are predicted from the estimated F0s, and the resulting corrupted harmonics are ignored. The amplitudes of these corrupted harmonics are replaced by harmonics taken from a library of spectral envelopes for different instruments, where the spectrum which most closely matches the important characteristics of each extracted spectrum is chosen. Finally, each voice is separately resynthesized by additive synthesis. This algorithm is demonstrated for a trio piece that consists of 3 different instruments.

  17. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  18. Operation of the APS rf gun

    International Nuclear Information System (INIS)

    Lewellen, J. W.

    1998-01-01

    The Advanced Photon Source (APS) has a thermionic-cathode rf gun system capable of providing beam to the APS linac. The gun system consists of a 1.6-cell thermionic-cathode rf gun, a fast kicker for beam current control, and an alpha magnet for bunch compression and injection into the APS linac line. This system is intended for use both as an injector for positron creation, and as a first beam source for the Low-Energy Undulator Test Line (LEUTL) project [1]. The first measured performance characteristics of the gun are presented.

  19. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    BELL, K.E.

    1999-08-12

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded.

  20. Learning Pitch with STDP: A Computational Model of Place and Temporal Pitch Perception Using Spiking Neural Networks.

    Directory of Open Access Journals (Sweden)

    Nafise Erfanian Saeedi

    2016-04-01

    Full Text Available Pitch perception is important for understanding speech prosody, music perception, recognizing tones in tonal languages, and perceiving speech in noisy environments. The two principal pitch perception theories consider the place of maximum neural excitation along the auditory nerve and the temporal pattern of the auditory neurons' action potentials (spikes as pitch cues. This paper describes a biophysical mechanism by which fine-structure temporal information can be extracted from the spikes generated at the auditory periphery. Deriving meaningful pitch-related information from spike times requires neural structures specialized in capturing synchronous or correlated activity from amongst neural events. The emergence of such pitch-processing neural mechanisms is described through a computational model of auditory processing. Simulation results show that a correlation-based, unsupervised, spike-based form of Hebbian learning can explain the development of neural structures required for recognizing the pitch of simple and complex tones, with or without the fundamental frequency. The temporal code is robust to variations in the spectral shape of the signal and thus can explain the phenomenon of pitch constancy.

  1. A global algorithm for estimating Absolute Salinity

    Directory of Open Access Journals (Sweden)

    T. J. McDougall

    2012-12-01

    Full Text Available The International Thermodynamic Equation of Seawater – 2010 has defined the thermodynamic properties of seawater in terms of a new salinity variable, Absolute Salinity, which takes into account the spatial variation of the composition of seawater. Absolute Salinity more accurately reflects the effects of the dissolved material in seawater on the thermodynamic properties (particularly density than does Practical Salinity.

    When a seawater sample has standard composition (i.e. the ratios of the constituents of sea salt are the same as those of surface water of the North Atlantic, Practical Salinity can be used to accurately evaluate the thermodynamic properties of seawater. When seawater is not of standard composition, Practical Salinity alone is not sufficient and the Absolute Salinity Anomaly needs to be estimated; this anomaly is as large as 0.025 g kg−1 in the northernmost North Pacific. Here we provide an algorithm for estimating Absolute Salinity Anomaly for any location (x, y, p in the world ocean.

    To develop this algorithm, we used the Absolute Salinity Anomaly that is found by comparing the density calculated from Practical Salinity to the density measured in the laboratory. These estimates of Absolute Salinity Anomaly however are limited to the number of available observations (namely 811. In order to provide a practical method that can be used at any location in the world ocean, we take advantage of approximate relationships between Absolute Salinity Anomaly and silicate concentrations (which are available globally.

  2. Jasminum flexile flower absolute from India--a detailed comparison with three other jasmine absolutes.

    Science.gov (United States)

    Braun, Norbert A; Kohlenberg, Birgit; Sim, Sherina; Meier, Manfred; Hammerschmidt, Franz-Josef

    2009-09-01

    Jasminum flexile flower absolute from the south of India and the corresponding vacuum headspace (VHS) sample of the absolute were analyzed using GC and GC-MS. Three other commercially available Indian jasmine absolutes from the species: J. sambac, J. officinale subsp. grandiflorum, and J. auriculatum and the respective VHS samples were used for comparison purposes. One hundred and twenty-one compounds were characterized in J. flexile flower absolute, with methyl linolate, benzyl salicylate, benzyl benzoate, (2E,6E)-farnesol, and benzyl acetate as the main constituents. A detailed olfactory evaluation was also performed.

  3. Meet the APS Editors Coffee Break

    Science.gov (United States)

    2014-03-01

    The APS Journal Editors invite you to join them for conversation and light refreshments. The Editors will be available to answer questions, discuss your ideas, and listen to your comments about the journals. All are welcome to attend.

  4. Pentoxifylline Treatment in Acute Pancreatitis (AP)

    Science.gov (United States)

    2018-02-21

    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  5. A Computationally Efficient Method for Polyphonic Pitch Estimation

    Directory of Open Access Journals (Sweden)

    Ruohua Zhou

    2009-01-01

    Full Text Available This paper presents a computationally efficient method for polyphonic pitch estimation. The method employs the Fast Resonator Time-Frequency Image (RTFI as the basic time-frequency analysis tool. The approach is composed of two main stages. First, a preliminary pitch estimation is obtained by means of a simple peak-picking procedure in the pitch energy spectrum. Such spectrum is calculated from the original RTFI energy spectrum according to harmonic grouping principles. Then the incorrect estimations are removed according to spectral irregularity and knowledge of the harmonic structures of the music notes played on commonly used music instruments. The new approach is compared with a variety of other frame-based polyphonic pitch estimation methods, and results demonstrate the high performance and computational efficiency of the approach.

  6. Investors prefer entrepreneurial ventures pitched by attractive men.

    Science.gov (United States)

    Brooks, Alison Wood; Huang, Laura; Kearney, Sarah Wood; Murray, Fiona E

    2014-03-25

    Entrepreneurship is a central path to job creation, economic growth, and prosperity. In the earliest stages of start-up business creation, the matching of entrepreneurial ventures to investors is critically important. The entrepreneur's business proposition and previous experience are regarded as the main criteria for investment decisions. Our research, however, documents other critical criteria that investors use to make these decisions: the gender and physical attractiveness of the entrepreneurs themselves. Across a field setting (three entrepreneurial pitch competitions in the United States) and two experiments, we identify a profound and consistent gender gap in entrepreneur persuasiveness. Investors prefer pitches presented by male entrepreneurs compared with pitches made by female entrepreneurs, even when the content of the pitch is the same. This effect is moderated by male physical attractiveness: attractive males were particularly persuasive, whereas physical attractiveness did not matter among female entrepreneurs.

  7. Determination of pitch rotation in a spherical birefringent microparticle

    Science.gov (United States)

    Roy, Basudev; Ramaiya, Avin; Schäffer, Erik

    2018-03-01

    Rotational motion of a three dimensional spherical microscopic object can happen either in pitch, yaw or roll fashion. Among these, the yaw motion has been conventionally studied using the intensity of scattered light from birefringent microspheres through crossed polarizers. Up until now, however, there is no way to study the pitch motion in spherical microspheres. Here, we suggest a new method to study the pitch motion of birefringent microspheres under crossed polarizers by measuring the 2-fold asymmetry in the scattered signal either using video microscopy or with optical tweezers. We show a couple of simple examples of pitch rotation determination using video microscopy for a microsphere attached with a kinesin molecule while moving along a microtubule and of a particle diffusing freely in water.

  8. Thermal transformations of pitch and its compositions with thermoanthracite

    Energy Technology Data Exchange (ETDEWEB)

    Belkina, T.V.; Ulanovskii, M.L.; Krysin, V.P.

    1983-01-01

    Derivatogrphy is used to investigate the character of thermal transformations of hard coal pitch in compositions with thermoanthracite. It was shown that losses in mass during thermal transformations of hard coal pitch in the temperature interval 200-1000 C occur in two stages, at a varying rate in the 200-600 C range and at a constant rate in the 600-1000 C range. The rate of loss in the 200-600 C range is determined primarily by the rate of diffusion of volatile components and products of pitch conversion and in the 600-1000 C range mainly by the rate of the elemental chemical event. The thermal transformation is essentially unchanged in the presence of thermoanthracite. Silica intensifies the synthesis and increases the solid residue yield. Increasing the rate of heating of the pitch-thermoanthracite brings about incomplete separation of volatile products and a corresponding increase in the solid residue yield. (9 refs.)

  9. Association of the pitch canker pathogen Fusarium circinatum with ...

    African Journals Online (AJOL)

    Association of the pitch canker pathogen Fusarium circinatum with grass hosts in commercial pine production areas of South Africa. Cassandra L Swett, Bernice Porter, Gerda Fourie, Emma T Steenkamp, Thomas R Gordon, Michael J Wingfield ...

  10. Meet you in the elevator! Pitching yourself and your research

    NARCIS (Netherlands)

    Scheffel, Maren; Börner, Dirk

    2013-01-01

    Scheffel, M., & Börner, D. (2013, 31 May). Meet you in the elevator! Pitching yourself and your research. Workshop presentation at the 9th Joint European Summer School on Technology Enhanced Learning, Limassol, Cyprus.

  11. Series pid pitch controller of large wind turbines generator

    Directory of Open Access Journals (Sweden)

    Micić Aleksandar D.

    2015-01-01

    Full Text Available For this stable process with oscillatory dynamics, characterized with small damping ratio and dominant transport delay, design of the series PID pitch controller is based on the model obtained from the open-loop process step response, filtered with the second-order Butterworth filter Fbw. Performance of the series PID pitch controller, with the filter Fbw, is analyzed by simulations of the set-point and input/output disturbance responses, including simulations with a colored noise added to the control variable. Excellent performance/robustness tradeoff is obtained, compared to the recently proposed PI pitch controllers and to the modified internal model pitch controller, developed here, which has a natural mechanism to compensate effect of dominant transport delay. [Projekat Ministarstva nauke Republike Srbije, br. III 47016

  12. AP1000 design and construction integration

    International Nuclear Information System (INIS)

    Winters, James W.; Clelland, Jill A.

    2004-01-01

    Construction costs of commercial nuclear generating plants must be reduced in order to expand the future use of nuclear energy. Two of the drivers of plant construction costs are the cost of financing during the construction duration and the substantial amount of skilled craft labor hours needed on site during construction. The application of information technology (IT) has been used to understand and reduce both of these drivers by establishing parallel construction paths using modules and integrating construction sequence review into the design process. In a program sponsored by EPRI, Westinghouse has modeled the construction of AP1000 in '4D' to show its viability, to improve its logic, to improve the plant design for constructibility and overall to reduce time and risk in the construction schedule. The design of most of AP1000 was constrained to be a duplicate of AP600 except where components required expansion for the higher power level. As a result, the construction schedule for AP1000 is as mature and as robust as that for AP600. Two areas important to the construction of AP1000 did require some design work because they could not remain the same as AP1000. First, the turbine building had to be redesigned to accommodate the larger turbine and its support systems. Again, as much of the AP600 design and philosophy as possible was retained. The building required enlargement and the basemat, foundations, steel structure and structural modules required modification. As concrete, steel, and equipment were defined by the designers, they were matched to the original AP600 turbine building schedule. This forced designers to assemble files to be consistent with building assembly activities and to think about constructibility as they defined the final design. Second, the reinforcement structure within the concrete under and supporting the containment vessel required detail design. Westinghouse was fortunate to have the constructor Obayashi of Japan recommend a detailed

  13. AP1000{sup TM} plant modularization

    Energy Technology Data Exchange (ETDEWEB)

    Cantarero L, C.; Demetri, K. J. [Westinghouse Electric Co., 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States); Quintero C, F. P., E-mail: cantarc@westinghouse.com [Westinghouse Electric Spain, Padilla 17, 28006 Madrid (Spain)

    2016-09-15

    The AP1000{sup TM} plant is an 1100 M We pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. Modules are used extensively in the design of the AP1000 plant nuclear island. The AP1000 plant uses modern, modular-construction techniques for plant construction. The design incorporates vendor-designed skids and equipment packages, as well as large, multi-ton structural modules and special equipment modules. Modularization allows traditionally sequential construction tasks to be completed simultaneously. Factory-built modules can be installed at the site in a planned construction schedule. The modularized AP1000 plant allows many more construction activities to proceed in parallel. This reduces plant construction calendar time, thus lowering the costs of plant financing. Furthermore, performing less work onsite significantly reduces the amount of skilled field-craft labor, which costs more than shop labor. In addition to labor cost savings, doing more welding and fabrication in a factory environment raises the quality of work, allowing more scheduling flexibility and reducing the amount of specialized tools required onsite. The site layout for the AP1000 plant has been established to support modular construction and efficient operations during construction. The plant layout is compact, using less space than previous conventional plant layouts. This paper provides and overview of the AP1000 plant modules with an emphasis on structural modules. Currently the Westinghouse AP1000 plant has four units under construction in China and four units under construction in the United States. All have shown successful fabrication and installation of various AP1000 plant modules. (Author)

  14. Pitch Sequence Complexity and Long-Term Pitcher Performance

    Directory of Open Access Journals (Sweden)

    Joel R. Bock

    2015-03-01

    Full Text Available Winning one or two games during a Major League Baseball (MLB season is often the difference between a team advancing to post-season play, or “waiting until next year”. Technology advances have made it feasible to augment historical data with in-game contextual data to provide managers immediate insights regarding an opponent’s next move, thereby providing a competitive edge. We developed statistical models of pitcher behavior using pitch sequences thrown during three recent MLB seasons (2011–2013. The purpose of these models was to predict the next pitch type, for each pitcher, based on data available at the immediate moment, in each at-bat. Independent models were developed for each player’s most frequent four pitches. The overall predictability of next pitch type is 74:5%. Additional analyses on pitcher predictability within specific game situations are discussed. Finally, using linear regression analysis, we show that an index of pitch sequence predictability may be used to project player performance in terms of Earned Run Average (ERA and Fielding Independent Pitching (FIP over a longer term. On a restricted range of the independent variable, reducing complexity in selection of pitches is correlated with higher values of both FIP and ERA for the players represented in the sample. Both models were significant at the α = 0.05 level (ERA: p = 0.022; FIP: p = 0.0114. With further development, such models may reduce risk faced by management in evaluation of potential trades, or to scouts assessing unproven emerging talent. Pitchers themselves might benefit from awareness of their individual statistical tendencies, and adapt their behavior on the mound accordingly. To our knowledge, the predictive model relating pitch-wise complexity and long-term performance appears to be novel.

  15. A Method for Low-Delay Pitch Tracking and Smoothing

    DEFF Research Database (Denmark)

    Christensen, Mads Græsbøll

    2012-01-01

    . In the second step, a Kalman filter is used to smooth the estimates and separate the pitch into a slowly varying component and a rapidly varying component. The former represents the mean pitch while the latter represents vibrato, slides and other fast changes. The method is intended for use in applica- tions...... that require fast and sample-by-sample estimates, like tuners for musical instruments, transcription tasks requiring details like vi- brato, and real-time tracking of voiced speech....

  16. Pitch perception in musical chords for cochlear implant users

    OpenAIRE

    Griffin, S. K.

    2017-01-01

    Many people with severe or profound hearing loss are able to benefit from electronic hearing provided by a cochlear implant (CI); however, perception of music is often reported to be unsatisfactory. Due to the sound processing restrictions and current spread, CI users do not always perceive accurate pitch information, which adversely affects their ability to perceive and enjoy music. This thesis examines the factors affecting pitch perception in musical contexts for CI recipients. A questionn...

  17. Accent phrase segmentation using transition probabilities between pitch pattern templates.

    OpenAIRE

    Shimodaira, Hiroshi; Nakai, Mitsuru

    1993-01-01

    This paper proposes a novel method for segmenting continuous speech into accent phrases by using a prosodic feature 'pitch pattern'. The pitch pattern extracted from input speech signals is divided into the accent segments automatically by using the One-Stage DP algorithm, in which reference templates representing various types of accent patterns and connectivity between them are used to find out the optimum sequence of accent segments. In case of making the reference templates from a large n...

  18. Identification and treatment of APS renal involvement.

    Science.gov (United States)

    Tektonidou, M G

    2014-10-01

    Renal involvement in antiphospholipid syndrome (APS), either primary or systemic lupus erythematosus (SLE)-related APS, includes renal artery stenosis or thrombosis, renal infarction, renal vein thrombosis and a small-vessel vaso-occlusive nephropathy defined as "antiphospholipid antibody (aPL)-associated nephropathy." aPL-associated nephropathy is characterized by acute lesions, thrombotic microangiopathy, and chronic lesions such as fibrous intimal hyperplasia, organizing thrombi with or without recanalization, fibrous occlusions of arteries or arterioles and focal cortical atrophy. Systemic hypertension, hematuria, proteinuria (ranging from mild to nephrotic level) and renal insufficiency represent the major clinical manifestations associated with aPL-associated nephropathy. Similar renal histologic and clinical characteristics have been described among all different groups of patients with positive aPL (primary APS, SLE-related APS, catastrophic APS and SLE/non-APS with positive aPL). In patients with aPL-associated nephropathy lesions in the absence of other causes associated with similar histological characteristics, aPL testing needs to be considered. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  19. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  20. Spectral Envelope Transformation in Singing Voice for Advanced Pitch Shifting

    Directory of Open Access Journals (Sweden)

    José L. Santacruz

    2016-11-01

    Full Text Available The aim of the present work is to perform a step towards more natural pitch shifting techniques in singing voice for its application in music production and entertainment systems. In this paper, we present an advanced method to achieve natural modifications when applying a pitch shifting process to singing voice by modifying the spectral envelope of the audio excerpt. To this end, an all-pole model has been selected to model the spectral envelope, which is estimated using a constrained non-linear optimization. The analysis of the global variations of the spectral envelope was carried out by identifying changes of the parameters of the model along with the changes of the pitch. With the obtained spectral envelope transformation functions, we applied our pitch shifting scheme to some sustained vowels in order to compare results with the same transformation made by using the Flex Pitch plugin of Logic Pro X and pitch synchronous overlap and add technique (PSOLA. This comparison has been carried out by means of both an objective and a subjective evaluation. The latter was done with a survey open to volunteers on our website.

  1. Absolute calibration in vivo measurement systems

    International Nuclear Information System (INIS)

    Kruchten, D.A.; Hickman, D.P.

    1991-02-01

    Lawrence Livermore National Laboratory (LLNL) is currently investigating a new method for obtaining absolute calibration factors for radiation measurement systems used to measure internally deposited radionuclides in vivo. Absolute calibration of in vivo measurement systems will eliminate the need to generate a series of human surrogate structures (i.e., phantoms) for calibrating in vivo measurement systems. The absolute calibration of in vivo measurement systems utilizes magnetic resonance imaging (MRI) to define physiological structure, size, and composition. The MRI image provides a digitized representation of the physiological structure, which allows for any mathematical distribution of radionuclides within the body. Using Monte Carlo transport codes, the emission spectrum from the body is predicted. The in vivo measurement equipment is calibrated using the Monte Carlo code and adjusting for the intrinsic properties of the detection system. The calibration factors are verified using measurements of existing phantoms and previously obtained measurements of human volunteers. 8 refs

  2. Vascular Manifestations in Antiphospholipid Syndrome (APS): Is APS a Thrombophilia or a Vasculopathy?

    Science.gov (United States)

    Siddique, Salma; Risse, Jessie; Canaud, Guillaume; Zuily, Stéphane

    2017-09-04

    Antiphospholipid antibody syndrome (APS) is characterized primarily by thrombosis and pregnancy morbidity. Chronic vascular lesions can also occur. While the underlying mechanisms of these vascular lesions are not entirely known, there have been multiple theories describing the potential process of vasculopathy in APS and the various clinical manifestations associated with it. Recently, it has been demonstrated that endothelial proliferation in kidneys can be explained by the activation of the mammalian target of rapamycin complex (mTORC) pathway by antiphospholipid antibodies (aPL). These data support the existence of an APS-related vasculopathy in different locations which can explain-in part-the different manifestations of APS. This review focuses on the various manifestations of APS as a result of APS-related vasculopathy, as well as pathophysiology, current screening, and treatment options for clinicians to be aware of.

  3. Optimal pitching axis location of flapping wings for efficient hovering flight

    NARCIS (Netherlands)

    Wang, Q.; Goosen, J.F.L.; van Keulen, A.

    2017-01-01

    Flapping wings can pitch passively about their pitching axes due to their flexibility, inertia, and aerodynamic loads. A shift in the pitching axis location can dynamically alter the aerodynamic loads, which in turn changes the passive pitching motion and the flight efficiency. Therefore, it is of

  4. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.

    2011-01-01

    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...... presence of both γ Dor and roAp pulsations and the unexpected detection of δ Sct and γ Dor pulsations in Ap stars present new opportunities and challenges for the interpretation of these stars. Since it is easy to confuse Am and Ap stars at classification dispersions, the nature of these Ap stars...

  5. Spirality: A Noval Way to Measure Spiral Arm Pitch Angle

    Science.gov (United States)

    Shields, Douglas W.; Boe, Benjamin; Henderson, Casey L.; Hartley, Matthew; Davis, Benjamin L.; Pour Imani, Hamed; Kennefick, Daniel; Kennefick, Julia D.

    2015-01-01

    We present the MATLAB code Spirality, a novel method for measuring spiral arm pitch angles by fitting galaxy images to spiral templates of known pitch. For a given pitch angle template, the mean pixel value is found along each of typically 1000 spiral axes. The fitting function, which shows a local maximum at the best-fit pitch angle, is the variance of these means. Error bars are found by varying the inner radius of the measurement annulus and finding the standard deviation of the best-fit pitches. Computation time is typically on the order of 2 minutes per galaxy, assuming at least 8 GB of working memory. We tested the code using 128 synthetic spiral images of known pitch. These spirals varied in the number of spiral arms, pitch angle, degree of logarithmicity, radius, SNR, inclination angle, bar length, and bulge radius. A correct result is defined as a result that matches the true pitch within the error bars, with error bars no greater than ±7°. For the non-logarithmic spiral sample, the correct answer is similarly defined, with the mean pitch as function of radius in place of the true pitch. For all synthetic spirals, correct results were obtained so long as SNR > 0.25, the bar length was no more than 60% of the spiral's diameter (when the bar was included in the measurement), the input center of the spiral was no more than 6% of the spiral radius away from the true center, and the inclination angle was no more than 30°. The synthetic spirals were not deprojected prior to measurement. The code produced the correct result for all barred spirals when the measurement annulus was placed outside the bar. Additionally, we compared the code's results against 2DFFT results for 203 visually selected spiral galaxies in GOODS North and South. Among the entire sample, Spirality's error bars overlapped 2DFFT's error bars 64% of the time. For those galaxies in which Source code is available by email request from the primary author.

  6. Westinghouse AP600 advanced nuclear plant design

    International Nuclear Information System (INIS)

    Gangloff, W.

    1999-01-01

    As part of the cooperative US Department of Energy (DOE) Advanced Light Water Reactor (ALWR) Program and the Electric Power Research Institute (EPRI), the Westinghouse AP600 team has developed a simplified, safe, and economic 600-megawatt plant to enter into a new era of nuclear power generation. Designed to satisfy the standards set by DOE and defined in the ALWR Utility Requirements Document (URD), the Westinghouse AP600 is an elegant combination of innovative safety systems that rely on dependable natural forces and proven technologies. The Westinghouse AP600 design simplifies plant systems and significant operation, inspections, maintenance, and quality assurance requirements by greatly reducing the amount of valves, pumps, piping, HVAC ducting, and other complex components. The AP600 safety systems are predominantly passive, depending on the reliable natural forces of gravity, circulation, convection, evaporation, and condensation, instead of AC power supplies and motor-driven components. The AP600 provides a high degree of public safety and licensing certainty. It draws upon 40 years of experience in light water reactor components and technology, so no demonstration plant is required. During the AP600 design program, a comprehensive test program was carried out to verify plant components, passive safety systems components, and containment behavior. When the test program was completed at the end of 1994, the AP600 became the most thoroughly tested advanced reactor design ever reviewed by the US Nuclear Regulatory Commission (NRC). The test results confirmed the exceptional behavior of the passive systems and have been instrumental in facilitating code validations. Westinghouse received Final Design Approval from the NRC in September 1998. (author)

  7. Dynamics of fluidic devices with applications to rotor pitch links

    Science.gov (United States)

    Scarborough, Lloyd H., III

    Coupling a Fluidic Flexible Matrix Composite (F2MC) to an air-pressurized fluid port produces a fundamentally new class of tunable vibration isolator. This fluidlastic device provides significant vibration reduction at an isolation frequency that can be tuned over a broad frequency range. The material properties and geometry of the F2MC element, as well as the port inertance, determine the isolation frequency. A unique feature of this device is that the port inertance depends on pressure so the isolation frequency can be adjusted by changing the air pressure. For constant port inertance, the isolation frequency is largely independent of the isolated mass so the device is robust to changes in load. A nonlinear model is developed to predict isolator length and port inertance. The model is linearized and the frequency response calculated. Experiments agree with theory, demonstrating a tunable isolation range from 9 Hz to 36 Hz and transmitted force reductions of up to 60 dB at the isolation frequency. Replacing rigid pitch links on rotorcraft with coupled fluidic devices has the potential to reduce the aerodynamic blade loads transmitted through the pitch links to the swashplate. Analytical models of two fluidic devices coupled with three different fluidic circuits are derived. These passive fluidlastic systems are tuned, by varying the fluid inertances and capacitances of each fluidic circuit, to reduce the transmitted pitch-link loads. The different circuit designs result in transmitted pitch link loads reduction at up to three main rotor harmonics. The simulation results show loads reduction at the targeted out-of-phase and in-phase harmonics of up to 88% and 93%, respectively. Experimental validation of two of the fluidic circuits demonstrates loads reduction of up to 89% at the out-of-phase isolation frequencies and up to 81% at the in-phase isolation frequencies. Replacing rigid pitch links on rotorcraft with fluidic pitch links changes the blade torsional

  8. Facial expression and vocal pitch height: Evidence of an intermodal association

    DEFF Research Database (Denmark)

    Huron, David; Dahl, Sofia; Johnson, Randolph

    2009-01-01

    region, judges still rated the high-pitch faces friendlier than the low-pitch faces. These results are consistent with prior research showing that vocal pitch height is used to signal aggression (low pitch) or appeasement (high pitch). An analysis of the facial features shows a strong correlation between...... eyebrow position and sung pitch—consistent with the role of eyebrows in signaling aggression and appeasement. Overall, the results are consistent with an inter-modal linkage between vocal and facial expressions....

  9. Influence of Pitch Height on the Perception of Submissiveness and Threat in Musical Passages

    Directory of Open Access Journals (Sweden)

    David Huron

    2006-09-01

    Full Text Available Bolinger, Ohala, Morton and others have established that vocal pitch height is perceived to be associated with social signals of dominance and submissiveness: higher vocal pitch is associated with submissiveness, whereas lower vocal pitch is associated with social dominance. An experiment was carried out to test this relationship in the perception of non-vocal melodies. Results show a parallel situation in music: higher-pitched melodies sound more submissive (less threatening than lower-pitched melodies.

  10. The Absolute Normal Scores Test for Symmetry

    Science.gov (United States)

    Penfield, Douglas A.; Sachdeva, Darshan

    1976-01-01

    The absolute normal scores test is described as a test for the symmetry of a distribution of scores about a location parameter. The test is compared to the sign test and the Wilcoxon test as an alternative to the "t"-test. (Editor/RK)

  11. The Theory of Absolute Reaction Rates

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 7. The Theory of Absolute Reaction Rates. Henry Eyring. Classics Volume 17 Issue 7 July 2012 pp 704-711. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/017/07/0704-0711. Author Affiliations.

  12. 49 CFR 236.709 - Block, absolute.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Block, absolute. 236.709 Section 236.709 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION, INSPECTION...

  13. Thin-film magnetoresistive absolute position detector

    NARCIS (Netherlands)

    Groenland, J.P.J.

    1990-01-01

    The subject of this thesis is the investigation of a digital absolute posi- tion-detection system, which is based on a position-information carrier (i.e. a magnetic tape) with one single code track on the one hand, and an array of magnetoresistive sensors for the detection of the information on the

  14. Det demokratiske argument for absolut ytringsfrihed

    DEFF Research Database (Denmark)

    Lægaard, Sune

    2014-01-01

    Artiklen diskuterer den påstand, at absolut ytringsfrihed er en nødvendig forudsætning for demokratisk legitimitet med udgangspunkt i en rekonstruktion af et argument fremsat af Ronald Dworkin. Spørgsmålet er, hvorfor ytringsfrihed skulle være en forudsætning for demokratisk legitimitet, og hvorf...

  15. Absolute Distance Measurements with Tunable Semiconductor Laser

    Czech Academy of Sciences Publication Activity Database

    Mikel, Břetislav; Číp, Ondřej; Lazar, Josef

    T118, - (2005), s. 41-44 ISSN 0031-8949 R&D Projects: GA AV ČR(CZ) IAB2065001 Keywords : tunable laser * absolute interferometer Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.661, year: 2004

  16. Stimulus Probability Effects in Absolute Identification

    Science.gov (United States)

    Kent, Christopher; Lamberts, Koen

    2016-01-01

    This study investigated the effect of stimulus presentation probability on accuracy and response times in an absolute identification task. Three schedules of presentation were used to investigate the interaction between presentation probability and stimulus position within the set. Data from individual participants indicated strong effects of…

  17. systemic complications following absolute alcohol embolisation of ...

    African Journals Online (AJOL)

    of the superficial temporal (STA), middle meningeal. (MMA) and occipital ... external jugular vein. Absolute alcohol was injected into the feeder artery using the intermittent pulsed spray technique in aliquots of 1 ml. A total of 55 ml of alcohol was injected. ... cells, vessel wall necrosis resulting in thrombosis and permanent ...

  18. On the absolute measure of Beta activities

    International Nuclear Information System (INIS)

    Sanchez del Rio, C.; Jimenez Reynaldo, O.; Rodriguez Mayquez, E.

    1956-01-01

    A new method for absolute beta counting of solid samples is given. The mea surements is made with an inside Geiger-Muller tube of new construction. The backscattering correction when using an infinite thick mounting is discussed and results for different materials given. (Author)

  19. Absolute tightness: the chemists hesitate to invest

    International Nuclear Information System (INIS)

    Anon.

    1996-01-01

    The safety requirements of industries as nuclear plants and the strengthening of regulations in the field of environment (more particularly those related to volatile organic compounds) have lead the manufacturers to build absolute tightness pumps. But these equipments do not answer all the problems and represent a high investment cost. In consequence, the chemists hesitate to invest. (O.L.)

  20. Pre- and Postseason Dynamic Ultrasound Evaluation of the Pitching Elbow.

    Science.gov (United States)

    Keller, Robert A; Marshall, Nathan E; Bey, Michael J; Ahmed, Hafeez; Scher, Courtney E; van Holsbeeck, Marnix; Moutzouros, Vasilios

    2015-09-01

    To use ultrasound imaging to document changes over time (i.e., preseason v postseason) in the pitching elbow of high school baseball pitchers. Twenty-two high school pitchers were prospectively followed. Pitchers were evaluated after a 2-month period of relative arm rest via preseason physical exams, dynamic ultrasound imaging of their throwing elbow, and the Quick Disabilities of the Arm, Shoulder, and Hand (QuickDASH) assessment. Players were reevaluated within 1 week of their last game. Dynamic ultrasound images were then randomized, blinded to testing time point, and evaluated by 2 fellowship-trained musculoskeletal radiologists. Average pitcher age was 16.9 years. Average pitches thrown was 456.5, maximum velocity 77.7 mph, games pitched 7.3, and days off between starts 6.6. From preseason to postseason, there were significant increases in ulnar collateral ligament (UCL) thickness (P = .02), ulnar nerve cross-sectional area (P = .001), UCL substance heterogeneity (P = .001), and QuickDASH scores (P = .03). In addition, there was a nonsignificant increase in loaded ulnohumeral joint space (P = .10). No pitchers had loose bodies on preseason exam, while 3 demonstrated loose bodies postseason. The increase in UCL thickness was significantly associated with the number of bullpen sessions per week (P = .01). The increase in ulnar nerve cross-sectional area was significantly associated with the number of pitches (P = .04), innings pitched (P = .01), and games pitched (P = .04). The stresses placed on the elbow during only one season of pitching create adaptive changes to multiple structures about the elbow including UCL heterogeneity and thickening, increased ulnohumeral joint space laxity, and enlarged ulnar nerve cross-sectional area. Level II prospective observational study. Copyright © 2015 Arthroscopy Association of North America. Published by Elsevier Inc. All rights reserved.

  1. Neural mechanisms underlying melodic perception and memory for pitch.

    Science.gov (United States)

    Zatorre, R J; Evans, A C; Meyer, E

    1994-04-01

    The neural correlates of music perception were studied by measuring cerebral blood flow (CBF) changes with positron emission tomography (PET). Twelve volunteers were scanned using the bolus water method under four separate conditions: (1) listening to a sequence of noise bursts, (2) listening to unfamiliar tonal melodies, (3) comparing the pitch of the first two notes of the same set of melodies, and (4) comparing the pitch of the first and last notes of the melodies. The latter two conditions were designed to investigate short-term pitch retention under low or high memory load, respectively. Subtraction of the obtained PET images, superimposed on matched MRI scans, provides anatomical localization of CBF changes associated with specific cognitive functions. Listening to melodies, relative to acoustically matched noise sequences, resulted in CBF increases in the right superior temporal and right occipital cortices. Pitch judgments of the first two notes of each melody, relative to passive listening to the same stimuli, resulted in right frontal-lobe activation. Analysis of the high memory load condition relative to passive listening revealed the participation of a number of cortical and subcortical regions, notably in the right frontal and right temporal lobes, as well as in parietal and insular cortex. Both pitch judgment conditions also revealed CBF decreases within the left primary auditory cortex. We conclude that specialized neural systems in the right superior temporal cortex participate in perceptual analysis of melodies; pitch comparisons are effected via a neural network that includes right prefrontal cortex, but active retention of pitch involves the interaction of right temporal and frontal cortices.

  2. Learning for pitch and melody discrimination in congenital amusia.

    Science.gov (United States)

    Whiteford, Kelly L; Oxenham, Andrew J

    2018-03-23

    Congenital amusia is currently thought to be a life-long neurogenetic disorder in music perception, impervious to training in pitch or melody discrimination. This study provides an explicit test of whether amusic deficits can be reduced with training. Twenty amusics and 20 matched controls participated in four sessions of psychophysical training involving either pure-tone (500 Hz) pitch discrimination or a control task of lateralization (interaural level differences for bandpass white noise). Pure-tone pitch discrimination at low, medium, and high frequencies (500, 2000, and 8000 Hz) was measured before and after training (pretest and posttest) to determine the specificity of learning. Melody discrimination was also assessed before and after training using the full Montreal Battery of Evaluation of Amusia, the most widely used standardized test to diagnose amusia. Amusics performed more poorly than controls in pitch but not localization discrimination, but both groups improved with practice on the trained stimuli. Learning was broad, occurring across all three frequencies and melody discrimination for all groups, including those who trained on the non-pitch control task. Following training, 11 of 20 amusics no longer met the global diagnostic criteria for amusia. A separate group of untrained controls (n = 20), who also completed melody discrimination and pretest, improved by an equal amount as trained controls on all measures, suggesting that the bulk of learning for the control group occurred very rapidly from the pretest. Thirty-one trained participants (13 amusics) returned one year later to assess long-term maintenance of pitch and melody discrimination. On average, there was no change in performance between posttest and one-year follow-up, demonstrating that improvements on pitch- and melody-related tasks in amusics and controls can be maintained. The findings indicate that amusia is not always a life-long deficit when using the current standard

  3. Faster decline of pitch memory over time in congenital amusia.

    Science.gov (United States)

    Williamson, Victoria J; McDonald, Claire; Deutsch, Diana; Griffiths, Timothy D; Stewart, Lauren

    2010-04-26

    Congenital amusia (amusia, hereafter) is a developmental disorder that impacts negatively on the perception of music. Psychophysical testing suggests that individuals with amusia have above average thresholds for detection of pitch change and pitch direction discrimination; however, a low-level auditory perceptual problem cannot completely explain the disorder, since discrimination of melodies is also impaired when the constituent intervals are suprathreshold for perception. The aim of the present study was to test pitch memory as a function of (a) time and (b) tonal interference, in order to determine whether pitch traces are inherently weaker in amusic individuals. Memory for the pitch of single tones was compared using two versions of a paradigm developed by Deutsch (1970a). In both tasks, participants compared the pitch of a standard (S) versus a comparison (C) tone. In the time task, the S and C tones were presented, separated in time by 0, 1, 5, 10, and 15 s (blocked presentation). In the interference task, the S and C tones were presented with a fixed time interval (5 s) but with a variable number of irrelevant tones in between 0, 2, 4, 6, and 8 tones (blocked presentation). In the time task, control performance remained high for all time intervals, but amusics showed a performance decrement over time. In the interference task, controls and amusics showed a similar performance decrement with increasing number of irrelevant tones. Overall, the results suggest that the pitch representations of amusic individuals are less stable and more prone to decay than those of matched non-amusic individuals.

  4. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-12-22

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed.

  5. The Significance of the Right Dorsolateral Prefrontal Cortex for Pitch Memory in Non-musicians Depends on Baseline Pitch Memory Abilities

    OpenAIRE

    Schaal, Nora K.; Kretschmer, Marina; Keitel, Ariane; Krause, Vanessa; Pfeifer, Jasmin; Pollok, Bettina

    2017-01-01

    Pitch memory is a resource which is shared by music and language. Neuroimaging studies have shown that the right dorsolateral prefrontal cortex (DLPFC) is activated during pitch memory processes. The present study investigated the causal significance of this brain area for pitch memory in non-musicians by applying cathodal and sham transcranial direct current stimulation (tDCS) over the right DLPFC and examining the impact on offline pitch and visual memory span performances. On the overall s...

  6. Pitch contour identification with combined place and temporal cues using cochlear implants

    Science.gov (United States)

    Luo, Xin; Padilla, Monica; Landsberger, David M.

    2012-01-01

    This study investigated the integration of place- and temporal-pitch cues in pitch contour identification (PCI), in which cochlear implant (CI) users were asked to judge the overall pitch-change direction of stimuli. Falling and rising pitch contours were created either by continuously steering current between adjacent electrodes (place pitch), by continuously changing amplitude modulation (AM) frequency (temporal pitch), or both. The percentage of rising responses was recorded as a function of current steering or AM frequency change, with single or combined pitch cues. A significant correlation was found between subjects’ sensitivity to current steering and AM frequency change. The integration of place- and temporal-pitch cues was most effective when the two cues were similarly discriminable in isolation. Adding the other (place or temporal) pitch cues shifted the temporal- or place-pitch psychometric functions horizontally without changing the slopes. PCI was significantly better with consistent place- and temporal-pitch cues than with inconsistent cues. PCI with single cues and integration of pitch cues were similar on different electrodes. The results suggest that CI users effectively integrate place- and temporal-pitch cues in relative pitch perception tasks. Current steering and AM frequency change should be coordinated to better transmit dynamic pitch information to CI users. PMID:22352506

  7. Three-dimensional cascaded system analysis of a 50 µm pixel pitch wafer-scale CMOS active pixel sensor x-ray detector for digital breast tomosynthesis.

    Science.gov (United States)

    Zhao, C; Vassiljev, N; Konstantinidis, A C; Speller, R D; Kanicki, J

    2017-03-07

    High-resolution, low-noise x-ray detectors based on the complementary metal-oxide-semiconductor (CMOS) active pixel sensor (APS) technology have been developed and proposed for digital breast tomosynthesis (DBT). In this study, we evaluated the three-dimensional (3D) imaging performance of a 50 µm pixel pitch CMOS APS x-ray detector named DynAMITe (Dynamic Range Adjustable for Medical Imaging Technology). The two-dimensional (2D) angle-dependent modulation transfer function (MTF), normalized noise power spectrum (NNPS), and detective quantum efficiency (DQE) were experimentally characterized and modeled using the cascaded system analysis at oblique incident angles up to 30°. The cascaded system model was extended to the 3D spatial frequency space in combination with the filtered back-projection (FBP) reconstruction method to calculate the 3D and in-plane MTF, NNPS and DQE parameters. The results demonstrate that the beam obliquity blurs the 2D MTF and DQE in the high spatial frequency range. However, this effect can be eliminated after FBP image reconstruction. In addition, impacts of the image acquisition geometry and detector parameters were evaluated using the 3D cascaded system analysis for DBT. The result shows that a wider projection angle range (e.g.  ±30°) improves the low spatial frequency (below 5 mm -1 ) performance of the CMOS APS detector. In addition, to maintain a high spatial resolution for DBT, a focal spot size of smaller than 0.3 mm should be used. Theoretical analysis suggests that a pixelated scintillator in combination with the 50 µm pixel pitch CMOS APS detector could further improve the 3D image resolution. Finally, the 3D imaging performance of the CMOS APS and an indirect amorphous silicon (a-Si:H) thin-film transistor (TFT) passive pixel sensor (PPS) detector was simulated and compared.

  8. Building an AP Social Studies Program with Non-Traditional AP Students

    Science.gov (United States)

    Ashmead, Amanda; Blanchette, Sue

    2013-01-01

    Equal access to education, that is to a high quality education, has increasingly come to mean access to an Advanced Placement program. In recent years, there has been steady attention paid to opening access to AP programs. The 9th annual College Board report (2013) stated "students who succeed on an AP Exam during high school typically…

  9. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  10. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  11. Study of Pumping Capacity of Pitched Blade Impellers

    Directory of Open Access Journals (Sweden)

    I. Fořt

    2002-01-01

    Full Text Available A study was made of the pumping capacity of pitched blade impellers in a cylindrical pilot plant vessel with four standard radial baffles at the wall under a turbulent regime of flow. The pumping capacity was calculated from the radial profile of the axial flow, under the assumption of axial symmetry of the discharge flow. The mean velocity was measured using laser Doppler anemometry in a transparent vessel of diameter T = 400 mm, provided with a standard dished bottom. Three and six blade pitched blade impellers (the pitch angle varied within the interval a Îá24°; 45°ń of impeller/vessel diameter ratio D/T = 0.36, as well as a three blade pitched blade impeller with folded blades of the same diameter, were tested. The calculated results were compared with the results of experiments mentioned in the literature, above all in cylindrical vessels with a flat bottom. Both arrangements of the agitated system were described by the impeller energetic efficiency, i.e, a criterion including in dimensionless form both the impeller energy consumption (impeller power input and the impeller pumping effect (impeller pumping capacity. It follows from the results obtained with various geometrical configurations that the energetic efficiency of pitched blade impellers is significantly lower for configurations suitable for mixing solid-liquid suspensions (low impeller off bottom clearances than for blending miscible liquids in mixing (higher impeller off bottom clearances.

  12. Modeling unsteady forces and pressures on a rapidly pitching airfoil

    Science.gov (United States)

    Schiavone, Nicole K.; Dawson, Scott T. M.; Rowley, Clarence W.; Williams, David R.

    2014-11-01

    This work develops models to quantify and understand the unsteady aerodynamic forces arising from rapid pitching motion of a NACA0012 airfoil at a Reynolds number of 50 000. The system identification procedure applies a generalized DMD-type algorithm to time-resolved wind tunnel measurements of the lift and drag forces, as well as the pressure at six locations on the suction surface of the airfoil. Models are identified for 5-degree pitch-up and pitch-down maneuvers within the overall range of 0-20 degrees. The identified models can accurately capture the effects of flow separation and leading-edge vortex formation and convection. We demonstrate that switching between different linear models can give accurate prediction of the nonlinear behavior that is present in high-amplitude maneuvers. The models are accurate for a wide-range of motions, including pitch-and-hold, sinusoidal, and pseudo-random pitching maneuvers. Providing the models access to a subset of the measured data channels can allow for improved estimates of the remaining states via the use of a Kalman filter, suggesting that the modeling framework could be useful for aerodynamic control applications. This work was supported by the Air Force Office of Scientific Research, under Award No. FA9550-12-1-0075.

  13. The Absolute Shielding Constants of Heavy Nuclei: Resolving the Enigma of the (119)Sn Absolute Shielding.

    Science.gov (United States)

    Malkin, Elena; Komorovsky, Stanislav; Repisky, Michal; Demissie, Taye B; Ruud, Kenneth

    2013-02-07

    We demonstrate that the apparent disagreement between experimental determinations and four-component relativistic calculations of the absolute shielding constants of heavy nuclei is due to the breakdown of the commonly assumed relation between the electronic contribution to the nuclear spin-rotation constants and the paramagnetic contribution to the NMR shielding constants. We demonstrate that this breakdown has significant consequences for the absolute shielding constant of (119)Sn, leading to errors of about 1000 ppm. As a consequence, we expect that many absolute shielding constants of heavy nuclei will be in need of revision.

  14. Shuttle APS propellant thermal conditioner study

    Science.gov (United States)

    Pearson, W. E.

    1971-01-01

    A study program was performed to allow selection of thermal conditioner assemblies for superheating O2 and H2 at supercritical pressures. The application was the auxiliary propulsion system (APS) for the space shuttle vehicle. The O2/H2 APS propellant feed system included propellant conditioners, of which the thermal conditioner assemblies were a part. Cryogens, pumped to pressures above critical, were directed to the thermal conditioner assembly included: (1) a gas generator assembly with ignition system and bipropellant valves, which burned superheated O2 and H2 at rich conditions; (2) a heat exchanger assembly for thermal conditioning of the cryogenic propellant; and (3) a dump nozzle for heat exchanger exhaust.

  15. An analysis of AP600 design features

    International Nuclear Information System (INIS)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author)

  16. From Hubble's NGSL to Absolute Fluxes

    Science.gov (United States)

    Heap, Sara R.; Lindler, Don

    2012-01-01

    Hubble's Next Generation Spectral Library (NGSL) consists of R-l000 spectra of 374 stars of assorted temperature, gravity, and metallicity. Each spectrum covers the wavelength range, 0.18-1.00 microns. The library can be viewed and/or downloaded from the website, http://archive.stsci.edu/prepds/stisngsll. Stars in the NGSL are now being used as absolute flux standards at ground-based observatories. However, the uncertainty in the absolute flux is about 2%, which does not meet the requirements of dark-energy surveys. We are therefore developing an observing procedure that should yield fluxes with uncertainties less than 1 % and will take part in an HST proposal to observe up to 15 stars using this new procedure.

  17. Trapped individual ion at absolute zero temperature

    Science.gov (United States)

    Yu, Nan; Dehmelt, Hans; Nagourney, Warren

    1989-01-01

    Laser cooling and ion trapping have progressed to such an extent that one can now speak of realizing a confined atom at absolute zero temperature. In this short publication, we analyze an experiment toward such realization using a single Ba+ ion in a miniature rf trap. The Ba+ ion is first laser-cooled to the limit where the ion spends most of its time in the zero-point energy state. Then a test sequence allows one to verify whether or not the ion is actually in its zero-point state. The test sequence may also serve as a device for state selection of an atom at absolute zero temperature. PMID:16594054

  18. Electrically tuned photoluminescence in large pitch cholesteric liquid crystal

    International Nuclear Information System (INIS)

    Middha, Manju; Kumar, Rishi; Raina, K. K.

    2014-01-01

    Cholesteric liquid crystals are known as 1-D photonic band gap materials due to their periodic helical supramolecular structure and larger birefringence. Depending upon the helical twisted pitch length, they give the characteristic contrast due to selective Bragg reflections when viewed through the polarizing optical microscope and hence affect the electro-optic properties. So the optimization of chiral dopant concentration in nematic liquid crystal leads to control the transmission of polarized light through the microscope. Hence transmission based polarizing optical microscope is used for the characterization of helical pitch length in the optical texture. The unwinding of helical pitch was observed with the application of electric field which affects the intensity of photoluminescence

  19. Demonstration of partial pitch 2-bladed wind turbine

    DEFF Research Database (Denmark)

    Kim, Taeseong; Zahle, Frederik; Troldborg, Niels

    This is the final report for the EUDP project performed from January 2012 to December 2015. The main objective for the project was to demonstrate the potential of the partial pitch two-bladed (PP-2B) technology. DTU Wind Energy took a responsibility for three workpackages (WPs) among 6 WPs which...... were aerodynamic evaluation of partial pitch technology (WP2), aeroelastic analysis of two-bladed turbine (WP3) and On-site testing (WP4). For the WP2, a comprehensive set of 3D CFD simulations including the gap between inner and outer part of the blade and vortex generators (VGs) of both cross...... pitch concept and detailed load analyses were performed. Also the comparison studies between numerical results and experimental results were performed. Moreover stability analyses for the PP- 2B turbine have been performed with HAWC2 and modal analysis using Hill’s method was performed to calculate...

  20. Pitching stability analysis of half-rotating wing air vehicle

    Science.gov (United States)

    Wang, Xiaoyi; Wu, Yang; Li, Qian; Li, Congmin; Qiu, Zhizhen

    2017-06-01

    Half-Rotating Wing (HRW) is a new power wing which had been developed by our work team using rotating-type flapping instead of oscillating-type flapping. Half-Rotating Wing Air Vehicle (HRWAV) is similar as Bionic Flapping Wing Air Vehicle (BFWAV). It is necessary to guarantee pitching stability of HRWAV to maintain flight stability. The working principle of HRW was firstly introduced in this paper. The rule of motion indicated that the fuselage of HRWAV without empennage would overturn forward as it generated increased pitching movement. Therefore, the empennage was added on the tail of HRWAV to balance the additional moment generated by aerodynamic force during flight. The stability analysis further shows that empennage could weaken rapidly the pitching disturbance on HRWAV and a new balance of fuselage could be achieved in a short time. Case study using numerical analysis verified correctness and validity of research results mentioned above, which could provide theoretical guidance to design and control HRWAV.

  1. Numerical Prediction of Hydromechanical Behaviour of Controllable Pitch Propeller

    Directory of Open Access Journals (Sweden)

    Saman Tarbiat

    2014-01-01

    Full Text Available The research described in this paper was carried out to predict hydrodynamic and frictional forces of controllable pitch propeller (CPP that bring about fretting problems in a blade bearing. The governing equations are Reynolds-averaged Navier-Stokes (RANS and are solved by OpenFOAM solver for hydrodynamic forces behind the ship’s wake. Frictional forces are calculated by practical mechanical formulae. Different advance velocities with constant rotational speed for blades are used to achieve hydrodynamic coefficients in open water and the wake behind the propeller. Results are compared at four different pitches. Detailed numerical results of 3D modelling of the propeller, hydrodynamic characteristics, and probability of the fretting motion in the propeller are presented. Results show that the probability of the fretting movement is related to the pitch.

  2. Interaural bimodal pitch matching with two-formant vowels

    DEFF Research Database (Denmark)

    Guerit, Francois Marie Louis Paul; Chalupper, Josef; Santurette, Sébastien

    practice. Behavioral pitch matching between the two ears has also been suggested, but has been shown to be tedious and unreliable. Here, an alternative method using two-formant vowels was developed and tested with a vocoder system simulating different CI insertion depths. The hypothesis was that patients...... may more easily identify vowels than perform a classical pitch-matching task. A spectral shift is inferred by comparing vowel spaces, measured by presenting the first formant in the HA and the second either in the HA or the CI. Preliminary results suggest that pitch mismatches can be derived from...... such vowel spaces. In order to take auditory adaptation in individual patients into account, the method will be tested with CI patients with contralateral residual hearing....

  3. Interpolation of uniformly absolutely continuous operators

    Czech Academy of Sciences Publication Activity Database

    Cobos, F.; Gogatishvili, Amiran; Opic, B.; Pick, L.

    2013-01-01

    Roč. 286, 5-6 (2013), s. 579-599 ISSN 0025-584X R&D Projects: GA ČR GA201/08/0383 Institutional support: RVO:67985840 Keywords : uniformly absolutely continuous operators * interpolation * type of an interpolation method Subject RIV: BA - General Mathematics Impact factor: 0.658, year: 2013 http://onlinelibrary.wiley.com/doi/10.1002/ mana .201100205/full

  4. Absolute spectrophotometry of the β Lyr

    International Nuclear Information System (INIS)

    Burnashev, V.I.; Skul'skij, M.Yu.

    1978-01-01

    In 1974 an absolute spectrophotometry of β Lyr was performed with the scanning spectrophotometer in the 3300-7400 A range. The energy distribution in the β Lyr spectrum is obtained. The β Lyr model is proposed. It is shown, that the continuous spectrum of the β Lyr radiation can be presented by the total radiation of the B8 3 and A5 3 two stars and of the gaseous envelope with Te =20000 K

  5. Benzofuranoid and bicyclooctanoid neolignans:absolute configuration

    International Nuclear Information System (INIS)

    Alvarenga, M.A. de; Giesbrecht, A.M.; Gottlieb, O.R.; Yoshida, M.

    1977-01-01

    The naturally occuring benzofuranoid and bicyclo (3,2,1) octanoid neolignans have their relative configurations established by 1 H and 13 C NMR, inclusively with aid of the solvent shift technique. Interconversion of the benzofuranoid type compounds, as well as for a benzofuranoid to a bicyclooctanoid derivate, make ORD correlations, ultimately with (2S, 3S) - and (2R,3R)-2,3- dihydrobenzofurans, possible, and led to the absolute configurations of both series of neolignans [pt

  6. Boosting pitch encoding with audiovisual interactions in congenital amusia.

    Science.gov (United States)

    Albouy, Philippe; Lévêque, Yohana; Hyde, Krista L; Bouchet, Patrick; Tillmann, Barbara; Caclin, Anne

    2015-01-01

    The combination of information across senses can enhance perception, as revealed for example by decreased reaction times or improved stimulus detection. Interestingly, these facilitatory effects have been shown to be maximal when responses to unisensory modalities are weak. The present study investigated whether audiovisual facilitation can be observed in congenital amusia, a music-specific disorder primarily ascribed to impairments of pitch processing. Amusic individuals and their matched controls performed two tasks. In Task 1, they were required to detect auditory, visual, or audiovisual stimuli as rapidly as possible. In Task 2, they were required to detect as accurately and as rapidly as possible a pitch change within an otherwise monotonic 5-tone sequence that was presented either only auditorily (A condition), or simultaneously with a temporally congruent, but otherwise uninformative visual stimulus (AV condition). Results of Task 1 showed that amusics exhibit typical auditory and visual detection, and typical audiovisual integration capacities: both amusics and controls exhibited shorter response times for audiovisual stimuli than for either auditory stimuli or visual stimuli. Results of Task 2 revealed that both groups benefited from simultaneous uninformative visual stimuli to detect pitch changes: accuracy was higher and response times shorter in the AV condition than in the A condition. The audiovisual improvements of response times were observed for different pitch interval sizes depending on the group. These results suggest that both typical listeners and amusic individuals can benefit from multisensory integration to improve their pitch processing abilities and that this benefit varies as a function of task difficulty. These findings constitute the first step towards the perspective to exploit multisensory paradigms to reduce pitch-related deficits in congenital amusia, notably by suggesting that audiovisual paradigms are effective in an appropriate

  7. Tank 241-AP-107 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107

  8. Barron's AP English literature and composition

    CERN Document Server

    Ehrenhaft EdD, George

    2016-01-01

    Includes five full-length practice AP exams with all questions answered and explained. Also features additional reviews on poetry, fiction, and drama, definitions of 175 literary and rhetorical terms, and more. Can be purchased alone or with an optional CD-ROM with two additional practice tests.

  9. The Promise of AP World History

    Science.gov (United States)

    Saldaña, Cristóbal T.

    2013-01-01

    AP World History is the ideal history course. It introduces students to 10,000 years of world history, and demands critical reading, critical writing, and critical thinking skills on the part of both the teacher and the students. It requires students to build their expertise in reading their textbook, and places demands on the teacher to assign…

  10. Meet the Editors of APS Reception

    Science.gov (United States)

    The Editors of the APS journals invite you to join them for conversation on Tuesday, March 15, 4:30-6:00 pm. The Editors will be available to answer questions, hear your ideas, and discuss any comments about the journals. All are welcome. Light refreshments will be served.

  11. The Demographic Wave: Rethinking Hispanic AP Trends

    Science.gov (United States)

    Edwards, Kelcey; Sawtell, Ellen

    2013-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Las Vegas, NV in July 2013. This presentation reviews new research examining the AP® experience of Hispanic graduates over the past decade. Topics include an in-depth look at the AP Spanish Language and Culture gateway hypothesis and trends in family characteristics such as parent…

  12. Structuring the AP Art History Course

    Science.gov (United States)

    Herscher, Walter R.

    2013-01-01

    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  13. Asteroseismic Theory of Rapidly Oscillating Ap Stars

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 26; Issue 2-3. Asteroseismic Theory of Rapidly Oscillating Ap Stars. Margarida S. Cunha. Volume 26 Issue 2-3 June-September 2005 pp 213-221. Fulltext. Click here to view fulltext PDF. Permanent link:

  14. Automatic pitch detection for a computer game interface

    International Nuclear Information System (INIS)

    Fonseca Solis, Juan M.

    2015-01-01

    A software able to recognize notes played by musical instruments is created through automatic pitch recognition. A pitch recognition algorithm is embedded into a software project, using the C implementation of SWIPEP. A memory game is chosen for project. A sequence of notes is listened and played by user to the computer, using a soprano recorder flute. The basic concepts to understand the acoustic phenomena involved are explained. The paper is aimed for all students with basic programming knowledge and want to incorporate sound processing to their projects. (author) [es

  15. Pitch and roll hydrodynamics of a pericell hovercraft

    Science.gov (United States)

    Moran, David D.

    1986-12-01

    Pitch and roll responses of hovercraft have been extremely difficult to predict due to the complexity of hydrodynamic analyses on one hand and the difficulties of appropriate cushion scale modeling on the other. The paper presents comparisons of pitch and roll stiffness coefficients for overwater and overland operations. Data are presented from model-scale and full-scale trials and analytic-numerical modeling. The effects of model-scale on the cushion dynamics relative to rotational responses are presented and the important characteristics of overwater and overland responses are discussed.

  16. Electric Control Substituting Pitch Control for Large Wind Turbines

    Directory of Open Access Journals (Sweden)

    Jon Kjellin

    2013-01-01

    turbine has fixed pitch and is only controlled electrically accommodated by passive stall of the blades. By electrically controlling the generator rotational speed with the inverter, passive stall regulation is enabled. The first results on experimental verification of stall regulation in gusty wind speeds are presented. The experiments show that the control system can keep the turbine rotational speed constant even at very gusty winds. It is concluded that electrical control accommodated by passive stall is sufficient as control of the wind turbine even at high wind speeds and can substitute mechanical control such as blade pitch.

  17. Adaptive sliding mode back-stepping pitch angle control of a variable-displacement pump controlled pitch system for wind turbines.

    Science.gov (United States)

    Yin, Xiu-xing; Lin, Yong-gang; Li, Wei; Liu, Hong-wei; Gu, Ya-jing

    2015-09-01

    A variable-displacement pump controlled pitch system is proposed to mitigate generator power and flap-wise load fluctuations for wind turbines. The pitch system mainly consists of a variable-displacement hydraulic pump, a fixed-displacement hydraulic motor and a gear set. The hydraulic motor can be accurately regulated by controlling the pump displacement and fluid flows to change the pitch angle through the gear set. The detailed mathematical representation and dynamic characteristics of the proposed pitch system are thoroughly analyzed. An adaptive sliding mode pump displacement controller and a back-stepping stroke piston controller are designed for the proposed pitch system such that the resulting pitch angle tracks its desired value regardless of external disturbances and uncertainties. The effectiveness and control efficiency of the proposed pitch system and controllers have been verified by using realistic dataset of a 750 kW research wind turbine. Copyright © 2015 ISA. Published by Elsevier Ltd. All rights reserved.

  18. Optimization of Nano-Grating Pitch Evaluation Method Based on Line Edge Roughness Analysis

    Directory of Open Access Journals (Sweden)

    Chen Jie

    2017-12-01

    Full Text Available Pitch uncertainty and line edge roughness are among the critical quality attributes of a pitch standard and normally the analyses of these two parameters are separate. The analysis of self-traceable Cr atom lithography nano-gratings shows a positive relevance and sensitivity between LER and evaluated standard deviation of pitch. Therefore, LER can be used as an aided pre-evaluation parameter for the pitch calculation method, such as the gravity center method or the zero-crossing points method. The optimization of the nano-grating evaluation method helps to obtain the accurate pitch value with fewer measurements and provide a comprehensive characterization of pitch standards.

  19. Changes in pitch height elicit both language-universal and language-dependent changes in neural representation of pitch in the brainstem and auditory cortex.

    Science.gov (United States)

    Krishnan, Ananthanarayan; Suresh, Chandan H; Gandour, Jackson T

    2017-03-27

    Language experience shapes encoding of pitch-relevant information at both brainstem and cortical levels of processing. Pitch height is a salient dimension that orders pitch from low to high. Herein we investigate the effects of language experience (Chinese, English) in the brainstem and cortex on (i) neural responses to variations in pitch height, (ii) presence of asymmetry in cortical pitch representation, and (iii) patterns of relative changes in magnitude of pitch height between these two levels of brain structure. Stimuli were three nonspeech homologs of Mandarin Tone 2 varying in pitch height only. The frequency-following response (FFR) and the cortical pitch-specific response (CPR) were recorded concurrently. At the Fz-linked T7/T8 site, peak latency of Na, Pb, and Nb decreased with increasing pitch height for both groups. Peak-to-peak amplitude of Na-Pb and Pb-Nb increased with increasing pitch height across groups. A language-dependent effect was restricted to Na-Pb; the Chinese had larger amplitude than the English group. At temporal sites (T7/T8), the Chinese group had larger amplitude, as compared to English, across stimuli, but also limited to the Na-Pb component and right temporal site. In the brainstem, F0 magnitude decreased with increasing pitch height; Chinese had larger magnitude across stimuli. A comparison of CPR and FFR responses revealed distinct patterns of relative changes in magnitude common to both groups. CPR amplitude increased and FFR amplitude decreased with increasing pitch height. Experience-dependent effects on CPR components vary as a function of neural sensitivity to pitch height within a particular temporal window (Na-Pb). Differences between the auditory brainstem and cortex imply distinct neural mechanisms for pitch extraction at both levels of brain structure. Copyright © 2017 IBRO. Published by Elsevier Ltd. All rights reserved.

  20. Changes in pitch height elicit both language universal and language dependent changes in neural representation of pitch in the brainstem and auditory cortex

    Science.gov (United States)

    Krishnan, Ananthanarayan; Suresh, Chandan H.; Gandour, Jackson T.

    2017-01-01

    Language experience shapes encoding of pitch-relevant information at both brainstem and cortical levels of processing. Pitch height is a salient dimension that orders pitch from low to high. Herein we investigate the effects of language experience (Chinese, English) in the brainstem and cortex on i) neural responses to variations in pitch height, ii) presence of asymmetry in cortical pitch representation, and iii) patterns of relative changes in magnitude of pitch height between these two levels of brain structure. Stimuli were three nonspeech homologs of Mandarin Tone 2 varying in pitch height only. The frequency-following response (FFR) and the cortical pitch-specific response (CPR) were recorded concurrently. At the Fz-linked T7/T8 site, peak latency of Na, Pb, and Nb decreased with increasing pitch height for both groups. Peak-to-peak amplitude of Na–Pb and Pb–Nb increased with increasing pitch height across groups. A language-dependent effect was restricted to Na-Pb; the Chinese had larger amplitude than the English group. At temporal sites (T7/T8), the Chinese group had larger amplitude, as compared to English, across stimuli, but also limited to the Na-Pb component and right temporal site. In the brainstem, F0 magnitude decreased with increasing pitch height; Chinese had larger magnitude across stimuli. A comparison of CPR and FFR responses revealed distinct patterns of relative changes in magnitude common to both groups. CPR amplitude increased and FFR amplitude decreased with increasing pitch height. Experience-dependent effects on CPR components vary as a function of neural sensitivity to pitch height within a particular temporal window (Na–Pb). Differences between the auditory brainstem and cortex imply distinct neural mechanisms for pitch extraction at both levels of brain structure. PMID:28108254

  1. The Effects of Lexical Pitch Accent on Infant Word Recognition in Japanese

    Directory of Open Access Journals (Sweden)

    Mitsuhiko Ota

    2018-01-01

    Full Text Available Learners of lexical tone languages (e.g., Mandarin develop sensitivity to tonal contrasts and recognize pitch-matched, but not pitch-mismatched, familiar words by 11 months. Learners of non-tone languages (e.g., English also show a tendency to treat pitch patterns as lexically contrastive up to about 18 months. In this study, we examined if this early-developing capacity to lexically encode pitch variations enables infants to acquire a pitch accent system, in which pitch-based lexical contrasts are obscured by the interaction of lexical and non-lexical (i.e., intonational features. Eighteen 17-month-olds learning Tokyo Japanese were tested on their recognition of familiar words with the expected pitch or the lexically opposite pitch pattern. In early trials, infants were faster in shifting their eyegaze from the distractor object to the target object than in shifting from the target to distractor in the pitch-matched condition. In later trials, however, infants showed faster distractor-to-target than target-to-distractor shifts in both the pitch-matched and pitch-mismatched conditions. We interpret these results to mean that, in a pitch-accent system, the ability to use pitch variations to recognize words is still in a nascent state at 17 months.

  2. Long-term pitch memory for music recordings is related to auditory working memory precision.

    Science.gov (United States)

    Van Hedger, Stephen C; Heald, Shannon Lm; Nusbaum, Howard C

    2018-04-01

    Most individuals have reliable long-term memories for the pitch of familiar music recordings. This pitch memory (1) appears to be normally distributed in the population, (2) does not depend on explicit musical training and (3) only seems to be weakly related to differences in listening frequency estimates. The present experiment was designed to assess whether individual differences in auditory working memory could explain variance in long-term pitch memory for music recordings. In Experiment 1, participants first completed a musical note adjustment task that has been previously used to assess working memory of musical pitch. Afterward, participants were asked to judge the pitch of well-known music recordings, which either had or had not been shifted in pitch. We found that performance on the pitch working memory task was significantly related to performance in the pitch memory task using well-known recordings, even when controlling for overall musical experience and familiarity with each recording. In Experiment 2, we replicated these findings in a separate group of participants while additionally controlling for fluid intelligence and non-pitch-based components of auditory working memory. In Experiment 3, we demonstrated that participants could not accurately judge the pitch of unfamiliar recordings, suggesting that our method of pitch shifting did not result in unwanted acoustic cues that could have aided participants in Experiments 1 and 2. These results, taken together, suggest that the ability to maintain pitch information in working memory might lead to more accurate long-term pitch memory.

  3. Interaural bimodal pitch matching with two-formant vowels

    DEFF Research Database (Denmark)

    Guérit, François; Chalupper, Josef; Santurette, Sébastien

    2013-01-01

    For bimodal patients, with a hearing aid (HA) in one ear and a cochlear implant (CI) in the opposite ear, usually a default frequency-to-electrode map is used in the CI. This assumes that the human brain can adapt to interaural place-pitch mismatches. This “one-size-fits-all” method might be part...

  4. Children's Identification of Questions from Rising Terminal Pitch

    Science.gov (United States)

    Saindon, Mathieu R.; Trehub, Sandra E.; Schellenberg, E. Glenn; van Lieshout, Pascal

    2016-01-01

    Young children are slow to master conventional intonation patterns in their "yes/no" questions, which may stem from imperfect understanding of the links between terminal pitch contours and pragmatic intentions. In Experiment 1, five to ten-year-old children and adults were required to judge utterances as questions or statements on the…

  5. Distraction by novel and pitch-deviant sounds in children

    Directory of Open Access Journals (Sweden)

    Nicole Wetzel

    2016-12-01

    Full Text Available The control of attention is an important part of our executive functions and enables us to focus on relevant information and to ignore irrelevant information. The ability to shield against distraction by task-irrelevant sounds is suggested to mature during school age. The present study investigated the developmental time course of distraction in three groups of children aged 7 – 10 years. Two different types of distractor sounds that have been frequently used in auditory attention research – novel environmental and pitch-deviant sounds – were presented within an oddball paradigm while children performed a visual categorization task. Reaction time measurements revealed decreasing distractor-related impairment with age. Novel environmental sounds impaired performance in the categorization task more than pitch-deviant sounds. The youngest children showed a pronounced decline of novel-related distraction effects throughout the experimental session. Such a significant decline as a result of practice was not observed in the pitch-deviant condition and not in older children. We observed no correlation between cross-modal distraction effects and performance in standardized tests of concentration and visual distraction. Results of the cross-modal distraction paradigm indicate that separate mechanisms underlying the processing of novel environmental and pitch-deviant sounds develop with different time courses and that these mechanisms develop considerably within a few years in middle childhood.

  6. Periodic Burning In Table Mountain-Pitch Pine Stands

    Science.gov (United States)

    Russell B. Randles; David H. van Lear; Thomas A. Waldrop; Dean M. Simon

    2002-01-01

    Abstract - The effects of multiple, low intensity burns on vegetation and wildlife habitat in Table Mountain (Pinus pungens Lamb.)-pitch (Pinus rigida Mill.) pine communities were studied in the Blue Ridge Mountains of North Carolina. Treatments consisted of areas burned from one to four times at 3-4 year...

  7. Wear and Friction in a Controllable Pitch Propeller

    NARCIS (Netherlands)

    Godjevac, M.

    2010-01-01

    The author is a naval architect and this book is his PhD thesis. In this research the author focuses on friction in a controllable pitch propeller (CPP), formation of wear in a CPP system, and their mutual dependence. Instead of going deeply only in tribology aspects, the author tries to get an

  8. Pitch organisation in Hendrik Hofmeyr's Alleenstryd | May | South ...

    African Journals Online (AJOL)

    Hendrik Hofmeyr's Alleenstryd is of seminal importance in the evolution of the composer's musical language. Emerging ideas of types of pitch organisation in earlier works are here for the first time organised into a fully integrated system and the principles applied here later became some of the most important hallmarks of ...

  9. Shoulder muscle firing patterns during the windmill softball pitch.

    Science.gov (United States)

    Maffet, M W; Jobe, F W; Pink, M M; Brault, J; Mathiyakom, W

    1997-01-01

    The purpose of this study was to describe the activity of eight shoulder muscles during the windmill fast-pitch softball throw. Ten collegiate female pitchers were analyzed with intramuscular electromyography, high-speed cinematography, and motion analysis. The supraspinatus muscle fired maximally during arm elevation from the 6 to 3 o'clock position phase, centralizing the humeral head within the glenoid. The posterior deltoid and teres minor muscles acted maximally from the 3 to 12 o'clock position phase to continue arm elevation and externally rotate the humerus. The pectoralis major muscle accelerated the arm from the 12 o'clock position to ball release phase. The serratus anterior muscle characteristically acted to position the scapula for optimal glenohumeral congruency, and the subscapularis muscle functioned as an internal rotator and to protect the anterior capsule. Although the windmill softball pitch is overtly different from the baseball pitch, several surprising similarities were revealed. The serratus anterior and pectoralis major muscles work in synchrony and seem to have similar functions in both pitches. Although the infraspinatus and teres minor muscles are both posterior cuff muscles, they are characteristically uncoupled during the 6 to 3 o'clock position phase, with the infraspinatus muscle acting more independently below 90 degrees. Subscapularis muscle activity seems important in dynamic anterior glenohumeral stabilization and as an internal rotator in both the baseball and softball throws.

  10. Pitch perception in children with autistic spectrum disorders

    NARCIS (Netherlands)

    Altgassen, A.M.; Kliegel, M.; Williams, T.I.

    2005-01-01

    This study investigated the accuracy of musical pitch detection in children with autistic spectrum disorders as compared with typically developing children. Seventeen children on the autistic spectrum (Mage=9.34, SDage=1.12) and 13 typically developing, chronological age-matched children (Mage=9.13,

  11. Singing Video Games May Help Improve Pitch-Matching Accuracy

    Science.gov (United States)

    Paney, Andrew S.

    2015-01-01

    The purpose of this study was to investigate the effect of singing video games on the pitch-matching skills of undergraduate students. Popular games like "Rock Band" and "Karaoke Revolutions" rate players' singing based on the correctness of the frequency of their sung response. Players are motivated to improve their…

  12. Joint Pitch and DOA Estimation Using the ESPRIT method

    DEFF Research Database (Denmark)

    Wu, Yuntao; Amir, Leshem; Jensen, Jesper Rindom

    2015-01-01

    In this paper, the problem of joint multi-pitch and direction-of-arrival (DOA) estimation for multi-channel harmonic sinusoidal signals is considered. A spatio-temporal matrix signal model for a uniform linear array is defined, and then the ESPRIT method based on subspace techniques that exploits...

  13. Process for tertiary oil recovery using tall oil pitch

    Science.gov (United States)

    Radke, C.J.

    1983-07-25

    A process and compositions for enhancing the recovery of acid crudes are disclosed. The process involves injecting caustic solutions into the reservoir to maintain a pH of 11 to 13. The fluid contains an effective amount of multivalent cation for inhibiting alkaline silica dissolution with the reservoir. A tall oil pitch soap is added as a polymeric mobility control agent. (DMC)

  14. Multilingual evaluation of voice disability index using pitch rate

    Directory of Open Access Journals (Sweden)

    Shuji Shinohara

    2017-06-01

    Full Text Available We propose the use of the pitch rate of free-form speech recorded by smartphones as an index of voice disability. This research compares the effectiveness of pitch rate, jitter, shimmer, and harmonic-to-noise ratio (HNR as indices of voice disability in English, German, and Japanese. Normally, the evaluation of these indices is performed using long-vowel sounds; however, this study included the recitation of a set passage, which is more similar to free-form speech. The results showed that for English, the jitter, shimmer, and HNR were very effective indices for long-vowel sounds, but the shimmer and HNR for read speech were considerably worse. Although the effectiveness of jitter as an index was maintained for read speech, the pitch rate was better in distinguishing between healthy individuals and patients with illnesses affecting their voice. The read speech results in German, Japanese, and English were similar, and the pitch rate showed the greatest efficiency for identification. Nevertheless, compared to English, the identification efficiency for the other two languages was lower.

  15. The thermal transformations of pitch and its compositions with thermoanthracite

    Energy Technology Data Exchange (ETDEWEB)

    Belkina, T.V.; Krysin, V.P.; Ulanovskii, M.L.

    1983-01-01

    The loss of mass in the thermal transformations of a hard-coal pitch and its compositions with thermoanthracite in the temperature interval of 200-1000/sup 0/C takes place in two main stages: with a variable rate in the 200-600/sup 0/C interval and at a constant rate in the 600-1000/sup 0/C interval. The rate of the mass loss process in the 200-600/sup 0/C interval is determined mainly by the rate of diffusion of the volatile components and also of the light products of the thermal transformations of the pitch from the bulk to the phase separation boundary, and in the 600-1000/sup 0/C interval predominantly by the rate of the actual elementary chemical reaction. In the presence of thermoanthracite, the nature of the thermal transformations of the pitch does not change appreciably, while in the presence of silica synthetic reactions are intensified, which leads to an increase in the yield of solid residue by approximately 4 mass %. (A rise in the rate of heating of pitch-thermoanthracite compositions leads to the incomplete elimination of volatile products in the first stage, which has a favorable action on the increase in the yield of solid residue.)

  16. Diseases of pines caused by the pitch canker fungus

    Science.gov (United States)

    L. David Dwinell; Stephen W. Fraedrich; D. Adams

    2001-01-01

    Fusarium subglutinans f. sp. pini, the pitch canker fungus, causes a number of serious diseases of Pinus species. The pathogen infects a variety of vegetative and reproductive pine structures at different stages of maturity and produces a diversity of symptoms. When the pathogen infects the woody vegetative...

  17. Pitch, Tempo, and Timbral Preferences in Recorded Piano Music.

    Science.gov (United States)

    Wapnick, Joel

    1980-01-01

    Subjects (96 undergraduate music students) were given freedom to alter pitch levels, tempos, and timbral qualities of tape recordings of 12 familiar and unfamiliar piano solos. Subject responses were analyzed for accuracy, as well as for preference directions. (Author/SJL)

  18. Pitch and Loudness Tinnitus in Individuals with Presbycusis.

    Science.gov (United States)

    Seimetz, Bruna Macangnin; Teixeira, Adriane Ribeiro; Rosito, Leticia Petersen Schmidt; Flores, Leticia Sousa; Pappen, Carlos Henrique; Dall'igna, Celso

    2016-10-01

    Introduction  Tinnitus is a symptom that is often associated with presbycusis. Objective  This study aims to analyze the existence of association among hearing thresholds, pitch, and loudness of tinnitus in individuals with presbycusis, considering the gender variable. Methods  Cross-sectional, descriptive, and prospective study, whose sample consisted of individuals with tinnitus and diagnosis of presbycusis. For the evaluation, we performed anamnesis along with otoscopy, pure tone audiometry, and acuphenometry to analyze the psychoacoustic characteristics of tinnitus individuals. Results  The sample consisted of 49 subjects, with a mean age of 69.57 ± 6.53 years, who presented unilateral and bilateral tinnitus, therefore, a sample of 80 ears. In analyzing the results, as for acuphenometry, the loudness of tinnitus was more present at 0dB and the pitch was 6HKz and 8HKz. Regarding the analysis of the association between the frequency of greater hearing threshold and tinnitus pitch, no statistical significance ( p  = 0.862) was found. As for the association between the intensity of greater hearing threshold and tinnitus loudness, no statistical significance ( p  = 0.115) was found. Conclusion  There is no significant association between the hearing loss of patients with presbycusis and the pitch and loudness of tinnitus.

  19. Pitch and Loudness Tinnitus in Individuals with Presbycusis

    Directory of Open Access Journals (Sweden)

    Seimetz, Bruna Macangnin

    2016-02-01

    Full Text Available Introduction Tinnitus is a symptom that is often associated with presbycusis. Objective This study aims to analyze the existence of association among hearing thresholds, pitch, and loudness of tinnitus in individuals with presbycusis, considering the gender variable. Methods Cross-sectional, descriptive, and prospective study, whose sample consisted of individuals with tinnitus and diagnosis of presbycusis. For the evaluation, we performed anamnesis along with otoscopy, pure tone audiometry, and acuphenometry to analyze the psychoacoustic characteristics of tinnitus individuals. Results The sample consisted of 49 subjects, with a mean age of 69.57 ± 6.53 years, who presented unilateral and bilateral tinnitus, therefore, a sample of 80 ears. In analyzing the results, as for acuphenometry, the loudness of tinnitus was more present at 0dB and the pitch was 6HKz and 8HKz. Regarding the analysis of the association between the frequency of greater hearing threshold and tinnitus pitch, no statistical significance (p = 0.862 was found. As for the association between the intensity of greater hearing threshold and tinnitus loudness, no statistical significance (p = 0.115 was found. Conclusion There is no significant association between the hearing loss of patients with presbycusis and the pitch and loudness of tinnitus.

  20. The Relationship between Pitch and Space in Congenital Amusia

    Science.gov (United States)

    Williamson, Victoria J.; Cocchini, Gianna; Stewart, Lauren

    2011-01-01

    Congenital amusia manifests as a lifelong difficulty in making sense of musical sound. The extent to which this disorder is accompanied by deficits in visuo-spatial processing is an important question, bearing on the issue of whether pitch processing draws on supramodal spatial representations. The present study assessed different aspects of…

  1. LQG Controller Design for Pitch Regulated Variable Speed Wind Turbine

    DEFF Research Database (Denmark)

    Imran, Raja Muhammed; Hussain, Dil Muhammad Akbar; Chen, Zhe

    2014-01-01

    Variable speed wind turbine is a complex and nonlinear system, a sophisticated control is required to meet the challenges posed by these systems. This paper is presenting a pitch regulation strategy based on LQG (Linear Quadratic Gaussian) to regulate turbine at its rated power and to reject...

  2. 14 CFR 35.21 - Variable and reversible pitch propellers.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Variable and reversible pitch propellers. 35.21 Section 35.21 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: PROPELLERS Design and Construction § 35.21 Variable and...

  3. Thrust generation and wake structure for flow across a pitching ...

    Indian Academy of Sciences (India)

    ... not a sufficient condition for the generation of thrust. The vortex strength is found to be invariant of the pitching frequency. Certain differences from the reported results are noted, which may be because of difference in the airfoil shape. These results can help improve understanding of the flow behavior as the low Reynolds ...

  4. Achieving Climate Change Absolute Accuracy in Orbit

    Science.gov (United States)

    Wielicki, Bruce A.; Young, D. F.; Mlynczak, M. G.; Thome, K. J; Leroy, S.; Corliss, J.; Anderson, J. G.; Ao, C. O.; Bantges, R.; Best, F.; hide

    2013-01-01

    The Climate Absolute Radiance and Refractivity Observatory (CLARREO) mission will provide a calibration laboratory in orbit for the purpose of accurately measuring and attributing climate change. CLARREO measurements establish new climate change benchmarks with high absolute radiometric accuracy and high statistical confidence across a wide range of essential climate variables. CLARREO's inherently high absolute accuracy will be verified and traceable on orbit to Système Internationale (SI) units. The benchmarks established by CLARREO will be critical for assessing changes in the Earth system and climate model predictive capabilities for decades into the future as society works to meet the challenge of optimizing strategies for mitigating and adapting to climate change. The CLARREO benchmarks are derived from measurements of the Earth's thermal infrared spectrum (5-50 micron), the spectrum of solar radiation reflected by the Earth and its atmosphere (320-2300 nm), and radio occultation refractivity from which accurate temperature profiles are derived. The mission has the ability to provide new spectral fingerprints of climate change, as well as to provide the first orbiting radiometer with accuracy sufficient to serve as the reference transfer standard for other space sensors, in essence serving as a "NIST [National Institute of Standards and Technology] in orbit." CLARREO will greatly improve the accuracy and relevance of a wide range of space-borne instruments for decadal climate change. Finally, CLARREO has developed new metrics and methods for determining the accuracy requirements of climate observations for a wide range of climate variables and uncertainty sources. These methods should be useful for improving our understanding of observing requirements for most climate change observations.

  5. Absolute Priority for a Vehicle in VANET

    Science.gov (United States)

    Shirani, Rostam; Hendessi, Faramarz; Montazeri, Mohammad Ali; Sheikh Zefreh, Mohammad

    In today's world, traffic jams waste hundreds of hours of our life. This causes many researchers try to resolve the problem with the idea of Intelligent Transportation System. For some applications like a travelling ambulance, it is important to reduce delay even for a second. In this paper, we propose a completely infrastructure-less approach for finding shortest path and controlling traffic light to provide absolute priority for an emergency vehicle. We use the idea of vehicular ad-hoc networking to reduce the imposed travelling time. Then, we simulate our proposed protocol and compare it with a centrally controlled traffic light system.

  6. Absolute method of measuring magnetic susceptibility

    Science.gov (United States)

    Thorpe, A.; Senftle, F.E.

    1959-01-01

    An absolute method of standardization and measurement of the magnetic susceptibility of small samples is presented which can be applied to most techniques based on the Faraday method. The fact that the susceptibility is a function of the area under the curve of sample displacement versus distance of the magnet from the sample, offers a simple method of measuring the susceptibility without recourse to a standard sample. Typical results on a few substances are compared with reported values, and an error of less than 2% can be achieved. ?? 1959 The American Institute of Physics.

  7. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  8. Pitch, roll, and yaw variations in patient positioning

    International Nuclear Information System (INIS)

    Kaiser, Adeel; Schultheiss, Timothy E.; Wong, Jeffrey Y.C.; Smith, David D.; Han, Chunhui; Vora, Nayana L.; Pezner, Richard D.; Chen Yijen; Radany, Eric H.

    2006-01-01

    Purpose: To use pretreatment megavoltage-computed tomography (MVCT) scans to evaluate positioning variations in pitch, roll, and yaw for patients treated with helical tomotherapy. Methods and Materials: Twenty prostate and 15 head-and-neck cancer patients were selected. Pretreatment MVCT scans were performed before every treatment fraction and automatically registered to planning kilovoltage CT (KVCT) scans by bony landmarks. Image registration data were used to adjust patient setups before treatment. Corrections for pitch, roll, and yaw were recorded after bone registration, and data from fractions 1-5 and 16-20 were used to analyze mean rotational corrections. Results: For prostate patients, the means and standard deviations (in degrees) for pitch, roll, and yaw corrections were -0.60 ± 1.42, 0.66 ± 1.22, and -0.33 ± 0.83. In head-and-neck patients, the means and standard deviations (in degrees) were -0.24 ± 1.19, -0.12 ± 1.53, and 0.25 ± 1.42 for pitch, roll, and yaw, respectively. No significant difference in rotational variations was observed between Weeks 1 and 4 of treatment. Head-and-neck patients had significantly smaller pitch variation, but significantly larger yaw variation, than prostate patients. No difference was found in roll corrections between the two groups. Overall, 96.6% of the rotational corrections were less than 4 deg. Conclusions: The initial rotational setup errors for prostate and head-and-neck patients were all small in magnitude, statistically significant, but did not vary considerably during the course of radiotherapy. The data are relevant to couch hardware design for correcting rotational setup variations. There should be no theoretical difference between these data and data collected using cone beam KVCT on conventional linacs

  9. Neural coding and perception of pitch in the normal and impaired human auditory system

    DEFF Research Database (Denmark)

    Santurette, Sébastien

    2011-01-01

    investigated using psychophysical methods. First, hearing loss was found to affect the perception of binaural pitch, a pitch sensation created by the binaural interaction of noise stimuli. Specifically, listeners without binaural pitch sensation showed signs of retrocochlear disorders. Despite adverse effects......Pitch is an important attribute of hearing that allows us to perceive the musical quality of sounds. Besides music perception, pitch contributes to speech communication, auditory grouping, and perceptual segregation of sound sources. In this work, several aspects of pitch perception in humans were...... of reduced frequency selectivity on binaural pitch perception, the ability to accurately process the temporal fine structure (TFS) of sounds at the output of the cochlear filters was found to be essential for perceiving binaural pitch. Monaural TFS processing also played a major and independent role...

  10. Facial Expression and Vocal Pitch Height: Evidence of an Intermodal Association

    Directory of Open Access Journals (Sweden)

    David Huron

    2009-11-01

    Full Text Available Forty-four participants were asked to sing moderate, high, and low pitches while their faces were photographed. In a two-alternative forced choice task, independent judges selected the high-pitch faces as more friendly than the low-pitch faces. When photographs were cropped to show only the eye region, judges still rated the high-pitch faces friendlier than the low-pitch faces. These results are consistent with prior research showing that vocal pitch height is used to signal aggression (low pitch or appeasement (high pitch. An analysis of the facial features shows a strong correlation between eyebrow position and sung pitch—consistent with the role of eyebrows in signaling aggression and appeasement. Overall, the results are consistent with an inter-modal linkage between vocal and facial expressions.

  11. CLEARING MAGNET DESIGN FOR APS-U

    Energy Technology Data Exchange (ETDEWEB)

    Abliz, M.; Grimmer, J.; Jaski, Y.; Westferro, F.; Ramanathan, M.

    2017-06-25

    The Advanced Photon Source is in the process of developing an upgrade (APS-U) of the storage ring. The upgrade will be converting the current double bend achromat (DBA) lattice to a multi-bend achromat (MBA) lattice. In addition, the storage ring will be operated at 6 GeV and 200 mA with regular swap-out injection to keep the stored beam current constant [1]. The swap-out injection will take place with beamline shutters open. For radiation safety to ensure that no electrons can exit the storage ring, a passive method of protecting the beamline and containing the electrons inside the storage ring is proposed. A clearing magnet will be located in all beamline front ends inside the storage ring tunnel. This article will discuss the features and design of the clearing magnet scheme for APS-U.

  12. Final report for tank 241-AP-108, grab samples 8AP-96-1, 8AP-96-2 and 8AP-96-FB

    International Nuclear Information System (INIS)

    Esch, R.A.

    1996-01-01

    This document is the final report deliverable for the tank 241-AP-108 grab samples. The samples were subsampled and analyzed in accordance with the TSAP. Included in this report are the results for the Waste Compatibility analyses, with the exception of DSC and thermogravimetric analysis (TGA) results which were presented in the 45 Day report (Part 2 of this document). The raw data for all analyses, with the exception of DSC and TGA, are also included in this report

  13. Cultural Diversity in AP Art History

    Science.gov (United States)

    Bolte, Frances R.

    2006-01-01

    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  14. Beryllium window for an APS diagnostics beamline

    International Nuclear Information System (INIS)

    Sheng, I.C.; Yang, B.X.; Sharma, Y.S.

    1997-01-01

    A beryllium (Be) window for an Advanced Photon Source (APS) diagnostics beamline has been designed and built. The window, which has a double concave axisymmetrical profile with a thickness of 0.5 mm at the center, receives 160 W/mm 2 (7 GeV/100 mA stored beam) from an undulator beam. The window design as well as thermal and thermomechanical analyses, including thermal buckling of the Be window, are presented

  15. Children born to SLE and APS mothers.

    Science.gov (United States)

    Nalli, C; Iodice, A; Andreoli, L; Lojacono, A; Motta, M; Fazzi, E; Tincani, A

    2014-10-01

    Systemic lupus erythematosus (SLE) and antiphospholipid antibody syndrome (APS) are autoimmune diseases that affect women of childbearing age. Pregnancies in these patients carry several complications such as prematurity. Maternal IgG antiphospholipid antibodies (aPL) can cross the placenta but they don't generally cause any neonatal thrombotic event. Because of the incompleteness of the fetal blood-brain barrier, aPL could theoretically reach the fetal brain. Whether this can have an effect on brain development is still under investigation. Some studies performed in children of patients with SLE and/or APS showed an increased number of learning disabilities without impairment in intelligence level. The objectives of this article are to evaluate the neurodevelopment outcome in 30 children (median age 9 years) born to mothers with SLE and/or APS with IgG anti-beta2-glycoprotein I during the third trimester of pregnancy and found positive for the same antibodies at birth. A neurological physical exam was performed in all children. We submitted some questionnaires to the mothers: the Child Behavior CheckList (CBCL) and a homemade set of questions obtained by a team composed of rheumatologists and pediatric neurologists. Intellectual functioning was determined by the Wechsler scale for corrected age. In all children neurological physical exam and intelligence levels were found to be normal but mild behavior disorders and history of neurological manifestations were shown in three children. Offspring of patients with SLE and/or APS are generally healthy. We and others observed the occurrence of minor neurological disorders that might be related to maternal disease or to prematurity. The limited number of the available data on this sensitive issue supports the need for further studies. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  16. Standardization of the cumulative absolute velocity

    International Nuclear Information System (INIS)

    O'Hara, T.F.; Jacobson, J.P.

    1991-12-01

    EPRI NP-5930, ''A Criterion for Determining Exceedance of the Operating Basis Earthquake,'' was published in July 1988. As defined in that report, the Operating Basis Earthquake (OBE) is exceeded when both a response spectrum parameter and a second damage parameter, referred to as the Cumulative Absolute Velocity (CAV), are exceeded. In the review process of the above report, it was noted that the calculation of CAV could be confounded by time history records of long duration containing low (nondamaging) acceleration. Therefore, it is necessary to standardize the method of calculating CAV to account for record length. This standardized methodology allows consistent comparisons between future CAV calculations and the adjusted CAV threshold value based upon applying the standardized methodology to the data set presented in EPRI NP-5930. The recommended method to standardize the CAV calculation is to window its calculation on a second-by-second basis for a given time history. If the absolute acceleration exceeds 0.025g at any time during each one second interval, the earthquake records used in EPRI NP-5930 have been reanalyzed and the adjusted threshold of damage for CAV was found to be 0.16g-set

  17. Two Studies of Pitch in String Instrument Vibrato: Perception and Pitch Matching Responses of University and High School String Players

    Science.gov (United States)

    Geringer, John M.; MacLeod, Rebecca B.; Ellis, Julia C.

    2014-01-01

    We investigated pitch perception of string vibrato tones among string players in two separate studies. In both studies we used tones of acoustic instruments (violin and cello) as stimuli. In the first, we asked 192 high school and university string players to listen to a series of tonal pairs: one tone of each pair was performed with vibrato and…

  18. Overview of the advanced photon source (APS)

    International Nuclear Information System (INIS)

    White, M.M.

    1994-01-01

    The Advanced Photon Source (APS) is a state-of-the-art synchrotron light source facility dedicated to the production of extremely brilliant x-ray beams for research. Its super-intense x-ray beams will be used in many areas of research including industrial research, biological and medical research, defense-related research, and basic research. The APS x-ray beams will allow scientists to study smaller samples, more complex systems, faster reactions and processes, and gather data at a greater level of detail than has been possible to date. Creation of these beams begins with electron production by an electron gun with a thermionic cathode. The electrons are accelerated to 200 MeV by a linear accelerator (linac) and then impinge on a tungsten target, resulting in electron-positron pair production. The positrons are accelerated to 450 MeV in the remainder of the linac, then accumulated, damped, and transferred to a synchrotron that increases their energy to 7 GeV. The 7-GeV positrons are injected into a storage ring, where they pass through special magnets that cause them to emit x-rays of the desired quality. Construction at ANL is nearly complete at this time, and the APS will begin operating for users in 1996. The accelerator and experimental facilities are described in this paper, and a brief overview of some of the experimental programs is given

  19. APS - Diagnostics and challenges for the future.

    Science.gov (United States)

    Pengo, V; Bison, E; Zoppellaro, G; Padayattil Jose, S; Denas, G; Hoxha, A; Ruffatti, A; Banzato, A

    2016-11-01

    Diagnosis of antiphospholipid syndrome (APS) is essentially based on the detection of circulating antiphospholipid (aPL) antibodies. Progress have been made on the standardization of tests exploring the presence of aPL as guidelines on coagulation and immunological tests were recently published in the literature. Clinical relevance of aPL profile has come from prospective cohort studies in populations with a homogeneous antibody profile supporting the view that triple positivity is a high risk pattern in patients and carriers. In addition to the classic ones, several other tests have been proposed for the diagnosis of APS. The detection of antibodies directed to domain 1 and 4/5 of β2-Glycoprotein I (β2GP1) were found to be particularly sound. Several issues remain to be addressed. We do not yet know what is the physiological function of β2GP1 and the pathophysiology of thrombosis and pregnancy loss in these patients. Moreover, treatment is poorly defined especially in the case of feared catastrophic APS. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. On the periodic variations of geomagnetic activity indices Ap and ap

    Directory of Open Access Journals (Sweden)

    H. Schreiber

    1998-05-01

    Full Text Available Yearly averages of geomagnetic activity indices Ap for the years 1967–1984 are compared to the respective averages of ν2·Bs, where v is the solar wind velocity and Bs is the southward interplanetary magnetic field (IMF component. The correlation of both quantities is known to be rather good. Comparing the averages of Ap with ν2 and Bs separately we find that, during the declining phase of the solar cycle, ν2 and during the ascending phase Bs have more influence on Ap. According to this observation (using Fourier spectral analysis the semiannual and 27 days, Ap variations for the years 1932–1993 were analysed separately for years before and after sunspot minima. Only those time-intervals before sunspot minima with a significant 27-day recurrent period of the IMF sector structure and those intervals after sunspot minima with a significant 28-28.5-day recurrent period of the sector structure were used. The averaged spectra of the two Ap data sets clearly show a period of 27 days before and a period of 28–29 days after sunspot minimum. Moreover, the phase of the average semiannual wave of Ap is significantly different for the two groups of data: the Ap variation maximizes near the equinoxes during the declining phase of the sunspot cycle and near the beginning of April and October during the ascending phase of the sunspot cycle, as predicted by the Russell-McPherron (R-M mechanism. Analysing the daily variation of ap in an analogue manner, the same equinoctial and R-M mechanisms are seen, suggesting that during phases of the solar cycle, when ap depends more on the IMF-Bs component, the R-M mechanism is predominant, whereas during phases when ap increases as v increases the equinoctial mechanism is more likely to be effective.Key words. Interplanetary physics · Magnetic fields · Solar wind plasma · Solar wind · magnetosphere interaction

  1. Forecasting Error Calculation with Mean Absolute Deviation and Mean Absolute Percentage Error

    Science.gov (United States)

    Khair, Ummul; Fahmi, Hasanul; Hakim, Sarudin Al; Rahim, Robbi

    2017-12-01

    Prediction using a forecasting method is one of the most important things for an organization, the selection of appropriate forecasting methods is also important but the percentage error of a method is more important in order for decision makers to adopt the right culture, the use of the Mean Absolute Deviation and Mean Absolute Percentage Error to calculate the percentage of mistakes in the least square method resulted in a percentage of 9.77% and it was decided that the least square method be worked for time series and trend data.

  2. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (II): thrombocytopenia and skin manifestations.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyze the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations, and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analyzed on thrombocytopenia and skin manifestations, and presents the recommendations elaborated by the Task Force after this analysis.

  3. Effects of a Simulated Game on Upper Extremity Pitching Mechanics and Muscle Activations Among Various Pitch Types in Youth Baseball Pitchers.

    Science.gov (United States)

    Oliver, Gretchen D; Plummer, Hillary; Henning, Lisa; Saper, Michael; Glimer, Gabrielle; Brambeck, Allison; Andrews, James R

    2017-03-21

    Throwing requires proper stability and orientation of the pelvis and scapula for efficient energy transfer during pitching. Fatigue of the pelvis and scapular musculature throughout the course of a game can impair pitching performance, and place excessive demands on the throwing arm leading to injury. The purpose of this study was to examine differences in pelvis, torso, and upper extremity pitching mechanics and muscle activations between the fastball, change-up, and curveball pitches in youth baseball pitchers following a simulated game. Fourteen youth baseball pitchers with no history of injury participated. Pitching mechanics were collected using an electromagnetic tracking system. Surface electromyography data were collected on the bilateral gluteus medius and maximus; and throwing arm side latissimus dorsi, lower trapezius, upper trapezius, and serratus anterior. Participants were instructed to throw maximum effort pitches during a simulated game that provided random game situations similar to those that occur in competition. Participants were limited to 85 pitches based on age-restricted pitch counts. Data from 3 fastballs, curveballs, and change-ups thrown in the first and last innings were selected for analysis. Repeated measures multivariate analyses of variance revealed that neither pitch type nor the effect of a simulated game resulted in statistically significant changes in pitching mechanics (F(10,600)=0.55, P=0.85), or muscle activations (pelvic: F(4,195)=0.07, P=0.85; scapular: F(4,118)=0.09, P=0.52). The principle findings of this study revealed that pitching to the age-restricted pitch count limit did not result in altered pitching mechanics or muscle activations, and no differences occurred between the 3 pitches. These results support previous research that indicate the curveball pitch is no more dangerous for youth than the other pitches commonly thrown. This is supported by the pitcher's ability to maintain a proper arm slot during all 3

  4. Local and global pitch perception in L1 and L2 readers of Dutch

    NARCIS (Netherlands)

    de Jong, Chiara; Postma, Marie; Mos, Maria; Vedder, Kayleigh; Hendriks, Danielle; Maggiore, G.

    2017-01-01

    Prior research showed a relationship between reading skills and pitch perception, however the exact nature remained unclear. By means of reading tests and a pitch perception test, we examined the relation between reading abilities and local and global pitch perception for 92 native Dutch children

  5. Pitch and Time Processing in Speech and Tones: The Effects of Musical Training and Attention

    Science.gov (United States)

    Sares, Anastasia G.; Foster, Nicholas E. V.; Allen, Kachina; Hyde, Krista L.

    2018-01-01

    Purpose: Musical training is often linked to enhanced auditory discrimination, but the relative roles of pitch and time in music and speech are unclear. Moreover, it is unclear whether pitch and time processing are correlated across individuals and how they may be affected by attention. This study aimed to examine pitch and time processing in…

  6. Major League pitching workload after primary ulnar collateral ligament reconstruction and risk for revision surgery.

    Science.gov (United States)

    Keller, Robert A; Mehran, Nima; Marshall, Nathan E; Okoroha, Kelechi R; Khalil, Lafi; Tibone, James E; Moutzouros, Vasilios

    2017-02-01

    Literature has attempted to correlate pitching workload with risk of ulnar collateral ligament (UCL) injury; however, limited data are available in evaluating workload and its relationship with the need for revision reconstruction in Major League Baseball (MLB) pitchers. We identified 29 MLB pitchers who underwent primary UCL reconstruction surgery and subsequently required revision reconstruction and compared them with 121 MLB pitchers who underwent primary reconstruction but did not later require revision surgery. Games pitched, pitch counts, and innings pitched were evaluated and compared for the seasons after returning from primary reconstruction and for the last season pitched before undergoing revision surgery. The difference in workload between pitchers who did and did not require revision reconstruction was not statistically significant in games pitched, innings pitched, and MLB-only pitch counts. The one significant difference in workload was in total pitch counts (combined MLB and minor league), with the pitchers who required revision surgery pitching less than those who did not (primary: 1413.6 pitches vs. revision: 959.0 pitches, P = .04). In addition, pitchers who required revision surgery underwent primary reconstruction at an early age (22.9 years vs. 27.3 years, P risk for injury after primary UCL reconstruction. However, correlations of risk may be younger age and less MLB experience at the time of the primary reconstruction. Copyright © 2017. Published by Elsevier Inc.

  7. Congenital Amusia in linguistic and non-linguistic pitch perception - What behavior and reaction times reveal

    NARCIS (Netherlands)

    Pfeifer, J.; Hamann, S.; Exter, M.; Campbell, N.; Gibbon, D.; Hirst, D.

    2014-01-01

    Congenital Amusia is a developmental disorder that has a negative influence on pitch perception. While it used to be described as a disorder of musical pitch perception, recent studies indicate that congenital amusics also show deficits in linguistic pitch perception. This study investigates the

  8. Pitch Discrimination and Melodic Memory in Children with Autism Spectrum Disorders

    Science.gov (United States)

    Stanutz, Sandy; Wapnick, Joel; Burack, Jacob A.

    2014-01-01

    Background: Pitch perception is enhanced among persons with autism. We extended this finding to memory for pitch and melody among school-aged children. Objective: The purpose of this study was to investigate pitch memory in musically untrained children with autism spectrum disorders, aged 7-13 years, and to compare it to that of age- and…

  9. Small Molecule Inhibitors Targeting Activator Protein 1 (AP-1)

    Science.gov (United States)

    2015-01-01

    Activator protein 1 (AP-1) is a pivotal transcription factor that regulates a wide range of cellular processes including proliferation, apoptosis, differentiation, survival, cell migration, and transformation. Accumulating evidence supports that AP-1 plays an important role in several severe disorders including cancer, fibrosis, and organ injury, as well as inflammatory disorders such as asthma, psoriasis, and rheumatoid arthritis. AP-1 has emerged as an actively pursued drug discovery target over the past decade. Excitingly, a selective AP-1 inhibitor T-5224 (51) has been investigated in phase II human clinical trials. Nevertheless, no effective AP-1 inhibitors have yet been approved for clinical use. Despite significant advances achieved in understanding AP-1 biology and function, as well as the identification of small molecules modulating AP-1 associated signaling pathways, medicinal chemistry efforts remain an urgent need to yield selective and efficacious AP-1 inhibitors as a viable therapeutic strategy for human diseases. PMID:24831826

  10. Absolute and Relative Time-Consistent Revealed Preferences

    OpenAIRE

    T. DEMUYNCK

    2007-01-01

    We introduce an Absolute (Relative) Time-consistent Axiom of Revealed Preference which characterizes the consistency of a choice function with the property of absolute (relative) time-consistency and impatience. The axiom requires that the absolute (relative) time-consistent and impatient closure of the revealed preference relation does not conflict with the strict revealed preference relation.

  11. A novel homozygous AP4B1 mutation in two brothers with AP-4 deficiency syndrome and ocular anomalies.

    Science.gov (United States)

    Accogli, Andrea; Hamdan, Fadi F; Poulin, Chantal; Nassif, Christina; Rouleau, Guy A; Michaud, Jacques L; Srour, Myriam

    2018-04-01

    Adaptor protein complex-4 (AP-4) is a heterotetrameric protein complex which plays a key role in vesicle trafficking in neurons. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been recently associated with an autosomal recessive phenotype, consisting of spastic tetraplegia, and intellectual disability (ID). The overlapping clinical picture among individuals carrying mutations in any of these genes has prompted the terms "AP-4 deficiency syndrome" for this clinically recognizable phenotype. Using whole-exome sequencing, we identified a novel homozygous mutation (c.991C>T, p.Q331*, NM_006594.4) in AP4B1 in two siblings from a consanguineous Pakistani couple, who presented with severe ID, progressive spastic tetraplegia, epilepsy, and microcephaly. Sanger sequencing confirmed the mutation was homozygous in the siblings and heterozygous in the parents. Similar to previously reported individuals with AP4B1 mutations, brain MRI revealed ventriculomegaly and white matter loss. Interestingly, in addition to the typical facial gestalt reported in other AP-4 deficiency cases, the older brother presented with congenital left Horner syndrome, bilateral optic nerve atrophy and cataract, which have not been previously reported in this condition. In summary, we report a novel AP4B1 homozygous mutation in two siblings and review the phenotype of AP-4 deficiency, speculating on a possible role of AP-4 complex in eye development. © 2018 Wiley Periodicals, Inc.

  12. Chromatic Modulator for a High-Resolution CCD or APS

    Science.gov (United States)

    Hartley, Frank; Hull, Anthony

    2008-01-01

    A chromatic modulator has been proposed to enable the separate detection of the red, green, and blue (RGB) color components of the same scene by a single charge-coupled device (CCD), active-pixel sensor (APS), or similar electronic image detector. Traditionally, the RGB color-separation problem in an electronic camera has been solved by use of either (1) fixed color filters over three separate image detectors; (2) a filter wheel that repeatedly imposes a red, then a green, then a blue filter over a single image detector; or (3) different fixed color filters over adjacent pixels. The use of separate image detectors necessitates precise registration of the detectors and the use of complicated optics; filter wheels are expensive and add considerably to the bulk of the camera; and fixed pixelated color filters reduce spatial resolution and introduce color-aliasing effects. The proposed chromatic modulator would not exhibit any of these shortcomings. The proposed chromatic modulator would be an electromechanical device fabricated by micromachining. It would include a filter having a spatially periodic pattern of RGB strips at a pitch equal to that of the pixels of the image detector. The filter would be placed in front of the image detector, supported at its periphery by a spring suspension and electrostatic comb drive. The spring suspension would bias the filter toward a middle position in which each filter strip would be registered with a row of pixels of the image detector. Hard stops would limit the excursion of the spring suspension to precisely one pixel row above and one pixel row below the middle position. In operation, the electrostatic comb drive would be actuated to repeatedly snap the filter to the upper extreme, middle, and lower extreme positions. This action would repeatedly place a succession of the differently colored filter strips in front of each pixel of the image detector. To simplify the processing, it would be desirable to encode information on

  13. Absolute ion hydration enthalpies from absolute hardness and some VBT relationships

    Science.gov (United States)

    Kaya, Savaş; Fernandes de Farias, Robson

    2018-01-01

    In the present work, absolute hydration enthalpies are calculated from ion absolute hardness for a series of +1 and -1 ions. The calculated values are compared with those previously reported (Housecroft, 2017) [2] and relationships between Vm-1/3 and absolute hardness are stablished. The following empirical equations have been derived, for cations and anions, respectively: ΔhydHo = -(9.645 η+ + 245.930) and ΔhydHo = -(64.601 η- + 12.321). In such equations, η+ and η- are the absolute hardness. It is shown that for d block monocations (Cu+, Ag+ and Au+), hydration enthalpy is closely related with Clementi effective nuclear charge by the equation: ΔhydHo = -(9.645 η+ + 245.930) (Zeff/(n - 1)), where n is the main quantum number. Furthermore, is shown that a typical VBT parameter (Vm-1/3) is related with η+ and η- values and so, with the energies of the frontier orbitals, that is, is stablished a direct relationship between a structural parameter available by X-ray data and the energy of atomic/molecular orbitals.

  14. Absolute beam current monitoring in endstation c

    International Nuclear Information System (INIS)

    Bochna, C.

    1995-01-01

    The first few experiments at CEBAF require approximately 1% absolute measurements of beam currents expected to range from 10-25μA. This represents errors of 100-250 nA. The initial complement of beam current monitors are of the non intercepting type. CEBAF accelerator division has provided a stripline monitor and a cavity monitor, and the authors have installed an Unser monitor (parametric current transformer or PCT). After calibrating the Unser monitor with a precision current reference, the authors plan to transfer this calibration using CW beam to the stripline monitors and cavity monitors. It is important that this be done fairly rapidly because while the gain of the Unser monitor is quite stable, the offset may drift on the order of .5μA per hour. A summary of what the authors have learned about the linearity, zero drift, and gain drift of each type of current monitor will be presented

  15. How is an absolute democracy possible?

    Directory of Open Access Journals (Sweden)

    Joanna Bednarek

    2011-01-01

    Full Text Available In the last part of the Empire trilogy, Commonwealth, Negri and Hardt ask about the possibility of the self-governance of the multitude. When answering, they argue that absolute democracy, understood as the political articulation of the multitude that does not entail its unification (construction of the people is possible. As Negri states, this way of thinking about political articulation is rooted in the tradition of democratic materialism and constitutes the alternative to the dominant current of modern political philosophy that identifies political power with sovereignty. The multitude organizes itself politically by means of the constitutive power, identical with the ontological creativity or productivity of the multitude. To state the problem of political organization means to state the problem of class composition: political democracy is at the same time economic democracy.

  16. Absolute negative mobility in the anomalous diffusion

    Science.gov (United States)

    Chen, Ruyin; Chen, Chongyang; Nie, Linru

    2017-12-01

    Transport of an inertial Brownian particle driven by the multiplicative Lévy noise was investigated here. Numerical results indicate that: (i) The Lévy noise is able to induce absolute negative mobility (ANM) in the system, while disappearing in the deterministic case; (ii) the ANM can occur in the region of superdiffusion while disappearing in the region of normal diffusion, and the appropriate stable index of the Lévy noise makes the particle move along the opposite direction of the bias force to the maximum degree; (iii) symmetry breaking of the Lévy noise also causes the ANM effect. In addition, the intrinsic physical mechanism and conditions for the ANM to occur are discussed in detail. Our results have the implication that the Lévy noise plays an important role in the occurrence of the ANM phenomenon.

  17. MLU and IPSyn measuring absolute complexity

    Directory of Open Access Journals (Sweden)

    Lea Nieminen

    2009-05-01

    Full Text Available This article compares the results of Mean Length of Utterance (MLU and Index of Productive Syntax (IPSyn with the structural complexity of spontaneous utterances produced by 30-month-old Finnish children in a semi-structured playing situation. The comparison was carried out in order to determine the aspects of structural complexity which can be detected with MLU and IPSyn. This research adopts the frameworks of absolute complexity together with a multidimensional view of utterance structure and, furthermore, applies it through Utterance Analysis (UA. The results of the comparison between the metrics and changes in structural complexity discovered by UA reveal that MLU and IPSyn do function as measures of structural complexity but only if used in close relation to each other. Because they focus on different aspects of utterances, the results of both metrics should be interpreted in relation to one another.DOI: http://dx.doi.org/10.5128/ERYa5.11

  18. Determination of prompt neutron decay constant of the AP-600 reactor core

    International Nuclear Information System (INIS)

    Surbakti, T.

    1998-01-01

    Determination of prompt neutron decay constant of the AP-600 reactor core has been performed using combination of two codes WIMS/D4 and Batan-2DIFF. The calculation was done at beginning of cycle and all of control rods pulled out. Cell generation from various kinds of core materials was done with 4 neutron energy group in 1-D transport code (WIMS/D4). The cell is considered for 1/4 fuel assembly in cluster model with square pitch arrange and then, the dimension of its unit cell is calculated. The unit cell consist of a fuel and moderator unit. The unit cell dimension as input data of WIMS/D4 code, called it annulus, is obtained from the equivalent unit cell. Macroscopic cross sections as output was used as input on neutron diffusion code Batan-2DIFF for core calculation as appropriate with three enrichment regions of the fuel of AP-600 core, namely 2, 2.5, and 3%. From result of diffusion code ( Batan-2DIFF) is obtained the value of delayed neutron fraction of 6.932E-03 and average prompt neutron life-time of 26.38 μs, so that the value of prompt neutron decay constant is 262.8 s-1. If it is compared the calculation result with the design value, the deviation are, for the design value of delayed neutron fraction is 7.5E-03, about 8% and the design value of average prompt neutron life time is 19.6 μs, about 34% respectively. The deviation because there are still unknown several core components of AP-600, so it didn't include in calculation yet

  19. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS)

    DEFF Research Database (Denmark)

    Bøe Wolff, A S; Oftedal, B; Johansson, S

    2008-01-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms...

  20. Teaching Materials and Strategies for the AP Music Theory Exam

    Science.gov (United States)

    Lively, Michael T.

    2017-01-01

    Each year, many students take the Advanced Placement (AP) Music Theory Exam, and the majority of these students enroll in specialized AP music theory classes as part of the preparation process. For the teachers of these AP music theory classes, a number of challenges are presented by the difficulty and complexity of the exam subject material as…

  1. WHY DOES LEIBNIZ NEED ABSOLUTE TIME?

    Directory of Open Access Journals (Sweden)

    NICOLÁS VAUGHAN C.

    2007-08-01

    Full Text Available Resumen: En este ensayo pongo en contraposición dos doctrinas conspicuamenteleibnicianas: la doctrina del tiempo relacional e ideal, y la doctrina de la armonía preestablecida. Argumentaré que si todas las substancias están necesariamentecoordinadas, entonces no tiene sentido negar el carácter absoluto y real del tiempo. En la primera sección describiré la concepción newtoniana y clarkeana del tiempo absoluto; en la segunda discutiré la crítica leibniciana a dicha concepción, crítica sobre la que se erige su doctrina relacional e ideal del tiempo; en la tercera sección daré un vistazo a la metafísica monádica madura de Leibniz, haciendo especial énfasis en la doctrina de la armonía preestablecida; finalmente, en la última sección sugeriré la existencia de una tensión irreconciliable entre estas dos doctrinas.Abstract: In this paper I bring together two characteristically Leibnizean doctrines:the doctrine of relational and ideal time, and the doctrine of preestablished harmony. I will argue that, if every substance is necessarily connected with another, then it makes no sense to deny absolute and real time. In the first section, I will describe Newton’s and Clarke’s conception of absolute time; then, in the second section, I will consider Leibniz’s critique of that conception, on which he bases his ideal and relational doctrine of time. In the third section I will look briefly at Leibniz’s mature monadic metaphysics, taking special account of his doctrine of preestablished harmony. In the last section, I will suggest that there is an irreconcilable tension between these two doctrines.

  2. The Significance of the Right Dorsolateral Prefrontal Cortex for Pitch Memory in Non-musicians Depends on Baseline Pitch Memory Abilities.

    Science.gov (United States)

    Schaal, Nora K; Kretschmer, Marina; Keitel, Ariane; Krause, Vanessa; Pfeifer, Jasmin; Pollok, Bettina

    2017-01-01

    Pitch memory is a resource which is shared by music and language. Neuroimaging studies have shown that the right dorsolateral prefrontal cortex (DLPFC) is activated during pitch memory processes. The present study investigated the causal significance of this brain area for pitch memory in non-musicians by applying cathodal and sham transcranial direct current stimulation (tDCS) over the right DLPFC and examining the impact on offline pitch and visual memory span performances. On the overall sample ( N = 22) no significant modulation effect of cathodal stimulation on the pitch span task was found. However, when dividing the sample by means of a median split of pre-test pitch memory abilities into a high and low performing group, a selective effect of significantly impaired pitch memory after cathodal tDCS in good performers was revealed. The visual control task was not affected by the stimulation in either group. The results support previous neuroimaging studies that the right DLPFC is involved in pitch memory processes in non-musicians and highlights the importance of baseline pitch memory abilities for the modulatory effect of tDCS.

  3. The Significance of the Right Dorsolateral Prefrontal Cortex for Pitch Memory in Non-musicians Depends on Baseline Pitch Memory Abilities

    Directory of Open Access Journals (Sweden)

    Nora K. Schaal

    2017-12-01

    Full Text Available Pitch memory is a resource which is shared by music and language. Neuroimaging studies have shown that the right dorsolateral prefrontal cortex (DLPFC is activated during pitch memory processes. The present study investigated the causal significance of this brain area for pitch memory in non-musicians by applying cathodal and sham transcranial direct current stimulation (tDCS over the right DLPFC and examining the impact on offline pitch and visual memory span performances. On the overall sample (N = 22 no significant modulation effect of cathodal stimulation on the pitch span task was found. However, when dividing the sample by means of a median split of pre-test pitch memory abilities into a high and low performing group, a selective effect of significantly impaired pitch memory after cathodal tDCS in good performers was revealed. The visual control task was not affected by the stimulation in either group. The results support previous neuroimaging studies that the right DLPFC is involved in pitch memory processes in non-musicians and highlights the importance of baseline pitch memory abilities for the modulatory effect of tDCS.

  4. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  5. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  6. Effects of musical training and hearing loss on pitch discrimination

    DEFF Research Database (Denmark)

    Santurette, Sébastien; Bianchi, Federica; Dau, Torsten

    2018-01-01

    Our ability to perceive the pitch of complex sounds is essential for melody perception and for our enjoyment of music. It also plays an important role in speech perception to convey intonation and sometimes meaning, e.g., in tonal languages, and greatly helps segregation of competing sound sources...... content of the sound and whether the harmonics are resolved by the auditory frequency analysis operated by cochlear processing. F0DLs are also heavily influenced by the amount of musical training received by the listener and by the spectrotemporal auditory processing deficits that often accompany...... sensorineural hearing loss. This paper reviews the latest evidence for how musical training and hearing loss affect pitch discrimination performance, based on behavioral F0DL experiments with complex tones containing either resolved or unresolved harmonics, carried out in listeners with different degrees...

  7. Neurological and developmental approaches to poor pitch perception and production.

    Science.gov (United States)

    Loui, Psyche; Demorest, Steven M; Pfordresher, Peter Q; Iyer, Janani

    2015-03-01

    Whereas much of research in music and neuroscience is aimed at understanding the mechanisms by which the human brain facilitates music, emerging interest in the neuromusic community aims to translate basic music research into clinical and educational applications. In the present paper, we explore the problems of poor pitch perception and production from both neurological and developmental/educational perspectives. We begin by reviewing previous and novel findings on the neural regulation of pitch perception and production. We then discuss issues in measuring singing accuracy consistently between the laboratory and educational settings. We review the Seattle Singing Accuracy Protocol--a new assessment tool that we hope can be adopted by cognitive psychologists as well as music educators-and we conclude with some suggestions that the present interdisciplinary approach might offer for future research. © 2014 New York Academy of Sciences.

  8. The Norma spiral arm: large-scale pitch angle

    Science.gov (United States)

    Vallée, Jacques P.

    2017-09-01

    In the inner Galaxy, we statistically find the mean pitch angle of the recently mapped Norma arm in two galactic quadrants (observed tangentially at galactic longitudes near l=328° and near l=20°), using the twin-tangent method, and obtain -13.7°± 1.4°. We compared with other measurements in the literature. Also, using the latest published data on pitch angle and the latest published data on the radial starting point of the four arms (R_{Gal} = 2.2 kpc) in each galactic quadrant, a revised velocity plot of the Norma spiral arm is made, along with other spiral arms in the Milky Way, in each Galactic quadrant.

  9. Compliance effects on dynamically pitching wind turbine airfoils

    Science.gov (United States)

    Magstadt, Andrew S.

    The effects of elastic compliance in dynamically pitching wind turbine blades have been investigated. A numerical model guided wind tunnel testing, which used unsteady surface pressure measurements and phase-locked Particle Imaging Velocimetry to gather aerodynamic information. Using a torsionally compliant member, aeroelastic effects on the unsteady aerodynamics were compared against the results from a corresponding rigidly pitching airfoil to isolate the effects of compliance. The novel experimental apparatus and data acquisition techniques developed at the University of Wyoming showed that the presence of compliance can alter flow-field structures and increase dynamic loading. The high sensitivity of this nonlinear system suggests the formation of fluid-structure instabilities in large-scale turbines and demonstrates the potential for aerodynamic control as a means to mitigate adverse loading effects and improve wind turbine efficiency.

  10. Torque- and Speed Control of a Pitch Regulated Wind Turbine

    Energy Technology Data Exchange (ETDEWEB)

    Rasila, Mika

    2003-07-01

    Variable speed operated wind turbines has the potential to reduce fatigue loads, compared to fixed speed wind turbines. With pitch controllable rotor blades limitation of the power at high wind speeds is obtained. The thesis describes different controlling aspects concerning wind turbines and how these together can be used to optimize the system's performance. Torque control is used in order to achieve reduction on the mechanical loads on the drive-train for low wind speeds and limitation of power output for high wind speeds. In the high wind speed interval torque control is effective in order to limit the output power if a sufficiently fast pitch actuator is used. In the middle wind speed interval filter utilization can be used to give a reference signal to the controller in order to reduce speed and torque variations.

  11. Application of fin system to reduce pitch motion

    Directory of Open Access Journals (Sweden)

    B. Rajesh Reguram

    2016-07-01

    Full Text Available Container ships are prone to move at a greater speed compared to other merchant ships. The slenderness of the hull of container vessel is for better speed, but it leads to unfavorable motions. The pitch and roll are related and sometimes the vessel might be forced to parametric roll condition which is very dangerous. A fin attached to the ship hull proves to be more efficient in controlling the pitch. The fin is fitted at a lowest possible location of the hull surface and it is at the bow part of the ship. Simulations are done using proven software package ANSYS AQWA and the results are compared. Simulations are done for both regular and irregular seas and the effect of fin on ship motion is studied. P-M spectrum is considered for various sea states.

  12. Amusia for pitch caused by right middle cerebral artery infarct.

    Science.gov (United States)

    Hochman, M Seth; Abrams, Kevin J

    2014-01-01

    A 61-year-old right-handed man with hypertension and dyslipidemia noted that he was singing along to classic rock songs on his car radio, but his voice was off pitch. Six days later, a magnetic resonance imaging scan of his brain revealed a cerebral infarct of the right temporal parietal cortex and insula. Case reports of the precise anatomic correlates of disordered pitch musical processing have been few and fragmentary. The anatomic involvement of our case coincides with the areas of involvement in 3 previously reported cases. Increased awareness of amusia as a rare clinical presentation of stroke should lead to earlier stroke intervention. Copyright © 2014 National Stroke Association. Published by Elsevier Inc. All rights reserved.

  13. Congenital amusia: a disorder of fine-grained pitch discrimination.

    Science.gov (United States)

    Peretz, Isabelle; Ayotte, Julie; Zatorre, Robert J; Mehler, Jacques; Ahad, Pierre; Penhune, Virginia B; Jutras, Benoît

    2002-01-17

    We report the first documented case of congenital amusia. This disorder refers to a musical disability that cannot be explained by prior brain lesion, hearing loss, cognitive deficits, socioaffective disturbance, or lack of environmental stimulation. This musical impairment is diagnosed in a middle-aged woman, hereafter referred to as Monica, who lacks most basic musical abilities, including melodic discrimination and recognition, despite normal audiometry and above-average intellectual, memory, and language skills. The results of psychophysical tests show that Monica has severe difficulties with detecting pitch changes. The data suggest that music-processing difficulties may result from problems in fine-grained discrimination of pitch, much in the same way as many language-processing difficulties arise from deficiencies in auditory temporal resolution.

  14. Comparing traditional AP classes to portfolio AP classes in effectiveness of measuring knowledge.

    Directory of Open Access Journals (Sweden)

    Olona, L.

    2017-07-01

    Full Text Available High school students across the United States and internationally take Advanced Placement exams in May each year. These students also spend their school year enrolled in an Advanced Placement (AP class in preparation for the exam. There is a lack of research on any correlation between a student’s performance in class and performance on the exam. This study aims to compare the difference in correlation between traditional AP classes and portfolio AP classes. Second-semester grades and exam scores were collected from 2015 and 2016 from Norman High School students. Traditional classes had weak, if any, correlation, and portfolio classes presented no correlation. This lack of a relationship between class grade and exam score implies that students are unable to gauge their future exam performance based on class performance. Future researchers should compare data for a greater sample of students as well as regional samples.

  15. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  16. Light airplane crash tests at three pitch angles

    Science.gov (United States)

    Vaughan, V. L., Jr.; Alfaro-Bou, E.

    1979-01-01

    Three similar twin-engine general aviation airplane specimens were crash tested at an impact dynamics research facility at 27 m/sec, a flight path angle of -15 deg, and pitch angles of -15 deg, 0 deg, and 15 deg. Other crash parameters were held constant. The test facility, instrumentation, test specimens, and test method are briefly described. Structural damage and accelerometer data for each of the three impact conditions are presented and discussed.

  17. Engaging Design Pitches: Storytelling Approaches and their Impacts

    OpenAIRE

    Parkinson, David

    2016-01-01

    This paper discusses the findings of a doctoral research study that builds an understanding of the relationship between storytelling approaches and their impacts at the design pitch. Determined through a literature review, the following desirable impacts were used to focus conversation during a series of semi-structured interviews conducted with employees from Unilever and Accenture: ‘Delivering Understanding’, ‘Demonstrating Value’, ‘Stimulating Critique’, and ‘Encouraging more Holistic Thin...

  18. Improved Methods for Pitch Synchronous Linear Prediction Analysis of Speech

    OpenAIRE

    劉, 麗清

    2015-01-01

    Linear prediction (LP) analysis has been applied to speech system over the last few decades. LP technique is well-suited for speech analysis due to its ability to model speech production process approximately. Hence LP analysis has been widely used for speech enhancement, low-bit-rate speech coding in cellular telephony, speech recognition, characteristic parameter extraction (vocal tract resonances frequencies, fundamental frequency called pitch) and so on. However, the performance of the co...

  19. Pitch Fork: A Novel tactile Digital Musical Instrument

    OpenAIRE

    Williams, Peter; Overholt, Daniel

    2017-01-01

    Pitch Fork is a prototype of an alternate, actuated digital musical instrument (DMI). It uses 5 infra-red and 4 piezoelectric sensors to control an additive synthesis engine. Iron bars are used as the physical point of contact in interaction with the aim of using material computation to control aspects of the digitally produced sound. This choice of material was also chosen to affect player experience. Sensor readings are relayed to a Macbook via an Arduino Mega. Mappings and audio output sig...

  20. Baseball pitching biomechanics in relation to injury risk and performance.

    Science.gov (United States)

    Fortenbaugh, Dave; Fleisig, Glenn S; Andrews, James R

    2009-07-01

    Baseball pitching kinematics, kinetics, ball velocity, and injuries at the shoulder and elbow are related. PubMed and Sport Discus were searched for original studies published between 1994 and 2008. Relevant references in these studies were retrieved. Inferential studies that tested relationships between kinematics and kinetics were included, as were studies that tested relationships between kinematics and ball velocity. Descriptive studies that simply quantified kinematics and/or kinetics were excluded. SEVERAL KINEMATIC PARAMETERS AT THE INSTANT OF FOOT CONTACT WERE ASSOCIATED WITH INCREASED UPPER EXTREMITY KINETICS: front foot position, front foot orientation, shoulder abduction, and shoulder horizontal adduction. The timing of shoulder external rotation, pelvis rotation, and upper trunk rotation was associated with increased kinetics and decreased ball velocity. Low braking force of the lead leg and a short stride were associated with decreased ball velocity. Decreased maximum shoulder external rotation, shoulder abduction, knee extension, and trunk tilt were also associated with decreased ball velocity. As pitchers develop, kinematic values remain similar, their variability reduces, and kinetic values gradually increase. Slight kinematic variations were seen among pitch types, although the kinetics of fastballs and curveballs were relatively the same; changeup kinetics were the lowest. As pitchers fatigued, kinetic values remained constant, but increases in arm pain were reported. Several kinematic parameters were related to joint kinetics and ball velocity. To enhance performance and reduce injury risk, pitchers need to learn proper fastball mechanics at an early age. A changeup is recommended as a safe secondary pitch to complement the fastball; the curveball can be added after fastball and changeup mechanics are mastered. Avoiding overuse and pitching while fatigued is necessary to minimize the risk of arm injury.

  1. Buds enable pitch and shortleaf pines to recover from injury

    Science.gov (United States)

    S. Little; H. A. Somes

    1956-01-01

    Pitch and shortleaf pines often survive severe damage by fires, cutting, rabbits, or deer. Deer may take all but 2 inches of the 6- to 8-inch shoots of seedlings, and still these seedlings may live and develop new shoots. Fires may kill all the foliage and terminal shoots on sapling or pole-size stems, but still these trees may green up and develop new leaders. Many of...

  2. Magnetosheath distortion of pitch angle distributions of solar protons

    International Nuclear Information System (INIS)

    Palmer, I.D.; Higbie, P.R.

    1978-01-01

    The propagation of energetic solar protons of 9 or approx. =1 MeV into the magnetosheath is investigated through three-dimensional pitch angle distributions measured on Vela satellites. Distortions are observed in the magnetosheath, as compared with isotropic or unidirectional distributions normally expected in interplanetary space. Two types of distortions are observed which are characterized by breaks in the distributions at μ/sub o/ O, where μ is the cosine of the pitch angle. The distributions in the magnetosheath are explained by a Liouville transformation, if particle motion across the bow shock and through the magnetosheath is assumed to be adiabatic. Whether μ/sub o/ is positive or negative is determined by whether the satellite in the magnetosheath lies beyond or in front of the region of maximum magnetic field compression (or neck) in the magnetosheath, relative to the direction of the net flow of particles. The magnitude of μ/sub o/ is a measure of the field ratio between neck and satellite. Scattering effects, which must occur at the bow shock and in the magnetosheath, only perturb the adiabatic propagation of the particles. The results show that one must be cautious in inferring the true interplanetary anisotropy from measurements in the magnetosheath. While the maxima and minima of the corresponding pitch angle distributions will be the same, the distributions can be vastly different, and both anisotropy and omnidirectional intensities significantly different, too. By corollary, the pitch angle distribution and anisotropy measured in the solar wind on field line that intercepts the bow shock sunward of the earth will in general be different from that which would be measured in interplanetary space on a field line not connected to the bow shock; to first order the effect of the bow shock can be computed by treating the motion as adiabatic

  3. The APS thin pulsed septum magnets

    International Nuclear Information System (INIS)

    Lopez, F.; Mills, F.; Milton, S.; Reeves, S.; Sheynin, S.; Thompson, K.; Turner, L.

    1994-01-01

    A thin (2-mm) eddy-current pulsed septum magnet was developed for use in the Advanced Photon Source (APS) machines. A number of different configurations of the magnet were assembled and tested in an effort to minimize the undesired leakage field in the stored-beam region. However, because of measured excessive leakage fields, an alternative direct-drive septum magnet was also constructed and tested. We present here the design specifications and acceptable performance criteria along with results of magnetic field measurements

  4. Tumores de apéndice cecal

    Directory of Open Access Journals (Sweden)

    Rubén Bembilbre Taboada

    1998-08-01

    Full Text Available Se realizó un estudio descriptivo-retrospectivo de 8 pacientes con tumores de apéndice cecal, en el período comprendido entre el 1 de enero de 1990 y el 1 de enero de 1997, los cuales fueron intervenidos quirúrgicamente en el Hospital Provincial Clinicoquirúrgico Docente "Dr. Gustavo Aldereguía". Se revisaron todos los libros de biopsias del Departamento de Anatomía Patológica correspondientes al período analizado, para obtener aquellos casos con diagnóstico de afección tumoral de apéndice. Se estudiaron las historias clínicas y se recogieron datos de interés como sexo, manifestaciones clínicas, diagnóstico presuntivo, diagnóstico anatomopatológico y tipo de intervención. La afección tumoral de apéndice cecal es infrecuente y constituyó el 0,38% del total de 20057 apéndices examinadas. No se hallaron diferencias respecto al sexo. Hubo un ligero predominio en pacientes con edades de más de 60 años. Los hallazgos clínicos más frecuentes fueron dolor agudo en fosa inguinal derecha y fiebre, con predominio del adenocarcinoma. Los principales resultados se exponen en tablasA retrospective-descriptive study of 8 patients with appendix ceci tumors attending the hospital from January 1st, 1990 to January 1st 1997 was made. These patients were operated at "Dr. Gustavo Aldereguía" clinical surgical teaching hospital in Cienfuegos. All the biopsy records of the analyzed period were checked in the Pathological Anatomy Department so as to collect those cases diagnosed with appendix ceci tumors. Medical records were examined and interesting data were collected as follows: sex, clinical symptoms, presumptive diagnosis, anatomopathological diagnosis and type of surgery. Tumors in appendix ceci are unusual and represented 0.38 % of 20 057 analyzed appendixes. Sex was not a determining factor. The disease was slightly predominant in patients over 60. The most frequent clinical findings were: nagging pain in the right inguinal fosa and

  5. An investigation of spatial representation of pitch in individuals with congenital amusia.

    Science.gov (United States)

    Lu, Xuejing; Sun, Yanan; Thompson, William Forde

    2017-09-01

    Spatial representation of pitch plays a central role in auditory processing. However, it is unknown whether impaired auditory processing is associated with impaired pitch-space mapping. Experiment 1 examined spatial representation of pitch in individuals with congenital amusia using a stimulus-response compatibility (SRC) task. For amusic and non-amusic participants, pitch classification was faster and more accurate when correct responses involved a physical action that was spatially congruent with the pitch height of the stimulus than when it was incongruent. However, this spatial representation of pitch was not as stable in amusic individuals, revealed by slower response times when compared with control individuals. One explanation is that the SRC effect in amusics reflects a linguistic association, requiring additional time to link pitch height and spatial location. To test this possibility, Experiment 2 employed a colour-classification task. Participants judged colour while ignoring a concurrent pitch by pressing one of two response keys positioned vertically to be congruent or incongruent with the pitch. The association between pitch and space was found in both groups, with comparable response times in the two groups, suggesting that amusic individuals are only slower to respond to tasks involving explicit judgments of pitch.

  6. Pitching Emotions: The Interpersonal Effects of Emotions in Professional Baseball

    Directory of Open Access Journals (Sweden)

    Arik eCheshin

    2016-02-01

    Full Text Available Sports games are inherently emotional situations, but surprisingly little is known about the social consequences of these emotions. We examined the interpersonal effects of emotional expressions in professional baseball. Specifically, we investigated whether pitchers' facial displays influence how pitches are assessed and responded to. Using footage from MLB World Series finals, we isolated incidents where the pitcher's face was visible before a pitch. A pre-study indicated that participants consistently perceived anger, happiness, and worry in pitchers' facial displays. An independent sample then predicted pitch characteristics and batter responses based on the same perceived emotional displays. Participants expected pitchers perceived as happy to throw more accurate balls, pitchers perceived as angry to throw faster and more difficult balls, and pitchers perceived as worried to throw slower and less accurate balls. Batters were expected to approach (swing when faced with a pitcher perceived as happy and to avoid (no swing when faced with a pitcher perceived as worried. Whereas previous research focused on using emotional expressions as information regarding past and current situations, our work suggests that people also use perceived emotional expressions to predict future behavior. Our results attest to the impact perceived emotional expressions can have on professional sports.

  7. Pitching effects of buoyancy during four competitive swimming strokes.

    Science.gov (United States)

    Cohen, Raymond C Z; Cleary, Paul W; Harrison, Simon M; Mason, Bruce R; Pease, David L

    2014-10-01

    The purpose of this study was to determine the pitching effects of buoyancy during all competitive swimming strokes--freestyle, backstroke, butterfly, and breaststroke. Laser body scans of national-level athletes and synchronized multiangle swimming footage were used in a novel markerless motion capture process to produce three-dimensional biomechanical models of the swimming athletes. The deforming surface meshes were then used to calculate swimmer center-of-mass (CoM) positions, center-of-buoyancy (CoB) positions, pitch buoyancy torques, and sagittal plane moments of inertia (MoI) throughout each stroke cycle. In all cases the mean buoyancy torque tended to raise the legs and lower the head; however, during part of the butterfly stroke the instantaneous buoyancy torque had the opposite effect. The swimming strokes that use opposing arm and leg strokes (freestyle and backstroke) had smaller variations in CoM positions, CoB positions, and buoyancy torques. Strokes with synchronized left-right arm and leg movement (butterfly and breaststroke) had larger variations in buoyancy torques, which impacts the swimmer's ability to maintain a horizontal body pitch for these strokes. The methodology outlined in this paper enables the rotational effects of buoyancy to be better understood by swimmers, allowing better control of streamlined horizontal body positioning during swimming to improve performance.

  8. Physics of pitch angle scattering and velocity diffusion. I - Theory

    Science.gov (United States)

    Karimabadi, H.; Krauss-Varban, D.; Terasawa, T.

    1992-01-01

    A general theory for the pitch angle scattering and velocity diffusion of particles in the field of a spectrum of waves in a magnetized plasma is presented. The test particle theory is used to analyze the particle motion. The form of diffusion surfaces is examined, and analytical expressions are given for the resonance width and bounce frequency. The resonance widths are found to vary strongly as a function of harmonic number. The resulting diffusion can be quite asymmetric with respect to pitch angle of 90 deg. The conditions for the onset of pitch angle scattering and energy diffusion are explained in detail. Some of the known shortcomings of the standard quasi-linear theory are also addressed, and ways to overcome them are shown. In particular, the often stated quasi-linear gap at 90 deg is found to exist only under very special cases. For instance, oblique wave propagation can easily remove the gap. The conditions for the existence of the gap are described in great detail. A new diffusion equation which takes into account the finite resonance widths is also discussed. The differences between this new theory and the standard resonance broadening theory is explained.

  9. Spatial Rack Drives Pitch Configurations: Essence and Content

    Science.gov (United States)

    Abadjieva, Emilia; Abadjiev, Valentin; Naganawa, Akihiro

    2018-03-01

    The practical realization of all types of mechanical motions converters is preceded by solving the task of their kinematic synthesis. In this way, the determination of the optimal values of the constant geometrical parameters of the chosen structure of the created mechanical system is achieved. The searched result is a guarantee of the preliminary defined kinematic characteristics of the synthesized transmission and in the first place, to guarantee the law of motions transformation. The kinematic synthesis of mechanical transmissions is based on adequate mathematical modelling of the process of motions transformation and on the object, realizing this transformation. Basic primitives of the mathematical models for synthesis upon a pitch contact point are geometric and kinematic pitch configurations. Their dimensions and mutual position in space are the input parameters for the processes of design and elaboration of the synthesized mechanical device. The study presented here is a brief review of the theory of pitch configurations. It is an independent scientific branch of the spatial gearing theory (theory of hyperboloid gears). On this basis, the essence and content of the corresponding primitives, applicable to the synthesis of spatial rack drives, are defined.

  10. Studies of microparticles in patients with the antiphospholipid syndrome (APS).

    Science.gov (United States)

    Vikerfors, A; Mobarrez, F; Bremme, K; Holmström, M; Ågren, A; Eelde, A; Bruzelius, M; Antovic, A; Wallén, H; Svenungsson, E

    2012-06-01

    To study circulating platelet, monocyte and endothelial microparticles (PMPs, MMPs and EMPs) in patients with antiphospholipid syndrome (APS) in comparison with healthy controls. Fifty-two patients with APS and 52 healthy controls were investigated. MPs were measured on a flow cytometer (Beckman Gallios) and defined as particles sized APS patients versus controls (p APS patients. We observed a high number of EMPs expressing TF in APS patients. The numbers of MMPs and total EMPs were also higher as compared with healthy controls but in contrast to previous reports, the number of PMPs did not differ between groups.

  11. A Fröhlich effect and representational gravity in memory for auditory pitch.

    Science.gov (United States)

    Hubbard, Timothy L; Ruppel, Susan E

    2013-08-01

    Memory for the initial pitch of an auditory target that increased or decreased in auditory frequency was examined. Memory was displaced forward in the direction of pitch motion, and this is consistent with the Fröhlich effect previously observed for visual targets moving in visual physical space. The Fröhlich effect for pitch increased with faster target velocity and decreased if an auditory cue with the same pitch as the initial pitch of the target was presented before the target was presented. The Fröhlich effect was larger for descending pitch motion than for ascending pitch motion, and this is consistent with an influence of representational gravity. The data suggest that representation of auditory frequency space exhibits some of the same biases as representation of visual physical space, and implications for theories of attention in displacement and for crossmodal and multisensory representation of space are discussed. 2013 APA, all rights reserved

  12. Fine-grained pitch processing of music and speech in congenital amusia.

    Science.gov (United States)

    Tillmann, Barbara; Rusconi, Elena; Traube, Caroline; Butterworth, Brian; Umiltà, Carlo; Peretz, Isabelle

    2011-12-01

    Congenital amusia is a lifelong disorder of music processing that has been ascribed to impaired pitch perception and memory. The present study tested a large group of amusics (n=17) and provided evidence that their pitch deficit affects pitch processing in speech to a lesser extent: Fine-grained pitch discrimination was better in spoken syllables than in acoustically matched tones. Unlike amusics, control participants performed fine-grained pitch discrimination better for musical material than for verbal material. These findings suggest that pitch extraction can be influenced by the nature of the material (music vs speech), and that amusics' pitch deficit is not restricted to musical material, but extends to segmented speech events. © 2011 Acoustical Society of America

  13. Binaural pitch perception in normal-hearing and hearing-impaired listeners

    DEFF Research Database (Denmark)

    Santurette, Sébastien; Dau, Torsten

    2007-01-01

    The effects of hearing impairment on the perception of binaural-pitch stimuli were investigated. Several experiments were performed with normal-hearing and hearing-impaired listeners, including detection and discrimination of binaural pitch, and melody recognition using different types of binaural...... pitches. For the normal-hearing listeners, all types of binaural pitches could be perceived immediately and were musical. The hearing-impaired listeners could be divided into three groups based on their results: (a) some perceived all types of binaural pitches, but with decreased salience or musicality...... compared to normal-hearing listeners; (b) some could only perceive the strongest pitch types; (c) some were unable to perceive any binaural pitch at all. The performance of the listeners was not correlated with audibility. Additional experiments investigated the correlation between performance in binaural...

  14. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  15. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  16. Validation of the new trapped environment AE9/AP9/SPM at low Earth orbit

    Science.gov (United States)

    Badavi, Francis F.

    2014-09-01

    solar cycles dating back to the 1970s, roughly representing 40 years of data collection. In contrast, the older AE8/AP8 and CRRES models were limited to only a few months of measurements taken during the prior solar minima and maxima. The dual goal of this paper is to first validate the AE8/AP8 and AE9/AP9/SPM trapped models against ISS dosemetric measurements for a silicon based detector, to assess the improvements in the AE9/AP9/SPM model as compared to AE8/AP8 model. The validation is done at selected target points within ISS-6A configuration during its passage through the south Atlantic anomaly (SAA). For such validation, only the isotropic spectrum of either model is needed. As a second goal, the isotropic spectra of both trapped models are re-casted into anisotropic spectra by modulating them with a measurement derived angular formalism which is applicable to trapped protons. Since at LEO electrons have minimal exposure contribution, the paper ignores the AE8 and AE9 component of the models and presents the angular validation of AP8 and AP9 against measurements from the compact environment anomaly sensor (CEASE) science instrument package, flown onboard the tri-service experiment-5 (TSX-5) satellite during the period of June 2000-July 2006. The spin stabilized satellite was flown in a 410 × 1710 km, 69° inclination orbit, allowing it to be exposed to a broad range of LEO regime. Particular emphasize is put on the validation of proton flux profiles at differential 40 MeV and integral >40 MeV, in the vicinity of SAA where protons exhibit east-west (EW) anisotropy and have a relatively narrow pitch angle distribution. Within SAA, the EW anisotropy results in different level of exposure to each side of CEASE instrument package, allowing the extraction of anisotropic proton spectra from the measurements. While the magnitude of the EW effect at LEO depends on a multitude of factors such as trapped proton energy, orientation of the spacecraft along the velocity vector

  17. RELAP5/MOD3 AP600 problems

    International Nuclear Information System (INIS)

    Riemke, R.A.

    1993-01-01

    RELAP5/MOD3 is a reactor systems analysis code that has been developed jointly by the US Nuclear Regulatory Commission (USNRC) and a consortium consisting of several of the countries and domestic organizations that were members of the International Code Assessment and Applications Program (ICAP). The code is currently being used to simulate transients for the next generation of advanced light water reactors (ALWR's). One particular reactor design is the Westinghouse AP600 pressurized water reactor (PWR), which consists of two hot legs and four cold legs as well as passive emergency core cooling (ECC) systems. Initial calculations with RELAP5/MOD3 indicated that the code was not as robust as RELAP5/MOD2.5 with regard to AP600 calculations. Recent modifications in the areas of condensation wall heat transfer, interfacial heat transfer in the presence of noncondensibles, bubbly flow interfacial heat transfer, and time smoothing of both interfacial drag and interfacial heat transfer have improved the robustness, although more reliability is needed

  18. Structural modules in AP1000 plant design

    International Nuclear Information System (INIS)

    Prasad, N.; Tunon-Sanjur, L.

    2007-01-01

    Structural modules are extensively used in AP1000 plant design. The shop manufacturing of modules components improves the quality and reliability of plant structures. The application of modules has a positive impact on construction schedules, and results in substantial savings in the construction cost. This paper describes various types of structural modules used for AP1000 plant structures. CA structural wall modules are steel plate modules with concrete placed, on or within the module, after module installation. The layout and design of the largest CA wall modules, CA01 and CA20, is described in detail. General discussion of structural floor modules, such as the composite and finned floors, is also included. Steel form CB modules (liners) consist of plate reinforced with angle stiffeners and tee sections. The angles and the tee sections are on the concrete side of the plate. Design of CB20 has been included as an example of CB type modules. Design codes and structural concepts related to module designs are discussed. (authors)

  19. On the Mechanisms for Defeating AP Projectiles

    Science.gov (United States)

    Rosenberg, Z.; Dekel, E.; Ashuach, Y.; Yeshurun, Y.

    The important mechanisms for defeating armor piercing (AP) projectiles are reviewed in this paper. These mechanisms are based on the compressive strength of the target material (its inherent resistance to penetration) and on the asymmetrical forces which it exerts on the threat, through proper geometrical arrangements. We discuss the basic features of the resistance to penetration, starting with the classical analysis of the cavity expansion process in elasto-plastic solids. This property of the target is responsible for the deceleration of hard cored projectiles and for the erosion of long rods, under normal impact conditions. We then discuss the asymmetrical interaction of AP projectiles with inclined plates (metals and polymers) and with ceramic spheres. These asymmetric forces are responsible for their deflection and breakup. Our work combines experimental observations with numerical simulations and engineering models, which enhance the understanding of the various phenomena encountered in these complex situations. This understanding is necessary for optimizing the performance of any armor design against a given threat.

  20. AP1000 shield building: a constructability challenge

    International Nuclear Information System (INIS)

    Di Giuseppe, Giovanni; Bonanno, Domenico

    2010-01-01

    The AP1000 Shield Building, an enhanced structure which surrounds the containment vessel, consists of standard Reinforced Concrete (RC) and composite Steel and Concrete (SC) construction. In the SC module the surface steel plates, (with attached shear studs and angles) filled with concrete, act as the steel reinforcement in concrete. This is a relatively new design technology that required the appropriate use of structural codes, supplemented with information from applicable tests on similar composite steel and concrete construction. Being a newer design concept, existing codes do not provide explicit guidance on SC construction so a review of literature and test data on composite structures similar to AP1000 shield building was done in order to confirm the technical basis for the design. The SC walls, air inlet structure and roof of the Shield Building will be constructed using modular construction practices and then transported to site and lifted into place. These modules, working also as permanent form-work, will be filled with high strength Self- Consolidating Concrete. (SCC) This paper provides a focused and integrated presentation of the enhanced shield building design methodology, testing, constructability and inspection. (authors)

  1. Pitch Angle Scattering of Energetic Electrons by Plasmaspheric Hiss Emissions

    Science.gov (United States)

    Tobita, M.; Omura, Y.; Summers, D.

    2017-12-01

    We study scattering of energetic electrons in pitch angles and kinetic energies through their resonance with plasmaspheric hiss emissions consisting of many coherent discrete whistler-mode wave packets with rising and falling frequencies [1,2,3]. Using test particle simulations, we evaluate the efficiency of scattering, which depends on the inhomogeneity ratio S of whistler mode wave-particle interaction [4]. The value of S is determined by the wave amplitude, frequency sweep rate, and the gradient of the background magnetic field. We first modulate those parameters and observe variations of pitch angles and kinetic energies of electrons with a single wave under various S values so as to obtain basic understanding. We then include many waves into the system to simulate plasmaspheric hiss emissions. As the wave packets propagate away from the magnetic equator, the nonlinear trapping potential at the resonance velocity is deformed, making a channel of gyrophase for untrapped electrons to cross the resonance velocity, and causing modulations in their pitch angles and kinetic energies. We find efficient scattering of pitch angles and kinetic energies because of coherent nonlinear wave-particle interaction, resulting in electron precipitations into the polar atmosphere. We compare the results with the bounce averaged pitch angle diffusion coefficient based on quasi-linear theory, and show that the nonlinear wave model with many coherent packets can cause scattering of resonant electrons much faster than the quasi-linear diffusion process. [1] Summers, D., Omura, Y., Nakamura, S., and C. A. Kletzing (2014), Fine structure of plasmaspheric hiss, J. Geophys. Res., 119, 9134-9149. [2] Omura, Y., Y. Miyashita, M. Yoshikawa, D. Summers, M. Hikishima, Y. Ebihara, and Y. Kubota (2015), Formation process of relativistic electron flux through interaction with chorus emissions in the Earth's inner magnetosphere, J. Geophys. Res. Space Physics, 120, 9545-9562. [3] Nakamura, S., Y

  2. Westinghouse AP1000 advanced passive plant: design features and benefits

    International Nuclear Information System (INIS)

    Walls, S.J.; Cummins, W.E.

    2003-01-01

    The Westinghouse AP1000 Program is aimed at implementing the AP1000 plant to provide a further major improvement in plant economics while maintaining the passive safety advantages established by the AP600. An objective is to retain to the maximum extent possible the plant design of the AP600 so as to retain the licensing basis, cost estimate, construction schedule, modularization scheme, and the detailed design from the AP600 program. Westinghouse and the US Nuclear Regulatory Commission staff have embarked on a program to complete Design Certification for the AP1000 by 2004. A pre-certification review phase was completed in March 2002 and was successful in establishing the applicability of the AP600 test program and AP600 safety analysis codes to the AP1000 Design Certification. On March 28, 2002, Westinghouse submitted to US NRC the AP1000 Design Control Document and Probabilistic Risk Assessment, thereby initiating the formal design certification review process. The results presented in these documents verify the safety performance of the API 000 and conformance with US NRC licensing requirements. Plans are being developed for implementation of a series of AP1000 plants in the US. Key factors in this planning are the economics of AP1000, and the associated business model for licensing, constructing and operating these new plants. Similarly plans are being developed to get the AP1000 design reviewed for use in the UK. Part of this planning has been to examine the AP1000 design relative to anticipated UK safety and licensing issues. (author)

  3. What is Needed for Absolute Paleointensity?

    Science.gov (United States)

    Valet, J. P.

    2015-12-01

    Many alternative approaches to the Thellier and Thellier technique for absolute paleointensity have been proposed during the past twenty years. One reason is the time consuming aspect of the experiments. Another reason is to avoid uncertainties in determinations of the paleofield which are mostly linked to the presence of multidomain grains. Despite great care taken by these new techniques, there is no indication that they always provide the right answer and in fact sometimes fail. We are convinced that the most valid approach remains the original double heating Thellier protocol provided that natural remanence is controlled by pure magnetite with a narrow distribution of small grain sizes, mostly single domains. The presence of titanium, even in small amount generates biases which yield incorrect field values. Single domain grains frequently dominate the magnetization of glass samples, which explains the success of this selective approach. They are also present in volcanic lava flows but much less frequently, and therefore contribute to the low success rate of most experiments. However the loss of at least 70% of the magnetization at very high temperatures prior to the Curie point appears to be an essential prerequisite that increases the success rate to almost 100% and has been validated from historical flows and from recent studies. This requirement can easily be tested by thermal demagnetization while low temperature experiments can document the detection of single domain magnetite using the δFC/δZFC parameter as suggested (Moskowitz et al, 1993) for biogenic magnetite.

  4. Differential Recognition of Pitch Patterns in Discrete and Gliding Stimuli in Congenital Amusia: Evidence from Mandarin Speakers

    Science.gov (United States)

    Liu, Fang; Xu, Yi; Patel, Aniruddh D.; Francart, Tom; Jiang, Cunmei

    2012-01-01

    This study examined whether "melodic contour deafness" (insensitivity to the direction of pitch movement) in congenital amusia is associated with specific types of pitch patterns (discrete versus gliding pitches) or stimulus types (speech syllables versus complex tones). Thresholds for identification of pitch direction were obtained using discrete…

  5. 50 μm pixel pitch wafer-scale CMOS active pixel sensor x-ray detector for digital breast tomosynthesis.

    Science.gov (United States)

    Zhao, C; Konstantinidis, A C; Zheng, Y; Anaxagoras, T; Speller, R D; Kanicki, J

    2015-12-07

    Wafer-scale CMOS active pixel sensors (APSs) have been developed recently for x-ray imaging applications. The small pixel pitch and low noise are very promising properties for medical imaging applications such as digital breast tomosynthesis (DBT). In this work, we evaluated experimentally and through modeling the imaging properties of a 50 μm pixel pitch CMOS APS x-ray detector named DynAMITe (Dynamic Range Adjustable for Medical Imaging Technology). A modified cascaded system model was developed for CMOS APS x-ray detectors by taking into account the device nonlinear signal and noise properties. The imaging properties such as modulation transfer function (MTF), noise power spectrum (NPS), and detective quantum efficiency (DQE) were extracted from both measurements and the nonlinear cascaded system analysis. The results show that the DynAMITe x-ray detector achieves a high spatial resolution of 10 mm(-1) and a DQE of around 0.5 at spatial frequencies  <1 mm(-1). In addition, the modeling results were used to calculate the image signal-to-noise ratio (SNRi) of microcalcifications at various mean glandular dose (MGD). For an average breast (5 cm thickness, 50% glandular fraction), 165 μm microcalcifications can be distinguished at a MGD of 27% lower than the clinical value (~1.3 mGy). To detect 100 μm microcalcifications, further optimizations of the CMOS APS x-ray detector, image aquisition geometry and image reconstruction techniques should be considered.

  6. 50 μm pixel pitch wafer-scale CMOS active pixel sensor x-ray detector for digital breast tomosynthesis

    International Nuclear Information System (INIS)

    Zhao, C; Kanicki, J; Konstantinidis, A C; Zheng, Y; Speller, R D; Anaxagoras, T

    2015-01-01

    Wafer-scale CMOS active pixel sensors (APSs) have been developed recently for x-ray imaging applications. The small pixel pitch and low noise are very promising properties for medical imaging applications such as digital breast tomosynthesis (DBT). In this work, we evaluated experimentally and through modeling the imaging properties of a 50 μm pixel pitch CMOS APS x-ray detector named DynAMITe (Dynamic Range Adjustable for Medical Imaging Technology). A modified cascaded system model was developed for CMOS APS x-ray detectors by taking into account the device nonlinear signal and noise properties. The imaging properties such as modulation transfer function (MTF), noise power spectrum (NPS), and detective quantum efficiency (DQE) were extracted from both measurements and the nonlinear cascaded system analysis. The results show that the DynAMITe x-ray detector achieves a high spatial resolution of 10 mm −1 and a DQE of around 0.5 at spatial frequencies  <1 mm −1 . In addition, the modeling results were used to calculate the image signal-to-noise ratio (SNR i ) of microcalcifications at various mean glandular dose (MGD). For an average breast (5 cm thickness, 50% glandular fraction), 165 μm microcalcifications can be distinguished at a MGD of 27% lower than the clinical value (∼1.3 mGy). To detect 100 μm microcalcifications, further optimizations of the CMOS APS x-ray detector, image aquisition geometry and image reconstruction techniques should be considered. (paper)

  7. Normal-Hearing Listeners’ and Cochlear Implant Users’ Perception of Pitch Cues in Emotional Speech

    Directory of Open Access Journals (Sweden)

    Steven Gilbers

    2015-10-01

    Full Text Available In cochlear implants (CIs, acoustic speech cues, especially for pitch, are delivered in a degraded form. This study’s aim is to assess whether due to degraded pitch cues, normal-hearing listeners and CI users employ different perceptual strategies to recognize vocal emotions, and, if so, how these differ. Voice actors were recorded pronouncing a nonce word in four different emotions: anger, sadness, joy, and relief. These recordings’ pitch cues were phonetically analyzed. The recordings were used to test 20 normal-hearing listeners’ and 20 CI users’ emotion recognition. In congruence with previous studies, high-arousal emotions had a higher mean pitch, wider pitch range, and more dominant pitches than low-arousal emotions. Regarding pitch, speakers did not differentiate emotions based on valence but on arousal. Normal-hearing listeners outperformed CI users in emotion recognition, even when presented with CI simulated stimuli. However, only normal-hearing listeners recognized one particular actor’s emotions worse than the other actors’. The groups behaved differently when presented with similar input, showing that they had to employ differing strategies. Considering the respective speaker’s deviating pronunciation, it appears that for normal-hearing listeners, mean pitch is a more salient cue than pitch range, whereas CI users are biased toward pitch range cues.

  8. TRUNK LEAN DURING A SINGLE-LEG SQUAT IS ASSOCIATED WITH TRUNK LEAN DURING PITCHING.

    Science.gov (United States)

    Plummer, Hillary A; Oliver, Gretchen D; Powers, Christopher M; Michener, Lori A

    2018-02-01

    Impaired trunk motion during pitching may be a risk factor for upper extremity injuries. Specifically, increased forces about the shoulder and elbow have been observed in pitchers with excessive contralateral trunk lean during pitching. Because of the difficulty in identifying abnormal trunk motions during a high-speed task such as pitching, a clinical screening test is needed to identify pitchers who have impaired trunk motion during pitching. The purpose of this study was to determine the relationship between the degree of lateral trunk lean during the single-leg squat and amount of trunk lean during pitching and if trunk lean during pitching can be predicted from lean during the single-leg squat. Controlled Laboratory Study; Cross-sectional. Seventy-three young baseball pitchers (11.4 ± 1.7 years; 156.3 ± 11.9 cm; 50.5 ± 8.8 kg) participated. An electromagnetic tracking system was used to obtain trunk kinematic data during a single-leg squat task (lead leg) and at maximum shoulder external rotation of a fastball pitch. Pearson correlation coefficients for trunk lean during the single-leg squat and pitching were calculated. A linear regression analysis was performed to determine if trunk lean during pitching can be predicted from lean during the single-leg squat. There was a positive correlation between trunk lean during the single-leg squat and trunk lean during pitching (r = 0.53; plean during the single-leg squat predicted the amount of lateral trunk lean during pitching (R 2 = 0.28; p lean during an SLS and pitching. Trunk lean during the single-leg squat explained 28% of the variance in trunk lean during pitching. Diagnosis, level 3.

  9. Evaluation of the absolute regional temperature potential

    Directory of Open Access Journals (Sweden)

    D. T. Shindell

    2012-09-01

    Full Text Available The Absolute Regional Temperature Potential (ARTP is one of the few climate metrics that provides estimates of impacts at a sub-global scale. The ARTP presented here gives the time-dependent temperature response in four latitude bands (90–28° S, 28° S–28° N, 28–60° N and 60–90° N as a function of emissions based on the forcing in those bands caused by the emissions. It is based on a large set of simulations performed with a single atmosphere-ocean climate model to derive regional forcing/response relationships. Here I evaluate the robustness of those relationships using the forcing/response portion of the ARTP to estimate regional temperature responses to the historic aerosol forcing in three independent climate models. These ARTP results are in good accord with the actual responses in those models. Nearly all ARTP estimates fall within ±20% of the actual responses, though there are some exceptions for 90–28° S and the Arctic, and in the latter the ARTP may vary with forcing agent. However, for the tropics and the Northern Hemisphere mid-latitudes in particular, the ±20% range appears to be roughly consistent with the 95% confidence interval. Land areas within these two bands respond 39–45% and 9–39% more than the latitude band as a whole. The ARTP, presented here in a slightly revised form, thus appears to provide a relatively robust estimate for the responses of large-scale latitude bands and land areas within those bands to inhomogeneous radiative forcing and thus potentially to emissions as well. Hence this metric could allow rapid evaluation of the effects of emissions policies at a finer scale than global metrics without requiring use of a full climate model.

  10. Absolute Radiometric Calibration of KOMPSAT-3A

    Directory of Open Access Journals (Sweden)

    H. Y. Ahn

    2016-06-01

    Full Text Available This paper presents a vicarious radiometric calibration of the Korea Multi-Purpose Satellite-3A (KOMPSAT-3A performed by the Korea Aerospace Research Institute (KARI and the Pukyong National University Remote Sensing Group (PKNU RSG in 2015.The primary stages of this study are summarized as follows: (1 A field campaign to determine radiometric calibrated target fields was undertaken in Mongolia and South Korea. Surface reflectance data obtained in the campaign were input to a radiative transfer code that predicted at-sensor radiance. Through this process, equations and parameters were derived for the KOMPSAT-3A sensor to enable the conversion of calibrated DN to physical units, such as at-sensor radiance or TOA reflectance. (2 To validate the absolute calibration coefficients for the KOMPSAT-3A sensor, we performed a radiometric validation with a comparison of KOMPSAT-3A and Landsat-8 TOA reflectance using one of the six PICS (Libya 4. Correlations between top-of-atmosphere (TOA radiances and the spectral band responses of the KOMPSAT-3A sensors at the Zuunmod, Mongolia and Goheung, South Korea sites were significant for multispectral bands. The average difference in TOA reflectance between KOMPSAT-3A and Landsat-8 image over the Libya 4, Libya site in the red-green-blue (RGB region was under 3%, whereas in the NIR band, the TOA reflectance of KOMPSAT-3A was lower than the that of Landsat-8 due to the difference in the band passes of two sensors. The KOMPSAT-3Aensor includes a band pass near 940 nm that can be strongly absorbed by water vapor and therefore displayed low reflectance. Toovercome this, we need to undertake a detailed analysis using rescale methods, such as the spectral bandwidth adjustment factor.

  11. Absolute parameters of young stars: QZ Carinae

    Science.gov (United States)

    Walker, W. S. G.; Blackford, M.; Butland, R.; Budding, E.

    2017-09-01

    New high-resolution spectroscopy and BVR photometry together with literature data on the complex massive quaternary star QZ Car are collected and analysed. Absolute parameters are found as follows. System A: M1 = 43 (±3), M2 = 19 (+3 -7), R1 = 28 (±2), R2 = 6 (±2), (⊙); T1 ˜ 28 000, T2 ˜ 33 000 K; System B: M1 = 30 (±3), M2 = 20 (±3), R1 = 10 (±0.5), R2 = 20 (±1), (⊙); T1 ˜ 36 000, T2 ˜ 30 000 K (model dependent temperatures). The wide system AB: Period = 49.5 (±1) yr, Epochs, conjunction = 1984.8 (±1), periastron = 2005.3 (±3) yr, mean separation = 65 (±3), (au); orbital inclination = 85 (+5 -15) deg, photometric distance ˜2700 (±300) pc, age = 4 (±1) Myr. Other new contributions concern: (a) analysis of the timing of minima differences (O - C)s for the eclipsing binary (System B); (b) the width of the eclipses, pointing to relatively large effects of radiation pressure; (c) inferences from the rotational widths of lines for both Systems A and B; and (d) implications for theoretical models of early-type stars. While feeling greater confidence on the quaternary's general parametrization, observational complications arising from strong wind interactions or other, unclear, causes still inhibit precision and call for continued multiwavelength observations. Our high-inclination value for the AB system helps to explain failures to resolve the wide binary in the previous years. The derived young age independently confirms membership of QZ Car to the open cluster Collinder 228.

  12. Absolute nuclear material assay using count distribution (LAMBDA) space

    Science.gov (United States)

    Prasad, Manoj K [Pleasanton, CA; Snyderman, Neal J [Berkeley, CA; Rowland, Mark S [Alamo, CA

    2012-06-05

    A method of absolute nuclear material assay of an unknown source comprising counting neutrons from the unknown source and providing an absolute nuclear material assay utilizing a model to optimally compare to the measured count distributions. In one embodiment, the step of providing an absolute nuclear material assay comprises utilizing a random sampling of analytically computed fission chain distributions to generate a continuous time-evolving sequence of event-counts by spreading the fission chain distribution in time.

  13. Planck absolute entropy of a rotating BTZ black hole

    Science.gov (United States)

    Riaz, S. M. Jawwad

    2018-04-01

    In this paper, the Planck absolute entropy and the Bekenstein-Smarr formula of the rotating Banados-Teitelboim-Zanelli (BTZ) black hole are presented via a complex thermodynamical system contributed by its inner and outer horizons. The redefined entropy approaches zero as the temperature of the rotating BTZ black hole tends to absolute zero, satisfying the Nernst formulation of a black hole. Hence, it can be regarded as the Planck absolute entropy of the rotating BTZ black hole.

  14. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  15. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP21Q.Seq.d/ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  16. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP24Q.Seq.d/ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  17. Control units for APS power supplies

    International Nuclear Information System (INIS)

    Despe, O.D.; Saunders, C.; McGhee, D.G.

    1993-01-01

    The Advanced Photon Source (APS) accelerator facility is made up of five major subsystems in addition to the linac: the positron accumulator ring (PAR), low energy transport (LET), booster synchrotron (SYNCH), high energy transport (HET), the storage ring (SR). Each subsystem has multiple magnet power supply combinations, some requiring multiple of operation. These magnet and power supply combinations computer controlled and monitored. The power supply control unit (PSCU) is the first layer of hardware and software above the power supply itself and is described in this paper. The description includes the basic philosophy for each of operation and how it influences the topology and of implementing control. The design of the analog reference blocks (ARBs) influenced the design of other custom functions well as the feedback controls for vibration and other dynamic corrections. The command set supported by the PSCU is discussed

  18. Investigation of APS PAR Vertical Beam Instability

    CERN Document Server

    Yao, Chihyuan; Sereno, Nicholas S; Yang Bing Xin

    2005-01-01

    The Advanced Photon Source (APS) particle accumulator ring (PAR) is a 325-MeV storage ring that collects and compresses linac pulse trains into a single bunch for booster injection. A vertical beam instability has been observed when only a single linac bunch is injected and the total beam charge is from 0.15 to 0.7 nC. The instability starts about 80 ms after the injection, lasts about 160 ms, and is highly reproducible. We performed spectral measurement and time-resolved imaging with both a gated-intensified camera and a streak camera in order to characterize this instability. Initial analysis of the data indicates that the instability is due to ion trapping. A stable lattice was established as result of the investigation. This report summarizes the experimental results and gives some preliminary analysis.

  19. MR imaging during arterial-portography (MR-AP) in the detection of hepatic tumor. Comparison with CT-AP

    International Nuclear Information System (INIS)

    Kajiya, Yoshiki; Nakajo, Masayuki; Miyazono, Nobuaki; Kajiya, Yoriko; Fujiyoshi, Fumito; Ichinari, Naohide

    1997-01-01

    This study was undertaken to compare the detection rate of hepatic space occupying lesion (SOLs) between computed tomography during arterial portography (CT-AP) and magnetic resonance imaging during arterial portography (MR-AP) and the differences in time intensity curve on MR-AP between HCC, metastatic tumor, FNH, and hemangioma. We performed CT-AP and MR-AP in 17 patients including 14 cases of HCC and one each of metastasis, FNH, and hemangioma. MR-AP was performed by Turbo-FLASH sequence. There was no statistically significant difference between CT-AP and MR-AP in detecting satellite lesions in terms of smallest diameter and number of flow defects (p>0.05). Hemangioma showed rapid enhancement after the first pass and, consequently, the same enhancement as the hepatic parenchyma. MR-AP was comparable to CT-AP in the detection of hepatic SOLs. Hemangioma showed an enhancement pattern different from those of HCC, metastatic tumor, and FNH, which showed patterns similar to each other. (author)

  20. Clinical manifestations of antiphospholipid syndrome (APS) with and without antiphospholipid antibodies (the so-called 'seronegative APS').

    Science.gov (United States)

    Rodriguez-Garcia, Jose Luis; Bertolaccini, Maria Laura; Cuadrado, Maria Jose; Sanna, Giovanni; Ateka-Barrutia, Oier; Khamashta, Munther A

    2012-02-01

    Although the medical literature currently provides a growing number of isolated case reports of patients with clinically well-defined antiphospholipid syndrome (APS) and persistently negative antiphospholipid antibodies (aPL), there are no studies including a series of patients addressing the clinical features of this condition. The authors assessed clinical manifestations of APS in 154 patients: 87 patients with seropositive APS and 67 patients with thrombosis and/or pregnancy morbidity persistently negative for aPL and presenting with at least two additional non-criteria manifestations of APS (the so-called 'seronegative APS', SN-APS). Patients were interviewed at the time of recruitment, and a retrospective file review was carried out. There were no significant differences in the frequency of thrombotic events or obstetric morbidity in patients with SN-APS versus patients with seropositive APS: deep vein thrombosis (31.4% vs 31.0%), pulmonary embolism (23.8% vs 28.7%), stroke (14.9% vs 17.2%), transient ischaemic attack (11.9% vs 10.3%), early spontaneous abortions (67.1% vs 52.1%), stillbirths (62.5% vs 59.4%), prematurity (28.1% vs 21.7%) or pre-eclampsia (28.1% vs 23.1%). Classic and SN-APS patients show similar clinical profiles. The results suggest that clinical management in patients with APS should not be based only on the presence of conventional aPL.

  1. Radiation characteristics of scintillator coupled CMOS APS for radiography conditions

    International Nuclear Information System (INIS)

    Kim, Kwang Hyun; Kim, Soongpyung; Kang, Dong-Won; Kim, Dong-Kie

    2006-01-01

    Under industrial radiography conditions, we analyzed short-term radiation characteristics of scintillator coupled CMOS APS (hereinafter SC CMOS APS). By means of experimentation, the contribution of the transmitted X-ray through the scintillator to the properties of the CMOS APS and the afterimage, generated in the acquired image even at low dose condition, were investigated. To see the transmitted X-ray effects on the CMOS APS, Fein focus TM X-ray machine, two scintillators of Lanex TM Fine and Regular, and two CMOS APS array of RadEye TM were used under the conditions of 50 kV p /1 mAs and 100 kV p /1 mAs. By measuring the transmitted X-ray on signal and Noise Power Spectrum, we analytically examined the generation mechanism of the afterimage, based on dark signal or dark current increase in the sensor, and explained the afterimage in the SC CMOS APS

  2. The speech signal segmentation algorithm using pitch synchronous analysis

    Directory of Open Access Journals (Sweden)

    Amirgaliyev Yedilkhan

    2017-03-01

    Full Text Available Parameterization of the speech signal using the algorithms of analysis synchronized with the pitch frequency is discussed. Speech parameterization is performed by the average number of zero transitions function and the signal energy function. Parameterization results are used to segment the speech signal and to isolate the segments with stable spectral characteristics. Segmentation results can be used to generate a digital voice pattern of a person or be applied in the automatic speech recognition. Stages needed for continuous speech segmentation are described.

  3. Fuzzy maintenance costs of a wind turbine pitch control device

    Directory of Open Access Journals (Sweden)

    Mariana Carvalho

    2015-07-01

    Full Text Available This paper deals with the problem of estimation maintenance costs for the case of the pitch controls system of wind farms turbines. Previous investigations have estimated these costs as (traditional “crisp” values, simply ignoring the uncertainty nature of data and information available. This paper purposes an extended version of the estimation model by making use of the Fuzzy Set Theory. The results alert decision-makers to consequent uncertainty of the estimations along with their overall level, thus improving the information given to the mainte-nance support system.

  4. Automatic cortical representation of auditory pitch changes in Rett syndrome.

    Science.gov (United States)

    Foxe, John J; Burke, Kelly M; Andrade, Gizely N; Djukic, Aleksandra; Frey, Hans-Peter; Molholm, Sophie

    2016-01-01

    Over the typical course of Rett syndrome, initial language and communication abilities deteriorate dramatically between the ages of 1 and 4 years, and a majority of these children go on to lose all oral communication abilities. It becomes extremely difficult for clinicians and caretakers to accurately assess the level of preserved auditory functioning in these children, an issue of obvious clinical import. Non-invasive electrophysiological techniques allow for the interrogation of auditory cortical processing without the need for overt behavioral responses. In particular, the mismatch negativity (MMN) component of the auditory evoked potential (AEP) provides an excellent and robust dependent measure of change detection and auditory sensory memory. Here, we asked whether females with Rett syndrome would produce the MMN to occasional changes in pitch in a regularly occurring stream of auditory tones. Fourteen girls with genetically confirmed Rett syndrome and 22 age-matched neurotypical controls participated (ages 3.9-21.1 years). High-density electrophysiological recordings from 64 scalp electrodes were made while participants passively listened to a regularly occurring stream of 503-Hz auditory tone pips that was occasionally (15 % of presentations) interrupted by a higher-pitched deviant tone of 996 Hz. The MMN was derived by subtracting the AEP to these deviants from the AEP produced to the standard. Despite clearly anomalous morphology and latency of the AEP to simple pure-tone inputs in Rett syndrome, the MMN response was evident in both neurotypicals and Rett patients. However, we found that the pitch-evoked MMN was both delayed and protracted in duration in Rett, pointing to slowing of auditory responsiveness. The presence of the MMN in Rett patients suggests preserved abilities to process pitch changes in auditory sensory memory. This work represents a beginning step in an effort to comprehensively map the extent of auditory cortical functioning in Rett

  5. Unsteady Surface Pressure Measurements on a Pitching Airfoil

    Science.gov (United States)

    1985-03-12

    through 8 Dynamics 7512B amplifiers. The pitching motions of the airfoil were generated by 6°jN\\! 920O/_ a PDP 11/03 computer controlling a Control...acquisition system. The pressure data were used to calculate pressure 2 coefficients which were in turn integrated to compute lift coefficients. Both...Airfoils," AIAA J., Vol. 13, No. 1, 17. Gormont, R.E., "A Mathenatical Model pp 71-79, Jan 1975. of Unsteady Aerodynamics and Radial 4. McAlister, K.W

  6. Crackle and fizz essential communication and pitching skills for scientists

    CERN Document Server

    Van den Brul, Caroline

    2014-01-01

    This is a book for scientists and other experts who need to explain the significance and potential of their work to colleagues, committees, funding bodies or the general public. It details how to harness story-telling principles to make complex or technical content easier to communicate and fulfilling for audiences. Eight narrative ingredients, Audience, Change and Affect, Lure, World, Character, Big Hook, Plot and Structure, are illustrated with examples and exercises to demonstrate how to build a presentation, how to pitch for funds or resources, how to make a persuasive argument, or simply how to explain ideas so they CRACKLE and FIZZ for the Audience.

  7. Binaural pitch perception in hearing-impaired listeners

    DEFF Research Database (Denmark)

    Dau, Torsten; Santurette, Sébastien; Strelcyk, Olaf

    2007-01-01

    When two white noises differing only in phase in a particular frequency range are presented simultaneously each to one of our ears, a pitch sensation may be perceived inside the head. This phenomenon, called ’binaural pitch’ or ’dichotic pitch’, can be produced by frequency-dependent interaural...... phasedifference patterns. The evaluation of these interaural phase differences depends on the functionality of the binaural auditory system and the spectro-temporal information at its input. A melody recognition task was performed in the present study using pure-tone stimuli and six different types of noises...

  8. Auricular Chondritis in a Postpartum Flare of SLE and APS

    Directory of Open Access Journals (Sweden)

    Elodie Ponce

    2014-10-01

    Full Text Available Introduction: Auricular chondritis has been occasionally described in patients with systemic lupus erythematosus (SLE and antiphospholipid syndrome (APS. Materials and methods: We report the case of a woman with a previous history of APS who presented with auricular chondritis with onset of SLE symptoms during the postpartum period. Conclusion: SLE and APS should be taken into consideration in the differential diagnosis of auricular chondritis.

  9. Essence and characteristics of the Westinghouse technology AP1000

    International Nuclear Information System (INIS)

    Llovet, Ricardo

    2014-01-01

    The AP1000 nuclear power plant can place the reactor in a Safe Shutdown Condition within the first 72 hours of a Station Blackout, without the use of AC power or operator action •With some operator action after 3 days, the AP1000 nuclear power plant continues to maintain reactor core cooling and Spent Fuel Pool cooling indefinitely •The AP1000 nuclear power plant has superior coping capabilities as well as significantly reduced risk for core damage

  10. FRANX. Application for analysis and quantification of the APS fire

    International Nuclear Information System (INIS)

    Snchez, A.; Osorio, F.; Ontoso, N.

    2014-01-01

    The FRANX application has been developed by EPRI within the Risk and Reliability User Group in order to facilitate the process of quantification and updating APS Fire (also covers floods and earthquakes). By applying fire scenarios are quantified in the central integrating the tasks performed during the APS fire. This paper describes the main features of the program to allow quantification of an APS Fire. (Author)

  11. Development of a Mechanical Passive Pitch System for a 500W Horizontal Axis Wind Turbine

    DEFF Research Database (Denmark)

    Poryzala, Tomek; Mikkelsen, Robert Flemming; Kim, Taeseong

    2017-01-01

    The goal of this paper is to design, analyze, manufacture, and test a mechanical passive pitch mechanism for a small horizontal axis wind turbine. Several pitching concepts were investigated in the wind industry and related fields before ultimately deciding on a centrifugal governor design concept...... in a pitch-to-stall configuration. Inertial and aerodynamic models were developed in order to predict steady-state performance and an optimization routine was created to optimize the pitch mechanism configuration subject to manufacturing constraints. Dynamic modeling in HAWC2 validated the steady......-state design code, aeroelastic simulations were performed in turbulent wind conditions to simulate the pitch system dynamics. Physical testing of the full turbine was not completed, however the hub sub-assembly was tested on its own to validate the passive pitch characteristics and showed good agreement...

  12. Relating the absence of binaural pitch percept to retro-cochlear impairment

    DEFF Research Database (Denmark)

    Santurette, Sébastien; Dau, Torsten

    that the salience of binaural pitch was affected by hearing impairment. Specifically, for subjects with a sensorineural impairment, binaural pitch perception was weaker than the normal-hearing average but the pitch sensation was immediately present. In contrast, no binaural pitch sensation at all was found...... for the (only) two subjects with damage at central stages. The aim of the present study is to clarify whether such a sharp distinction between levels of impairment can be made using binaural pitch stimuli. A pitch detection test was performed by three groups of subjects with: 1) normal hearing; 2) a cochlear...... be an interesting indicator of retro-cochlear deficit and useful for characterising the auditory profile of individual hearing-impaired listeners....

  13. Congenital amusics use a secondary pitch mechanism to identify lexical tones.

    Science.gov (United States)

    Bones, Oliver; Wong, Patrick C M

    2017-09-01

    Amusia is a pitch perception disorder associated with deficits in processing and production of both musical and lexical tones, which previous reports have suggested may be constrained to fine-grained pitch judgements. In the present study speakers of tone-languages, in which lexical tones are used to convey meaning, identified words present in chimera stimuli containing conflicting pitch-cues in the temporal fine-structure and temporal envelope, and which therefore conveyed two distinct utterances. Amusics were found to be more likely than controls to judge the word according to the envelope pitch-cues. This demonstrates that amusia is not associated with fine-grained pitch judgements alone, and is consistent with there being two distinct pitch mechanisms and with amusics having an atypical reliance on a secondary mechanism based upon envelope cues. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  14. AP-2ε Expression in Developing Retina: Contributing to the Molecular Diversity of Amacrine Cells.

    Science.gov (United States)

    Jain, Saket; Glubrecht, Darryl D; Germain, Devon R; Moser, Markus; Godbout, Roseline

    2018-02-21

    AP-2 transcription factors play important roles in the regulation of gene expression during development. Four of the five members of the AP-2 family (AP-2α, AP-2β, AP-2γ and AP-2δ) have previously been shown to be expressed in developing retina. Mouse knockouts have revealed roles for AP-2α, AP-2β and AP-2δ in retinal cell specification and function. Here, we show that the fifth member of the AP-2 family, AP-2ε, is also expressed in amacrine cells in developing mammalian and chicken retina. Our data indicate that there are considerably fewer AP-2ε-positive cells in the developing mouse retina compared to AP-2α, AP-2β and AP-2γ-positive cells, suggesting a specialized role for AP-2ε in a subset of amacrine cells. AP-2ε, which is restricted to the GABAergic amacrine lineage, is most commonly co-expressed with AP-2α and AP-2β, especially at early stages of retinal development. Co-expression of AP-2ε and AP-2γ increases with differentiation. Analysis of previously published Drop-seq data from single retinal cells supports co-expression of multiple AP-2s in the same cell. Since AP-2s bind to their target sequences as either homodimers or heterodimers, our work suggests spatially- and temporally-coordinated roles for combinations of AP-2 transcription factors in amacrine cells during retinal development.

  15. Absolute chronology and stratigraphy of Lepenski Vir

    Directory of Open Access Journals (Sweden)

    Borić Dušan

    2007-01-01

    Full Text Available In the last decade, a number of specialist analyses were made on the material from old excavations of Mesolithic-Neolithic sites in the Danube Gorges. These new results altered significantly our understanding of the Lepenski Vir culture. The question of chronology of this regional phenomenon has been acute since the discovery of Lepenski Vir in the 1960s, and it remains of key importance for understanding the character of Mesolithic-Neolithic transformations in this and the neighbouring regions. The most heated debate was fuelled by the initial stratigraphic and chronological attribution of the type-site itself. There remained the question about the adequate dating of the most prominent phase at this site characterized by buildings with trapezoidal bases covered with limestone floors and with rectangular stone-lined hearths placed in the centre of these features. There have been suggestions that these features also contain Early Neolithic Starčevo type pottery and other similar items of material culture and should thus be dated to the Early Neolithic historical context. Moreover, the first series of conventional radiocarbon determinations (21 dates also suggested that the absolute chronology of these features should be confined to the period from around 6400-5500 cal BC (Fig. 1. Due to the importance of defining more precisely the chronology for the start of construction of these particular features at Lepenski Vir and for establishing the life-span of these buildings and their associated material culture, we have AMS (Accelerator Mass Spectrometry dated a number of contexts from this site. The results are presented in this paper. The project was made possible through the Oxford Radiocarbon Accelerate Dating Service (ORADS programme funded by the Arts and Humanities Research Council (AHRC and the Natural Environment Research Council (NERC of the Great Britain. Apart from those dates presented in this paper, there are 29 previously published

  16. ONLINE MINIMIZATION OF VERTICAL BEAM SIZES AT APS

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yipeng

    2017-06-25

    In this paper, online minimization of vertical beam sizes along the APS (Advanced Photon Source) storage ring is presented. A genetic algorithm (GA) was developed and employed for the online optimization in the APS storage ring. A total of 59 families of skew quadrupole magnets were employed as knobs to adjust the coupling and the vertical dispersion in the APS storage ring. Starting from initially zero current skew quadrupoles, small vertical beam sizes along the APS storage ring were achieved in a short optimization time of one hour. The optimization results from this method are briefly compared with the one from LOCO (Linear Optics from Closed Orbits) response matrix correction.

  17. The Ped-APS Registry: the antiphospholipid syndrome in childhood.

    Science.gov (United States)

    Avcin, T; Cimaz, R; Rozman, B

    2009-09-01

    In recent years, antiphospholipid syndrome (APS) has been increasingly recognised in various paediatric autoimmune and nonautoimmune diseases, but the relatively low prevalence and heterogeneity of APS in childhood made it very difficult to study in a systematic way. The project of an international registry of paediatric patients with APS (the Ped-APS Registry) was initiated in 2004 to foster and conduct multicentre, controlled studies with large number of paediatric APS patients. The Ped-APS Registry is organised as a collaborative project of the European Forum on Antiphospholipid Antibodies and Juvenile Systemic Lupus Erythematosus Working Group of the Paediatric Rheumatology European Society. Currently, it documents a standardised clinical, laboratory and therapeutic data of 133 children with antiphospholipid antibodies (aPL)-related thrombosis from 14 countries. The priority projects for future research of the Ped-APS Registry include prospective enrollment of new patients with aPL-related thrombosis, assessment of differences between the paediatric and adult APS, evaluation of proinflammatory genotype as a risk factor for APS manifestations in childhood and evaluation of patients with isolated nonthrombotic aPL-related manifestations.

  18. Addendum: ``Hard X-Rays and Gamma Rays from Type Ia Supernovae'' (ApJ, 492, 228 [1998])

    Science.gov (United States)

    Höflich, Peter; Wheeler, J. C.

    2004-04-01

    We report a subtle error in the normalization of the absolute flux published in our original article (hereafter HWK98), and some minor updates. The normalization problem is related to the post-processing. As a consequence, the reported line fluxes are too large at early times. Note that Figure 1 of P. Höflich (ApJ, 492, 228 [1998]) has been transferred from HWK98. Results of previous papers are not affected (E. Müller, P. Höflich, A. M. Khokhlov, & E. Müller, ApJ, 492, 228 [1998]; P. Höflich, A. M. Khokhlov, & E. Müller, ApJ, 492, 228 [1998]). For calculating the γ-ray spectra, the γ-ray transport is solved via a Monte Carlo code that produces an output file containing the Eddington flux, the energy input by radioactive decay and escape probability, ζ, of γ-ray photons. In a postprocessing step, the spectrum is renormalized and convolved with the instrumental response function of the γ-ray telescope. A two-step procedure is used to obtain the emergent spectra to separate the CPU-intensive Monte Carlo transport calculation from the ``fast'' second step, allowing us to study the influence of the instrument on the observables (e.g., E. Müller, P. Höflich, A. M. Khokhlov, & E. Müller, ApJ, 492, 228 [1998

  19. Voltage harmonic variation in three-phase induction motors with different coil pitches

    International Nuclear Information System (INIS)

    Deshmukh, Ram; Moses, Anthony John; Anayi, Fatih

    2006-01-01

    A pulse-width modulation (PWM) inverter feeding four different chorded three-phase induction motors was tested for low-order odd harmonic voltage component and efficiency at different loads. Total harmonic distortion (THD) due to 3rd, 5th and 9th harmonics was less in a motor with 160 o coil pitch. Particular harmonic order for each coil pitch was suppressed and the efficiency of a 120 o coil pitch motor was increased by 7.5%

  20. THE BEHAVIOR OF THE PITCH ANGLE OF SPIRAL ARMS DEPENDING ON OPTICAL WAVELENGTH

    Energy Technology Data Exchange (ETDEWEB)

    Martínez-García, Eric E.; Puerari, Ivânio; Rosales-Ortega, F. F.; Luna, A. [Instituto Nacional de Astrofísica, Óptica y Electrónica (INAOE), Aptdo. Postal 51 y 216, 72000 Puebla, Pue. (Mexico); González-Lópezlira, Rosa A. [Centro de Radioastronomía y Astrofísica, UNAM, Campus Morelia, Michoacán, México, C.P. 58089 (Mexico); Fuentes-Carrera, Isaura, E-mail: ericmartinez@inaoep.mx [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, U. P. Adolfo López Mateos, Zacatenco, 07730 México, D.F. (Mexico)

    2014-09-20

    Based on integral field spectroscopy data from the CALIFA survey, we investigate the possible dependence of spiral arm pitch angle with optical wavelength. For three of the five studied objects, the pitch angle gradually increases at longer wavelengths. This is not the case for two objects where the pitch angle remains constant. This result is confirmed by the analysis of SDSS data. We discuss the possible physical mechanisms to explain this phenomenon, as well as the implications of the results.

  1. Ball Speed and Release Consistency Predict Pitching Success in Major League Baseball.

    Science.gov (United States)

    Whiteside, David; Martini, Douglas N; Zernicke, Ronald F; Goulet, Grant C

    2016-07-01

    Whiteside, D, Martini, DN, Zernicke, RF, and Goulet, GC. Ball speed and release consistency predict pitching success in Major League Baseball. J Strength Cond Res XX(X): 000-000, 2015-This study aimed to quantify how ball flight kinematics (i.e., ball speed and movement), release location, and variations therein relate to pitching success in Major League Baseball (MLB). One hundred ninety starting MLB pitchers met the inclusion criteria for this study. Ball trajectory information was collected for 76,000 pitches and inserted into a forward stepwise multiple regression model, which examined how (a) pitch selection, (b) ball speed, (c) ball movement (horizontal and lateral), (d) release location (horizontal and lateral), (e) variation in pitch speed, (f) variation in ball movement, and (g) variation in release location related to pitching success (as measured by fielding independent pitching-FIP). Pitch speed, release location variability, variation in pitch speed, and horizontal release location were significant predictors of FIP and, collectively, accounted for 24% of the variance in FIP. These findings suggest that (a) maximizing ball speed, (b) refining a consistent spatial release location, and (c) using varied pitch speeds should be primary foci for the pitching coach. However, between-pitcher variations underline how training interventions should be administered at the individual level, with consideration given to the pitcher's injury history. Finally, despite offering significant predictors of success, these three factors explained only 22% of the variance in FIP and should not be considered the only, or preeminent, indicators of a pitcher's effectiveness. Evidently, traditional pitching metrics only partly account for a pitcher's effectiveness, and future research is necessary to uncover the remaining contributors to success.

  2. Study on the structure of pitch-polymer compositions by fluorescence microscope

    OpenAIRE

    Makomaski, Grzegorz

    2014-01-01

    In this work, the results of studies on the evaluation of colloidal structure of coal-tar pitch compositions with selected waste polymers by fluorescence microscope. For pitch-polymer compositions containing 10?50?wt% waste polymer, softening point, coking value and content of components insoluble in toluene and quinoline were carried out. The results indicate that pitch-polymer compositions can be treated as microheterogeneous systems, colloidal and biphase, generally exhibiting uniform disp...

  3. Low vocal pitch preference drives first impressions of trustworthiness and dominance in non- contextual scenarios

    OpenAIRE

    Tsantani, Maria,; Belin, Pascal; Mcaleer, Phil,

    2016-01-01

    International audience; Vocal pitch has been found to influence judgments of perceived trustworthiness and dominance from a novel voice. However, the majority of findings arise from using only male voices and in context-specific scenarios. In two experiments, we first explore the influence of average vocal pitch on first-impression judgments of perceived trustworthiness and dominance, before establishing the existence of an overall preference for high or low pitch across genders. In Experimen...

  4. Pitch perception and production in congenital amusia: Evidence from Cantonese speakers

    OpenAIRE

    Liu, Fang; Chan, Alice H. D.; Ciocca, Valter; Roquet, Catherine; Peretz, Isabelle; Wong, Patrick C. M.

    2016-01-01

    This study investigated pitch perception and production in speech and music in individuals with congenital amusia (a disorder of musical pitch processing) who are native speakers of Cantonese, a tone language with a highly complex tonal system. Sixteen Cantonese-speaking congenital amusics and 16 controls performed a set of lexical tone perception, production, singing, and psychophysical pitch threshold tasks. Their tone production accuracy and singing proficiency were subsequently judged by ...

  5. Congenital Amusia (or Tone-Deafness) Interferes with Pitch Processing in Tone Languages

    OpenAIRE

    Tillmann, Barbara; Burnham, Denis; Nguyen, Sebastien; Grimault, Nicolas; Gosselin, Nathalie; Peretz, Isabelle

    2011-01-01

    Congenital amusia is a neurogenetic disorder that affects music processing and that is ascribed to a deficit in pitch processing. We investigated whether this deficit extended to pitch processing in speech, notably the pitch changes used to contrast lexical tones in tonal languages. Congenital amusics and matched controls, all non-tonal language speakers, were tested for lexical tone discrimination in Mandarin Chinese (Experiment 1) and in Thai (Experiment 2). Tones were presented in pairs an...

  6. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  7. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP13Q.Seq.d/ Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP

  8. Does Absolute Synonymy exist in Owere-Igbo? | Omego | AFRREV ...

    African Journals Online (AJOL)

    Among Igbo linguistic researchers, determining whether absolute synonymy exists in Owere–Igbo, a dialect of the Igbo language predominantly spoken by the people of Owerri, Imo State, Nigeria, has become a thorny issue. While some linguistic scholars strive to establish that absolute synonymy exists in the lexical ...

  9. Determination of Absolute Zero Using a Computer-Based Laboratory

    Science.gov (United States)

    Amrani, D.

    2007-01-01

    We present a simple computer-based laboratory experiment for evaluating absolute zero in degrees Celsius, which can be performed in college and undergraduate physical sciences laboratory courses. With a computer, absolute zero apparatus can help demonstrators or students to observe the relationship between temperature and pressure and use…

  10. Children’s identification of familiar songs from pitch and timing cues

    Directory of Open Access Journals (Sweden)

    Anna eVolkova

    2014-08-01

    Full Text Available The goal of the present study was to ascertain whether children with normal hearing and prelingually deaf children with cochlear implants could use pitch or timing cues alone or in combination to identify familiar songs. Children 4-7 years of age were required to identify the theme songs of familiar TV shows in a simple task with excerpts that preserved (1 the relative pitch and timing cues of the melody but not the original instrumentation, (2 the timing cues only (rhythm, meter, and tempo, and (3 the relative pitch cues only (pitch contour and intervals. Children with normal hearing performed at high levels and comparably across the three conditions. The performance of child implant users was well above chance levels when both pitch and timing cues were available, marginally above chance with timing cues only, and at chance with pitch cues only. This is the first demonstration that children can identify familiar songs from monotonic versions—timing cues but no pitch cues—and from isochronous versions—pitch cues but no timing cues. The study also indicates that, in the context of a very simple task, young implant users readily identify songs from melodic versions that preserve pitch and timing cues.

  11. arXiv Signal coupling to embedded pitch adapters in silicon sensors

    CERN Document Server

    Artuso, M.; Bezshyiko, I.; Blusk, S.; Bruendler, R.; Bugiel, S.; Dasgupta, R.; Dendek, A.; Dey, B.; Ely, S.; Lionetto, F.; Petruzzo, M.; Polyakov, I.; Rudolph, M.; Schindler, H.; Steinkamp, O.; Stone, S.

    2018-01-01

    We have examined the effects of embedded pitch adapters on signal formation in n-substrate silicon microstrip sensors with data from beam tests and simulation. According to simulation, the presence of the pitch adapter metal layer changes the electric field inside the sensor, resulting in slowed signal formation on the nearby strips and a pick-up effect on the pitch adapter. This can result in an inefficiency to detect particles passing through the pitch adapter region. All these effects have been observed in the beam test data.

  12. Visuoauditory mappings between high luminance and high pitch are shared by chimpanzees (Pan troglodytes) and humans

    Science.gov (United States)

    Ludwig, Vera U.; Adachi, Ikuma; Matsuzawa, Tetsuro

    2011-01-01

    Humans share implicit preferences for certain cross-sensory combinations; for example, they consistently associate higher-pitched sounds with lighter colors, smaller size, and spikier shapes. In the condition of synesthesia, people may experience such cross-modal correspondences to a perceptual degree (e.g., literally seeing sounds). So far, no study has addressed the question whether nonhuman animals share cross-modal correspondences as well. To establish the evolutionary origins of cross-modal mappings, we tested whether chimpanzees (Pan troglodytes) also associate higher pitch with higher luminance. Thirty-three humans and six chimpanzees were required to classify black and white squares according to their color while hearing irrelevant background sounds that were either high-pitched or low-pitched. Both species performed better when the background sound was congruent (high-pitched for white, low-pitched for black) than when it was incongruent (low-pitched for white, high-pitched for black). An inherent tendency to pair high pitch with high luminance hence evolved before the human lineage split from that of chimpanzees. Rather than being a culturally learned or a linguistic phenomenon, this mapping constitutes a basic feature of the primate sensory system. PMID:22143791

  13. Toward a quantitative account of pitch distribution in spontaneous narrative: method and validation.

    Science.gov (United States)

    Matteson, Samuel E; Olness, Gloria Streit; Caplow, Nancy J

    2013-05-01

    Pitch is well-known both to animate human discourse and to convey meaning in communication. The study of the statistical population distributions of pitch in discourse will undoubtedly benefit from methodological improvements. The current investigation examines a method that parameterizes pitch in discourse as musical pitch interval H measured in units of cents and that disaggregates the sequence of peak word-pitches using tools employed in time-series analysis and digital signal processing. The investigators test the proposed methodology by its application to distributions in pitch interval of the peak word-pitch (collectively called the discourse gamut) that occur in simulated and actual spontaneous emotive narratives obtained from 17 middle-aged African-American adults. The analysis, in rigorous tests, not only faithfully reproduced simulated distributions imbedded in realistic time series that drift and include pitch breaks, but the protocol also reveals that the empirical distributions exhibit a common hidden structure when normalized to a slowly varying mode (called the gamut root) of their respective probability density functions. Quantitative differences between narratives reveal the speakers' relative propensity for the use of pitch levels corresponding to elevated degrees of a discourse gamut (the "e-la") superimposed upon a continuum that conforms systematically to an asymmetric Laplace distribution.

  14. Musicians demonstrate experience-dependent brainstem enhancement of musical scale features within continuously gliding pitch.

    Science.gov (United States)

    Bidelman, Gavin M; Gandour, Jackson T; Krishnan, Ananthanarayan

    2011-10-10

    In contrast to language, where pitch patterns consist of continuous and curvilinear contours, musical pitch consists of relatively discrete, stair-stepped sequences of notes. Behavioral and neurophysiological studies suggest that both tone-language and music experience enhance the representation of pitch cues associated with a listener's domain of expertise, e.g., curvilinear pitch in language, discrete scale steps in music. We compared brainstem frequency-following responses (FFRs) of English-speaking musicians (musical pitch experience) and native speakers of Mandarin Chinese (linguistic pitch experience) elicited by rising and falling tonal sweeps that are exemplary of Mandarin tonal contours but uncharacteristic of the pitch patterns typically found in music. In spite of musicians' unfamiliarity with such glides, we find that their brainstem FFRs show enhancement of the stimulus where the curvilinear sweep traverses discrete notes along the diatonic musical scale. This enhancement was note specific in that it was not observed immediately preceding or following the scale tone of interest (passing note). No such enhancements were observed in Chinese listeners. These findings suggest that the musician's brainstem may be differentially tuned by long-term exposure to the pitch patterns inherent to music, extracting pitch in relation to a fixed, hierarchical scale. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  15. Heroes and Villains: The Relationship between Pitch Tessitura and Sociability of Operatic Characters

    Directory of Open Access Journals (Sweden)

    Daniel Shanahan

    2015-01-01

    Full Text Available Research in speech prosody and ethology suggests that pitch height indexes positive and negative social affects, in the sense that higher pitched voices are used to convey friendliness, whereas lower pitched voices are used to convey aggression (Bolinger, 1964. Research concerning animal calls suggests that this association generalizes to many species. In a study of the calls for 56 species, Morton (1977, 1994 proposed a sound-size model in which large size (and low pitch is associated with aggression, whereas small size (and high pitch is associated with friendliness, fear, or appeasement. We examine whether this association can be observed in music. Specifically, the results of three studies are reported in which the pitch-height of various voices is related to estimates of the sociability of the corresponding operatic characters. Results indeed indicate an association between lower-pitched voices and less sociable characters, in contrast to higher-pitched voices being associated with more sociable characters. In addition, older male characters tend to exhibit lower-pitched voices, consistent with known physiological changes (Linville, 2004; Reubold, Harrington & Kleber, 2010.

  16. Anodal transcranial direct current stimulation over the supramarginal gyrus facilitates pitch memory.

    Science.gov (United States)

    Schaal, Nora K; Williamson, Victoria J; Banissy, Michael J

    2013-11-01

    Functional neuroimaging studies have shown activation of the supramarginal gyrus during pitch memory tasks. A previous transcranial direct current stimulation study using cathodal stimulation over the left supramarginal gyrus reported a detrimental effect on short-term pitch memory performance, indicating an important role of the supramarginal gyrus in pitch memory. The current study aimed to determine whether pitch memory could be improved following anodal stimulation of the left supramarginal gyrus. The performances of non-musicians on two pitch memory tasks (pitch recognition and recall) and a visual memory control task following anodal or sham transcranial direct current stimulation were compared. The results show that, post-stimulation, the anodal group but not the control group performed significantly better on both pitch memory tasks; performance did not differ on the face memory task. These findings provide strong support for the causal involvement of the left supramarginal gyrus in the pitch memory process, and highlight the potential efficacy of transcranial direct current stimulation as a tool to improve pitch memory. © 2013 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

  17. Voice pitch alters mate-choice-relevant perception in hunter-gatherers.

    Science.gov (United States)

    Apicella, Coren L; Feinberg, David R

    2009-03-22

    In humans, voice pitch is thought to be a cue of underlying quality and an important criterion for mate choice, but data from non-Western cultures have not been provided. Here we test attributions to and preferences for voices with raised and lowered pitch in hunter-gatherers. Using a forced-choice playback experiment, we found that both men and women viewed lower pitched voices in the opposite sex as being better at acquiring resources (e.g. hunting and gathering). While men preferred higher pitched women's voices as marriage partners, women showed no overall preference for voice pitch in men. However, women who were currently breastfeeding had stronger preferences for higher pitched male voices whereas women not currently breastfeeding preferred lower pitched voices. As testosterone is considered a costly signal associated with dominance, heritable immunity to infection and low paternal investment, women's preferences potentially reflect a trade-off between securing good genes and paternal investment. Men's preferences for higher pitched female voices are probably due to an evolved preference for markers of fecundity, reflected in voice pitch.

  18. From amusic to musical?--Improving pitch memory in congenital amusia with transcranial alternating current stimulation.

    Science.gov (United States)

    Schaal, Nora K; Pfeifer, Jasmin; Krause, Vanessa; Pollok, Bettina

    2015-11-01

    Brain imaging studies highlighted structural differences in congenital amusia, a life-long perceptual disorder that is associated with pitch perception and pitch memory deficits. A functional anomaly characterized by decreased low gamma oscillations (30-40 Hz range) in the right dorsolateral prefrontal cortex (DLPFC) during pitch memory has been revealed recently. Thus, the present study investigates whether applying transcranial alternating current stimulation (tACS) at 35 Hz to the right DLPFC would improve pitch memory. Nine amusics took part in two tACS sessions (either 35 Hz or 90 Hz) and completed a pitch and visual memory task before and during stimulation. 35 Hz stimulation facilitated pitch memory significantly. No modulation effects were found with 90 Hz stimulation or on the visual task. While amusics showed a selective impairment of pitch memory before stimulation, the performance during 35 Hz stimulation was not significantly different to healthy controls anymore. Taken together, the study shows that modulating the right DLPFC with 35 Hz tACS in congenital amusia selectively improves pitch memory performance supporting the hypothesis that decreased gamma oscillations within the DLPFC are causally involved in disturbed pitch memory and highlight the potential use of tACS to interact with cognitive processes. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. Pitch perception and production in congenital amusia: Evidence from Cantonese speakers.

    Science.gov (United States)

    Liu, Fang; Chan, Alice H D; Ciocca, Valter; Roquet, Catherine; Peretz, Isabelle; Wong, Patrick C M

    2016-07-01

    This study investigated pitch perception and production in speech and music in individuals with congenital amusia (a disorder of musical pitch processing) who are native speakers of Cantonese, a tone language with a highly complex tonal system. Sixteen Cantonese-speaking congenital amusics and 16 controls performed a set of lexical tone perception, production, singing, and psychophysical pitch threshold tasks. Their tone production accuracy and singing proficiency were subsequently judged by independent listeners, and subjected to acoustic analyses. Relative to controls, amusics showed impaired discrimination of lexical tones in both speech and non-speech conditions. They also received lower ratings for singing proficiency, producing larger pitch interval deviations and making more pitch interval errors compared to controls. Demonstrating higher pitch direction identification thresholds than controls for both speech syllables and piano tones, amusics nevertheless produced native lexical tones with comparable pitch trajectories and intelligibility as controls. Significant correlations were found between pitch threshold and lexical tone perception, music perception and production, but not between lexical tone perception and production for amusics. These findings provide further evidence that congenital amusia is a domain-general language-independent pitch-processing deficit that is associated with severely impaired music perception and production, mildly impaired speech perception, and largely intact speech production.

  20. Effects of Music and Tonal Language Experience on Relative Pitch Performance.

    Science.gov (United States)

    Ngo, Mary Kim; Vu, Kim-Phuong L; Strybel, Thomas Z

    2016-01-01

    We examined the interaction between music and tone language experience as related to relative pitch processing by having participants judge the direction and magnitude of pitch changes in a relative pitch task. Participants' performance on this relative pitch task was assessed using the Cochran-Weiss-Shanteau (CWS) index of expertise, based on a ratio of discrimination over consistency in participants' relative pitch judgments. Testing took place in 2 separate sessions on different days to assess the effects of practice on participants' performance. Participants also completed the Montreal Battery of Evaluation of Amusia (MBEA), an existing measure comprising subtests aimed at evaluating relative pitch processing abilities. Musicians outperformed nonmusicians on both the relative pitch task, as measured by the CWS index, and the MBEA, but tonal language speakers outperformed non-tonal language speakers only on the MBEA. A closer look at the discrimination and consistency component scores of the CWS index revealed that musicians were better at discriminating different pitches and more consistent in their assessments of the direction and magnitude of relative pitch change.

  1. Determining Pitch-angle Diffusion Coefficients from Test Particle Simulations

    Science.gov (United States)

    Ivascenko, Alex; Lange, Sebastian; Spanier, Felix; Vainio, Rami

    2016-12-01

    The transport and acceleration of charged particles in turbulent media are topics of great interest in space physics and interstellar astrophysics. These processes are dominated by the scattering of particles off magnetic irregularities. The scattering process itself is usually described by small-angle scattering, with the pitch-angle coefficient {D}μ μ playing a major role. Since the diffusion coefficient {D}μ μ can be determined analytically only for the approximation of quasilinear theory, the determination of this coefficient from numerical simulations has become more important. So far these simulations have yielded particle tracks for small-scale scattering, which can then be interpreted using the running diffusion coefficients. This method has a limited range of validity. This paper presents two new methods that allow for the calculation of the pitch-angle diffusion coefficient from numerical simulations. These methods no longer analyze particle trajectories and instead examine the change of particle distribution functions. It is shown that these methods provide better resolved results and allow for the analysis of strong turbulence. The application of these methods to Monte Carlo simulations of particle scattering and hybrid MHD-particle simulations is presented. Both analysis methods are able to recover the diffusion coefficients used as input for the Monte Carlo simulations and provide better results in MHD simulations, especially for stronger turbulence.

  2. Unsteady Flow Interactions Between Pitching Wings In Schooling Arrangements

    Science.gov (United States)

    Kurt, Melike; Moored, Keith

    2017-11-01

    In nature, many fish aggregate into large groups or schools for protection against predators, for social interactions and to save energy during migrations. Regardless of their prime motivation, fish experience three-dimensional flow interactions amongst themselves that can improve or hamper swimming performance and give rise to fluid-mediated forces between individuals. To date, the unsteady, three-dimensional flow interactions among schooling fish remains relatively unexplored. In order to study these interactions, the caudal fins of two interacting fish are idealized as two finite span pitching wings arranged in mixtures of canonical in-line and side-by-side arrangements. The forces and moments acting on the wings in the streamwise and cross-stream directions are quantified as the arrangement and the phase delay between the wings is altered. Particle image velocimetry is employed to characterize the flow physics during high efficiency locomotion. Finally, the forces and flowfields of two-dimensional pitching wings are compared with three-dimensional wings to distinguish how three-dimensionality alters the flow interactions in schools of fish.

  3. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS): partial gene deletions contribute to APS I.

    Science.gov (United States)

    Bøe Wolff, A S; Oftedal, B; Johansson, S; Bruland, O; Løvås, K; Meager, A; Pedersen, C; Husebye, E S; Knappskog, P M

    2008-03-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms or copy number variations in the AIRE gene were associated with AAD and APS II. First, nine SNPs in the AIRE gene were analyzed in 311 patients with AAD and APS II and 521 healthy controls, identifying no associated risk. Second, in a subgroup of 25 of these patients, AIRE sequencing revealed three novel polymorphisms. Finally, the AIRE copy number was determined by duplex quantitative PCR in 14 patients with APS I, 161 patients with AAD and APS II and in 39 healthy subjects. In two Scandinavian APS I patients previously reported to be homozygous for common AIRE mutations, we identified large deletions of the AIRE gene covering at least exon 2 to exon 8. We conclude that polymorphisms in the AIRE gene are not associated with AAD and APS II. We further suggest that DNA analysis of the parents of patients found to be homozygous for mutations in AIRE, always should be performed.

  4. Differential recognition of pitch patterns in discrete and gliding stimuli in congenital amusia: evidence from Mandarin speakers.

    Science.gov (United States)

    Liu, Fang; Xu, Yi; Patel, Aniruddh D; Francart, Tom; Jiang, Cunmei

    2012-08-01

    This study examined whether "melodic contour deafness" (insensitivity to the direction of pitch movement) in congenital amusia is associated with specific types of pitch patterns (discrete versus gliding pitches) or stimulus types (speech syllables versus complex tones). Thresholds for identification of pitch direction were obtained using discrete or gliding pitches in the syllable /ma/ or its complex tone analog, from nineteen amusics and nineteen controls, all healthy university students with Mandarin Chinese as their native language. Amusics, unlike controls, had more difficulty recognizing pitch direction in discrete than in gliding pitches, for both speech and non-speech stimuli. Also, amusic thresholds were not significantly affected by stimulus types (speech versus non-speech), whereas controls showed lower thresholds for tones than for speech. These findings help explain why amusics have greater difficulty with discrete musical pitch perception than with speech perception, in which continuously changing pitch movements are prevalent. Copyright © 2012 Elsevier Inc. All rights reserved.

  5. High Pressure Reverse Flow APS Engine

    Science.gov (United States)

    Senneff, J. M.

    1972-01-01

    A design and test demonstration effort was undertaken to evaluate the concept of the reverse flow engine for the APS engine application. The 1500 lb (6672 N) thrust engine was designed to operate on gaseous hydrogen and gaseous oxygen propellants at a mixture ratio of 4 and to achieve the objective performance of 435 sec (4266 Nsec/kg) specific impulse. Superimposed durability requirements called for a million-cycle capability with 50 hours duration. The program was undertaken as a series of tasks including the initial preliminary design, design of critical test components and finally, the design and demonstration of an altitude engine which could be used interchangeably to examine operating parameters as well as to demonstrate the capability of the concept. The program results are reported with data to indicate that all of the program objectives were met or exceeded within the course of testing on the program. The analysis effort undertaken is also reported in detail and supplemented with test data in some cases where prior definitions could not be made. The results are contained of these analyses as well as the test results conducted throughout the course of the program. Finally, the test data and analytical results were combined to allow recommendations for a flight weight design. This preliminary design effort is also detailed.

  6. AP-102/104 Retrieval control system qualification test procedure

    International Nuclear Information System (INIS)

    RIECK, C.A.

    1999-01-01

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents

  7. Hyperoxia increases AP-1 DNA binding in rat brain.

    Science.gov (United States)

    Tong, LiQi; Toliver-Kinsky, Tracy; Rassin, David; Werrbach-Perez, Karin; Perez-Polo, J Regino

    2003-01-01

    Oxidative stress appears to contribute to neurodegenerative outcomes after ischemia, hypoxia, and hyperoxia. The AP-1 transcription factor is made up of a family of regulatory proteins that can be activated by oxidative stress. In the present study, we examined AP-1 DNA binding activity in terms of specific participating AP-1 proteins in rat brain after hyperoxia. Male Sprague-Dawley rats were exposed to 100% oxygen under isobaric conditions over time. The AP-1 DNA binding activity present in the rat hippocampus and basal forebrain was characterized by electrophoretic mobility shift analysis (EMSA) and the participating AP-1 proteins identified by immunodepletion/supershift and Western blotting analyses. The Fos and Jun proteins were localized by immunohistochemistry to hippocampus. There were significant increases in AP-1 DNA binding in both hippocampus and basal forebrain after hyperoxia. There was also a significant increase in c-Jun protein levels and the proportion of c-Jun present in AP-1 DNA binding complexes in hippocampal nuclei after hyperoxia. These results suggest that AP-1 activation via c-Jun binding to DNA is an important component of brain responses to oxidative stress.

  8. Training and development of the Assistant Practitioners (APs) in radiography

    International Nuclear Information System (INIS)

    Stewart-Lord, Adéle

    2014-01-01

    A mixed methods study conducted over three phases (Phase I – scoping exercise, Phase II – questionnaire and Phase III – semi-structured interviews) aimed to explore the role and integration of the assistant practitioner (AP) practitioner in radiography from the AP perspective. Findings of the overall study are presented across a range of articles where this publication only presents the findings in relation to the training and education of APs from all three phases. Results showed the educational routes undertaken by APs in radiography during training. Training whilst working in the clinical department has highlighted a number of key issues relating to educational pathways and delivery methods. Findings showed that APs felt that more could be done to prepare the individual for clinical practice thereby increasing their confidence and facilitating role development. Results also identified a number of challenges in the training and education of APs in radiography. Clear routes of progression and career pathways are not available to APs in radiography. In conclusion the findings suggest the need for a review of existing educational programmes and future standardisation. The need exists to clarify the justifiable methods of training and differentiate between recognised educational qualifications to enable informed career development decisions by APs and their employers

  9. Discussion of QA grading for AP1000 NP plant

    International Nuclear Information System (INIS)

    Luo Shuiyun; Zhang Qingchuan

    2012-01-01

    The grading method of quality assurance for the following AP1000 project is presented based on the Westinghouse classification principle, referring to the classification method of the AP1000 self-reliance supporting project and considering the factors of classification, which can meet the requirements of domestic nuclear safety regulation and standard of the QA classification. (authors)

  10. Status of the Advanced Photon Source (APS) linear accelerator

    International Nuclear Information System (INIS)

    White, M.; Berg, W.; Fuja, R.; Grelick, A.; Mavrogenes, G.; Nassiri, A.; Russell, T.; Wesolowski, W.

    1993-01-01

    A 2856-MHz S-band, 450-MeV electron/positron linear accelerator is the first part of the injector for the Advanced Photon Source (APS) 7-GeV storage ring. Construction of the APS linac is currently nearing completion, and commissioning will begin in July 1993. The linac and its current status are discussed in this paper

  11. Data-Based Decision Making: The Road to AP Equity

    Science.gov (United States)

    Edwards, Kelcey; Duggan, Odette

    2012-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Lake Buena Vista, FL in July 2012. This presentation reviews concepts central to achieving equitable AP access and success for all willing and academically prepared students. We analyze trends in participation and performance by race/ethnicity from the AP Report to the Nation and…

  12. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  13. [Diverse histological lesions in a patient with antiphospholipid syndrome (APS)].

    Science.gov (United States)

    Salvatore, Ermanno; Luciani, Remo; Di Palma, Annamaria; Aversano, Arturo; Stellato, Davide; Liuzzi, Marco; Iele, Emilio; Martignetti, Vinicio; Spagnuolo, Enrico; Morrone, Luigi

    2011-01-01

    Antiphospholipid syndrome (APS) is a rare autoimmune disorder. It can be secondary to systemic lupus erythematosus (SLE) or occur in the absence of autoimmune disease. The hallmark of this so-called primary APS is the presence of circulating antiphospholipid antibodies. Renal involvement in primary APS is caused by thrombosis within the renal vasculature. Recently, nonthrombotic glomerulonephritic renal lesions have been described in primary APS as a new histological entity. We here report a patient with primary APS in whom both lesion types were present. A 58-year-old Caucasian man with no significant past medical history presented to our nephrology unit with diffuse edema. Urinalysis showed proteinuria exceeding 400 mg/dL. The autoantibody panel (p-ANCA, c- ANCA, anti-nucleus, anti-DS-DNA) was negative except for anticardiolipin antibodies, which tested positive in two different samples. The diagnostic workup included a kidney biopsy that revealed thrombotic lesions compatible with primary APS and a typical pattern of focal segmental glomerulosclerosis. The kidney is a major target in APS but the exact mechanism underlying the pathogenesis of APS nephropathy has been poorly recognized. The use of kidney biopsy is a fundamental diagnostic tool in this setting, with possible implications also from a prognostic and therapeutic viewpoint.

  14. Building an SDN enterprise WLAN based on virtual APs

    NARCIS (Netherlands)

    Sequeira, L.; Cruz, J.L. de la; Ruiz-Mas, J.; Saldana, J.; Fernandez-Navajas, J.; Almodovar, J.

    2017-01-01

    In this letter, the development and testing of an open enterprise Wi-Fi solution based on virtual access points (APs), managed by a central WLAN controller is presented. It allows seamless handovers between APs in different channels, maintaining the QoS of real-time services. The potential

  15. OpenAPS Data Commons on Open Humans

    OpenAIRE

    Lewis, Dana M.; Ball, Madeleine

    2017-01-01

    Poster describing OpenAPS, Open Humans, and joint work creating a data commons for OpenAPS data in the Open Humans platform. Presented at the 2017 Sage Assembly Bionetworks Assembly and recipient of a Young Innovator/Investigator award.

  16. AP: A Critical Examination of the Advanced Placement Program

    Science.gov (United States)

    Sadler, Philip M.; Sonnert, Gerhard; Tai, Robert; Klopfenstein, Kirstin

    2016-01-01

    The Advanced Placement (AP) program was created to enhance the experience of gifted students as they transition from high school to college. "AP: A Critical Examination of the Advanced Placement Program," edited by Philip M. Sadler, Gerhard Sonnert, Robert Tai, and Kirstin Klopfenstein (2010, Harvard Education Press), questions the…

  17. A Closer Examination of the Academic Benefits of AP

    Science.gov (United States)

    McKillip, Mary E. M.; Rawls, Anita

    2013-01-01

    The authors sought to better understand the relationship between students participating in the Advanced Placement (AP) program and subsequent performance on the Scholastic Aptitude Test (SAT). Focusing on students graduating from U.S. public high schools in 2010, the authors used propensity scores to match junior year AP examinees in 3 subjects to…

  18. Development of a superconducting undulator for the APS

    International Nuclear Information System (INIS)

    Ivanyushenkov, Y; Abliz, M; Doose, C; Fuerst, J; Hasse, Q; Kasa, M; Trakhtenberg, E; Vasserman, I; Gluskin, E; Lev, V; Mezentsev, N; Syrovatin, V; Tsukanov, V

    2013-01-01

    As the western hemisphere's premier x-ray synchrotron radiation source, the Advanced Photon Source (APS) continues to advance the state of the art in insertion device technology in order to maintain record high brightness, especially in the hard x-ray wavelength region. Due to the unique bunch pattern used for normal APS operations and its ultimate capabilities, the APS has chosen superconducting technology for its future hard x-ray undulator sources. In the last several years, the APS in collaboration with the Budker Institute of Nuclear Physics has being developing the technology for planar, small-period superconducting undulators (SCUs). These developments include the design and construction of several prototypes and the construction of the necessary mechanical, vacuum, and cryogenic infrastructure at the APS site. Several prototypes of the SCU magnetic structure have been built and tested. The first SCU is assembled and will be installed in the APS storage ring at the end of 2012. Expected SCU performance in terms of x-ray brightness should noticeably exceed that of existing APS undulators. Immediately after commissioning, the SCU will be used at APS Sector 6 as the radiation source for high-energy x-ray studies.

  19. AP@home: The Artificial Pancreas Is Now at Home

    NARCIS (Netherlands)

    Heinemann, Lutz; Benesch, Carsten; DeVries, J. Hans

    2016-01-01

    In the past years the development of an artificial pancreas (AP) has made great progress and many activities are ongoing in this area of research. The major step forward made in the last years was moving the evaluation of AP systems from highly controlled experimental conditions to daily life

  20. Pitch and loudness matching of unmodulated and modulated stimuli in cochlear implantees.

    Science.gov (United States)

    Vandali, Andrew; Sly, David; Cowan, Robert; van Hoesel, Richard

    2013-08-01

    The pitch elicited by unmodulated and amplitude modulated electrical pulse trains was examined with six adult cochlear implantees. In addition, for three of those subjects who had some hearing in their contralateral ear, the pitch of unmodulated electrical pulse trains was compared to that of complex harmonic acoustic tones. In the first experiment, pulse rate discrimination and the effects of place and level differences on pitch were examined for unmodulated pulse trains. General results were consistent with previous studies showing that variations in pulse rate, while holding loudness fixed, elicit changes in pitch at low rates, but become progressively harder to discriminate as rates approach approximately 300 pulses-per-second. Variations in place or level of stimulation generally produced changes in pitch consistent with tonotopic place and spread of excitation. In the second experiment, pitch and loudness of unmodulated pulse trains were compared with those of amplitude modulated stimuli as a function of modulation depth, rate, and shape, and presentation level. The pitch elicited by an amplitude modulated pulse train was generally higher than that of an unmodulated pulse train with a pulse rate equal to the modulation rate, and generally decreased toward that of the unmodulated pulse train as modulation depth or rate increased, or as presentation level decreased. Sharper/narrower modulation produced lower pitch. In the final experiment, the pitch heights of acoustic complex harmonic tones and unmodulated pulse trains were compared. When electrical pulse rate was equal to the fundamental frequency of the acoustic tone, similar pitch heights were elicited. The results from these experiments indicate that F0 rate pitch derived from the temporal envelope in existing clinical cochlear implant strategies may often be higher than that of acoustic harmonic tones at the same F0 in normal hearing, and that pitch growth with increasing F0 may be shallower. The