WorldWideScience

Sample records for aberto ao ar

  1. Do Universo Privado ao Espaço Aberto, do Espaço Aberto ao Universo Privado - Recepção e Gênese de L´Étranger de Albert Camus

    Directory of Open Access Journals (Sweden)

    Samara Geske

    2009-10-01

    Full Text Available Este artigo pretende traçar linhas gerais sobre a recepção e a gênese de L’Étranger , passando pelo universo privado dos primeiros leitores do manuscrito até chegar ao espaço aberto de seus primeiros críticos, para do espaço aberto da obra publicada retornar o universo privado do processo de criação do romance.

  2. Fatores ambientais sobre a idade ao primeiro parto, dias abertos e intervalo entre partos em vacas da raça holandesa na Bacia Leiteira de Castrolanda, estado do Paraná

    OpenAIRE

    Wolff, Maria Cândida Córdova

    2012-01-01

    Dados provenientes do Programa de Análises de Rebanhos Leiteiros do Paraná (PARLPR) da Associação Paranaense de Criadores de Bovinos Leiteiros da Raça Holandesa (APCBRH) foram analisados para estudar os fatores do meio ambiente (rebanho, ano de parto, mês de parto, grupo genético, idade ao parto e efeito vaca) que estariam influenciando as características reprodutivas: idade ao primeiro parto (IPP) em meses, .dias abertos (DA) e intervalo entre partos (IEP) em dias, nas vacas da raça Holandes...

  3. MICOBIOTA ASSOCIADA À MADEIRA SERRADA DE Eucalyptus grandis HILL EX MAIDEN DURANTE A SECAGEM AO AR LIVRE

    Directory of Open Access Journals (Sweden)

    Paulo Fernando Trugilho

    2006-02-01

    Full Text Available O objetivo principal deste trabalho foi o de acompanhar a secagem ao ar livre da madeira serrada de Eucalyptus grandis conduzida na região de Lavras, MG e identificar a micobiota associada à madeira em diversas fases da secagem. As tábuas foram cortadas de oito toras de 3,0 m de comprimento, oriundas de três árvores, com 27 anos de idade, plantadas em área experimental da UFLA. Dos resultados, pôde-se concluir que a secagem da madeira de Eucalyptus grandis ao ar livre, iniciada em janeiro, consumiu 158 dias até atingir umidade próxima a 12,5%. A curva de secagem foi representada por uma equação logarítmica com coeficiente de determinação (R2 igual a 98,3%. Os fungos causadores de bolores superficiais e de manchas tiveram maior ocorrência no início da secagem. As mais altas freqüências de fungos, verificadas no início da secagem, foram observadas para Penicillium spp. e Pestalotiopsis sp. O fungo Lentinus lepideus ocorreu com maior freqüência no final da secagem.

  4. Biomassa microbiana em amostras de solos secadas ao ar e reumedecidas Microbial biomass in air dried and rewetted soil samples

    Directory of Open Access Journals (Sweden)

    Antônio Samarão Gonçalves

    2002-05-01

    Full Text Available O objetivo do trabalho foi avaliar a viabilidade do condicionamento de amostras como terra fina secada ao ar (TFSA por curto período, para a determinação do carbono da biomassa microbiana (BMS-C, pelo método da fumigaçãoextração, e verificar a respiração microbiana basal (RB do solo. O condicionamento como TFSA, procedendo-se à fumigação para a análise da BMS-C imediatamente ou 24 horas após o reumedecimento, proporcionou valores de BMS-C para os solos Podzólicos, Latossolo Vermelho-Amarelo álico e Orgânico, semelhantes aos valores dos seus controles. Os solos Glei Pouco Húmico e Vertissolo apresentaram valores de BMS-C similares aos do controle a partir de 24 horas de incubação; o solo Planossolo arenoso apresentou valores similares aos do controle com 72 horas, e a Rendizina, com 168 horas de incubação. Na maioria dos solos, a RB determinada na TFSA apresentou valores maiores do que os do tratamento-controle, quando avaliada imediatamente ou 24 horas após o reumedecimento a 60% da capacidade máxima de retenção de água, seguida de queda e manutenção em níveis semelhantes ao do controle nos períodos subseqüentes. O précondicionamento, de curta duração, como TFSA, é promissor para a determinação da BMS-C, quando níveis e períodos adequados de reumedecimento são adotados.The objective of this work was to evaluate the utilization of short term air dried soil samples in a determination of soil microbial biomass (SMB-C, by a fumigationextraction method, and soil microbial basal respiration (BR. Zero time or 24 hours rewetting incubation period before fumigation procedure gave values of SMB-C similar to those of the control for the Podzolic soils, Allic RedYellow Latosol and Organic soil. Low Humic Gley and Vertisol soils gave values of SMB-C similar to those of the control for periods of incubation equal or higher than 24 hours. Planosol (sandy soil and Rendzina soils gave values of SMB-C similar to the

  5. Teste de provocação oral aberto na confirmação de alergia ao leite de vaca mediada por IgE: qual seu valor na prática clínica? Open oral food challenge in the confirmation of cow's milk allergy mediated by IgE: what is its value in the clinical practice?

    Directory of Open Access Journals (Sweden)

    Raquel Bicudo Mendonça

    2011-09-01

    Full Text Available OBJETIVO: Revisar os principais protocolos de padronização para o teste de provocação oral aberto aplicado a crianças com suspeita de alergia ao leite de vaca mediada por imunoglobulina E. FONTES DE DADOS: Foram selecionados artigos publicados, nos últimos dez anos, nas bases de dados Medline, Lilacs e SciELO, utilizando-se os descritores de assunto: "hipersensibilidade alimentar", "leite de vaca", "alergia ao leite de vaca", "teste de provocação oral", "crianças" e "diagnóstico". SÍNTESE DOS DADOS: O teste de provocação oral é o método mais fidedigno para estabelecer ou excluir o diagnóstico de alergia alimentar e sua forma aberta pode ser a primeira opção, quando apenas reações objetivas são esperadas. O local para realizar o teste deve possuir todos os recursos para tratamento de emergência. Como preparo, o paciente deve seguir dieta de exclusão do alimento suspeito e descontinuar o uso de medicamentos que possam interferir no resultado do teste. Habitualmente, utilizam-se 8 a 10g de leite em pó ou 100mL de leite fluido, oferecidos em volumes progressivos, a intervalos de dez a 60 minutos. Apesar da rigidez do método, ainda existem situações em que há dificuldade de interpretação dos resultados; por isso, médicos bem treinados devem aplicar o teste, sendo cautelosos ao julgarem as reações. CONCLUSÕES: Mesmo considerando as limitações que dificultam a aplicação do teste de provocação oral na prática clínica, a implementação do teste nos serviços de saúde poderia reduzir diagnósticos falsos-positivos de alergias.OBJECTIVE: To review the main standardization protocols of the open oral food challenge applied to children with suspicion of cow's milk allergy mediated by immunoglobulin E. DATA SOURCE: Medline, Lilacs and SciELO databases were searched for articles published in the last ten years using the following descriptors: "food hypersensitivity", "cow's milk", "cow's milk allergy", "oral food

  6. Ensaio clínico, aberto, controlado sobre a adição de brometo de ipratrópio ao fenoterol no tratamento da crise de asma em adultos Open, controlled clinical assay of the addition of ipratropium bromide to fenoterol in the treatment of acute asthma crisis in adults

    Directory of Open Access Journals (Sweden)

    Solange Diccini

    1999-12-01

    Full Text Available No tratamento da crise de asma, empregam-se doses repetidas de drogas b2-agonistas por via inalatória. O efeito da adição do brometo de ipratrópio (BI ao b2-agonistas é controverso em adultos. OBJETIVO: Avaliar se adição de BI ao fenoterol, em tratamentos inalatórios repetidos, induz a maior broncodilatação, com reversibilidade da crise e alta da emergência em pacientes em crise grave de asma. LOCAL DO ESTUDO: Serviço de Pronto-Atendimento de Pneumologia, Disciplina de Pneumologia da Unifesp-Hospital São Paulo, no período de julho de 1995 a fevereiro de 1997. TIPO DE ESTUDO: Aberto, randomizado, paralelo. Alta da emergência determinada pelo VEF1 e PFE > 60% do previsto. CASUÍSTICA E MÉTODOS: Cento e vinte pacientes em crise de asma foram divididos em dois grupos (N = 60: fenoterol (F e brometo de ipratrópio + fenoterol (BIF com VEF1 e PFE Repeated dosis of inhaled b2-agonists have been used in the treatment of acute asthma. The effect of added ipratropium bromide (IB to b2-agonist is controversial in adults. OBJECTIVE: To evaluate if addition of IB to fenoterol, in repeated doses, induces a greater bronchodilation, a greater reversion of the attack, and discharge from emergency unit in adults with acute severe asthma. SETTING: Pneumology Emergency Department, Unifesp-Hospital São Paulo, in the period from July 1995 to February 1997. TYPE OF STUDY: Open, randomized and parallel study. Discharge from the hospital: FEV1 and PEF > 60% of the predicted value. METHODS: 120 patients with FEV1 and PEF < 50% of the predicted value were divided into two groups (N = 60: fenoterol (F and ipratropium bromide + fenoterol (IBF. Each group received inhalation treatment through a metered-dose inhaler (MDI attached to a holding chamber, administered at 30-minute interval, for a total of three treatments. In the group F four puffs of fenoterol (400 mg were administered, and in the IBF group, 160 mg of BI and 400 mg of fenoterol (four puffs

  7. Uma análise de aspectos relacionados ao desenvolvimento e adoção de Enterprise Resources Planning livre de código aberto An analysis of aspects related to the development and adoption of free open source Enterprise Resources Planning

    Directory of Open Access Journals (Sweden)

    Rogério Atem de Carvalho

    2009-12-01

    Full Text Available Sistemas Integrados de Gestão ou Enterprise Resources Planning - ERP possibilitam o processamento das informações necessárias em uma empresa usando um único banco de dados. Muito tem se escrito sobre este tipo de software, abordando questões como o alto custo da aquisição de licenças, e a dependência de consultoria para a sua adaptação e implantação nas empresas. Atualmente vem crescendo o desenvolvimento e uso de ERP Livre de Código Aberto (FOS-ERP. Porém verifica-se que este tipo de sistema ainda não é suficientemente explorado, mesmo no meio acadêmico. Este artigo relata alguns trabalhos publicados sobre o assunto e levanta questões que devem ser tratadas por pesquisadores e demais interessados para adequar e viabilizar o uso desses sistemas conforme a realidade nacional. Assim, após uma introdução ao tema, são apresentadas algumas diferenças entre o FOS-ERP e seus equivalentes proprietários (Proprietary ERP ou P-ERP em termos de modelos de negócios, seleção, customização e evolução. Em seguida são elencados alguns desafios e oportunidades que o FOS-ERP pode oferecer a usuários, fornecedores, pesquisadores e colaboradores individuais. Concluindo, este artigo busca ampliar a discussão sobre FOS-ERP, destacando fatores tais como seu potencial de inovação tecnológica e estratégias de negócios.Enterprise Resources Planning (ERP enables the processing of information required in an enterprise, using a single database. Much has been written about this type of software, addressing issues such as the high cost of licenses acquisitions, and the dependence on consultants for its adaptation and implementation in companies. Currently the development and use of ERP Free Open Source (FOS-ERP has increased. However, this type of system is still not sufficiently explored, even in academia. This article analyses some papers on the subject, and raises questions that must be addressed by researchers and other stakeholders

  8. A eficácia do milnaciprano em pacientes ambulatoriais com transtorno depressivo maior não respondedores ao tratamento com ISRSs: um estudo aberto de 12 semanas Efficacy of milnacipran in outpatients experiencing major depression non respondent to SSRIs: a 12-week open study

    Directory of Open Access Journals (Sweden)

    Marcelo P. Fleck

    2010-01-01

    Full Text Available CONTEXTO: O objetivo deste estudo é avaliar a eficácia do milnaciprano em pacientes ambulatoriais com depressão maior grave que não respondem em tempo e em dosagem adequados à terapia com ISRSs. MÉTODOS: Um estudo aberto multicêntrico com a duração de 12 semanas foi elaborado para avaliar a eficácia do milnaciprano após falha em um experimento com ISRS. Remissão completa (HAMD-17 50%, CGI e avaliação da qualidade de vida (WHOQOL-Bref. RESULTADOS: O escore HAMD-17 médio da amostra foi de 27 (7,2. As taxas de remissão com o milnaciprano foram de 17,5%, e as de resposta, 61,3%. Na linha de base, 70,9% dos pacientes foram classificados como gravemente sintomáticos. Ao final do tratamento, 48,1% dos pacientes foram classificados como normais assintomáticos ou sintomáticos limítrofes e 20,2% eram moderadamente sintomáticos. Além disso, os quatro domínios do WHOQOL-Bref, um instrumento genérico de mensuração de qualidade de vida, apresentou diferenças clínicas e estatísticas: CONCLUSÃO: Nossos resultados sugerem que o milnaciprano é uma possível opção para pacientes que não respondem a ISRSs. Uma vez que não há evidências na literatura de um antidepressivo que seja a melhor opção quando um ISRS falha, o uso do milnaciprano deveria ser considerado em casos de pacientes com depressão severa.BACKGROUND: The objective of this study is to evaluate the efficacy of milnacipran in outpatients experiencing severe MDD non-respondent to adequate time and dosing of SSRI therapy. METHODS: A 12 week multi-centric study open study was designed to evaluate the efficacy of milnacipran after a SRRI trial failure. Complete remission (HAMD-17 50%, CGI and quality of life measure (WHOQOL-Bref. RESULTS: The mean HAMD-17 score of the sample was 27 (7.2. The remission rates for minalcipran were 17.5% and response 61.3%. At baseline, 70.9% of the patients were markedly or severely ill. At treatment end, 48.1% of the patients were normal

  9. Espectroscopia de candidatos a remanescentes de aglomerados abertos

    Science.gov (United States)

    Pavani, D. B.; Bica, E.; Ahumada, A. V.; Clariá, J. J.

    2003-08-01

    A pesquisa sobre remanescentes de aglomerados abertos tem despertado grande interesse. Seguindo esta tendência encontramos estudos teóricos e observacionais. Os primeiros baseiam-se em simulações numéricas buscando determinar fração de binárias e distâncias galatocêntricas, tempo de vida e conteúdo estelar. Estes estão relacionados à função inicial de massa e densidade de estrelas, ou seja, se ricos ou pobremente povoados, compactos ou esparsos. No caso observacional procuram-se identificar os remanescentes considerando-se que trazem estas assinaturas de seus percursores. No presente estudo empregamos espectroscopia para analisar oito concentrações pobremente povoadas, previamente classificadas como aglomerados abertos, sendo sete compactas e uma esparsa. As observações foram obtidas através do telescópio de 2,15 m do CASLEO em San Juan, Argentina, em turnos entre 2001 e 2003. Utilizamos uma câmara CCD contendo um chip Tektronics de 1024X1024 pixeis aliado a um espectrógrafo REOSC. O domínio espectral vai de 3700 a 7000 Å. As reduções foram realizadas no Observatório Astronômico de Córdoba (Argentina) usando pacotes IRAF padrões. Determinamos idades, avermelhamentos e tipos espectrais através de comparações com biblioteca de estrelas e de aglomerados. Em alguns casos nossos espectros estavam dominados por estrelas individuais às quais determinamos seus tipos espectrais. Aos oito objetos adicionamos mais cinco da literatura recente analisados via espectro ou diagrama cor-magnitude. O histograma resultante contém idades típicas entre 0.5 e 3 Ganos. Considerando que predominantemente estes objetos encontram-se na vizinhança solar e, portanto, não cruzaram muitas vezes o plano Galático esperamos que a diferença no tempo necessário para dissolução destes prováveis remanescentes seja em função de diferentes massas iniciais.

  10. Uma análise de aspectos relacionados ao desenvolvimento e adoção de Enterprise Resources Planning livre de código aberto An analysis of aspects related to the development and adoption of free open source Enterprise Resources Planning

    OpenAIRE

    Rogério Atem de Carvalho; Renato Campos

    2009-01-01

    Sistemas Integrados de Gestão ou Enterprise Resources Planning - ERP possibilitam o processamento das informações necessárias em uma empresa usando um único banco de dados. Muito tem se escrito sobre este tipo de software, abordando questões como o alto custo da aquisição de licenças, e a dependência de consultoria para a sua adaptação e implantação nas empresas. Atualmente vem crescendo o desenvolvimento e uso de ERP Livre de Código Aberto (FOS-ERP). Porém verifica-se que este tipo de sistem...

  11. Relação entre baixo peso ao nascer e a poluição do ar no Município de São Paulo

    Directory of Open Access Journals (Sweden)

    Andréa Medeiros

    2005-12-01

    Full Text Available OBJETIVO: A poluição do ar tem sido investigada como possível determinante do baixo peso ao nascer. O objetivo do estudo foi verificar o efeito da poluição do ar sobre o peso ao nascer. MÉTODOS: Foram analisados todos os partos de mães residentes no Município de São Paulo, nos anos de 1998 a 2000. Estimaram-se as prevalências de baixo peso ao nascer conforme características do recém-nascido, da mãe e do parto. Apenas os distritos mais centrais de São Paulo foram incluídos, totalizando uma amostra de 311.735 nascimentos. Para avaliação do efeito da poluição do ar foram excluídos os prematuros, gemelares e analisados somente os nascimentos das áreas mais centrais da cidade. Os elementos poluentes analisados foram ozônio (O3, dióxido de enxofre (SO2, dióxido de nitrogênio (NO2, partículas em suspensão (PM10 e monóxido de carbono (CO. O efeito da exposição materna à poluição do ar no peso ao nascer foi avaliado por meio de regressão linear e logística. RESULTADOS: Do total analisado, 4,6% dos recém-nascidos apresentaram menos de 2.500 g ao nascer. A exposição materna ao CO, PM10 e NO2 durante o primeiro trimestre de gestação mostrou associação estatisticamente significante com a diminuição no peso do recém-nascido. CONCLUSÕES: Os resultados reforçam que a exposição materna à poluição do ar no primeiro trimestre de gestação pode contribuir para o menor ganho de peso do feto.

  12. Ensaio clínico, aberto, controlado sobre a adição de brometo de ipratrópio ao fenoterol no tratamento da crise de asma em adultos Open, controlled clinical assay of the addition of ipratropium bromide to fenoterol in the treatment of acute asthma crisis in adults

    OpenAIRE

    Solange Diccini; Clystenes Odyr Soares Silva; Jorge Nakatani; Carlos Alberto de Castro Pereira

    1999-01-01

    No tratamento da crise de asma, empregam-se doses repetidas de drogas b2-agonistas por via inalatória. O efeito da adição do brometo de ipratrópio (BI) ao b2-agonistas é controverso em adultos. OBJETIVO: Avaliar se adição de BI ao fenoterol, em tratamentos inalatórios repetidos, induz a maior broncodilatação, com reversibilidade da crise e alta da emergência em pacientes em crise grave de asma. LOCAL DO ESTUDO: Serviço de Pronto-Atendimento de Pneumologia, Disciplina de Pneumologia da Unifesp...

  13. Análise econômica do Sistema Intensivo de Suínos Criados ao Ar Livre Economic analysis of an Outdoor Pig Production System

    Directory of Open Access Journals (Sweden)

    Denyse Maria Galvão Leite

    2001-04-01

    Full Text Available Foi instalado um Sistema Intensivo de Suínos Criados ao Ar Livre (SISCAL, na Estação Experimental de Pato Branco do Instituto Agronômico do Paraná, com o objetivo de determinar os custos de implantação e produção deste sistema, na região Sudoeste do Paraná. A área do SISCAL foi dimensionada para um plantel de 14 matrizes e um reprodutor, a qual foi dividida em piquetes para separar os animais por estágios fisiológicos (reprodução, gestação e creche. O custo de implantação foi baseado nos custos de mão-de-obra e dos materiais utilizados para instalação do sistema e confecção de alguns equipamentos, como também os custos da construção da fábrica e depósito de ração e dos equipamentos para confecção das rações.O custo total de implantação do SISCAL, excluindo o valor da terra, foi de US$ 6862,80, ou seja, US$ 490,20 por matriz instalada, em julho de 1997. A construção e os equipamentos da fábrica de ração foram os itens mais caros do custo de implantação. O custo total de produção por kg de leitão desmamado produzido foi US$ 0,617, em junho de 1999. Neste período, foi possível obter 18,81% de lucro líquido por kg de leitão produzido.An Outdoor Pig Production System (SISCAL, at the Experimental Station Agronomic Institute of Paraná State was used with the objective to determine the establishment and production costs of this system in the Southwestern region of Paraná. The SISCAL area was dimensioned to a 14 sows and one boar herd, which was divided in paddocks to separate the animals per physiological stage (reproduction, gestation and nursery. The establishment cost was based on the labor, material used for the system installation and the manufacturing of some equipment, as well as the feed plant and storage construction costs and equipments for the ration production. The total establishment observed cost of the SISCAL, excluding capital value of land, was of US$ 6862.80 or US$ 490.20 per housed

  14. Determinação analítica da performance da irrigação por sulcos abertos e em declive

    Directory of Open Access Journals (Sweden)

    Aristides Fraga Lima Filho

    2015-06-01

    Full Text Available Uma solução analítica foi desenvolvida, para avaliar sulcos abertos e em declive, com base na teoria de Balanço de Volume de Walker e Skogerboe (1987. Essa metodologia é capaz de obter, matematicamente, a performance de um sistema, dispensando a construção de gráficos que definem os parâmetros de avaliação. A solução matemática é baseada no ajuste de equações ao modelo potencial, no cálculo das áreas sob as curvas definidas no ajuste e na intercessão de curvas, obtendo-se, assim, a performance de sistemas de irrigação por sulcos abertos e em declive. Para validação da metodologia, foi realizado um experimento de campo, na Fazenda Experimental da Universidade Federal do Ceará, situada no município de Pentecoste, pertencente ao Centro de Ciências Agrárias. Os dados de campo foram submetidos à análise pelas duas metodologias. Os resultados mostraram que a metodologia analítica pode ser usada para avaliar a irrigação por sulcos abertos e em declive.

  15. Caracterização bioclimática de sistemas ao ar livre e confinado para a criação de matrizes suínas gestantes Bioclimatic characterization of outdoor and confined systems for pregnant sows

    Directory of Open Access Journals (Sweden)

    Aérica C. Nazareno

    2012-01-01

    Full Text Available O confinamento de matrizes suínas foi criado com o intuito de maximizar a produtividade; entretanto, existem problemas relacionados ao bem-estar animal. Objetivou-se avaliar a criação de matrizes suínas gestantes no sistema de confinamento e ao ar livre, com relação ao ambiente térmico e às respostas fisiológicas. O experimento foi realizado em Monte Mor/SP. A avaliação fisiológica foi realizada por meio do registro das variáveis: frequência respiratória e temperatura de pele. Foram registradas as variáveis meteorológicas: temperatura de bulbo seco, temperatura de bulbo úmido e temperatura de globo negro, caracterizando o ambiente por meio da entalpia e índice de temperatura de globo e umidade. Foram utilizados seis animais por tratamento. O delineamento experimental foi inteiramente casualizado em parcelas subdivididas, e as médias comparadas pelo teste de Tukey. As variáveis fisiológicas e meteorológicas apresentaram valores superiores no confinamento. O sistema de criação ao ar livre potencializou as trocas térmicas entre os animais e o ambiente, o que refletiu em menor estresse por calor observado nos animais.Pregnant sows confinement systems were created in order to maximize the productivity, however there are problems concerning the animal welfare. The aim of this research was to evaluate pregnant sows in outdoors and in confinement systems in relation to the thermal environment and physiological animal responses. The experiment was conducted in a commercial farm in Monte Mor city, São Paulo, Brazil. The physiological evaluation was performed by recording physiological variables, such as respiratory frequency and skin temperature. Furthermore, variables like dry bulb temperature, wet bulb temperature, and black globe temperature were also evaluated to characterize the ambient by means of enthalpy and black globe humidity index. In each treatment six animals were evaluated. The experimental design was completely

  16. Educação ao ar livre pela aventura: o aprendizado de valores morais em expedições à natureza Education outdoors through adventure: learning moral values in nature expeditions

    Directory of Open Access Journals (Sweden)

    Flavio Theodor Kunreuther

    2012-06-01

    Full Text Available A educação ao ar livre, por meio de cursos no formato expedição, ainda acontece de forma tímida no Brasil. Entende-se por expedição uma experiência educacional contínua, de múltiplos dias, em que alunos e instrutores aventuram-se em um trajeto em área remota da natureza de forma autossuficiente. O presente estudo analisa os cursos desse tipo. Por meio de entrevistas e questionários semiestruturados, investigou-se a aprendizagem dos alunos segundo suas próprias percepções e as dos educadores da instituição, com ênfase no desenvolvimento moral do indivíduo. Como parte do estudo de caso sobre um aluno adolescente participante de um dos cursos, entrevistou-se também uma psicóloga que coordena um abrigo para menores. Os resultados encontrados indicam que os cursos de educação ao ar livre caracterizam-se por experiências que estimulam trabalhos em grupo, debates sobre justiça e solidariedade, e reflexões sobre valores e princípios como coragem, esforço pessoal, disciplina, respeito e superação de limites. Os resultados também indicam que tal proposta educacional aufere experiências sensíveis e de conexão do ser humano com a natureza. Muito embora haja potencial educacional para a educação ao ar livre, a atuação do educador perante seus alunos é fundamental para que as experiências sejam física e psicologicamente seguras, alcancem seus potenciais pedagógicos de desenvolvimento da moralidade e ajudem as pessoas a desenvolverem uma consciência ambiental, manifestada por meio de ações concretas ao retornarem dos cursos para suas comunidades.Open air education through courses organized as expeditions is still incipient in Brazil. We understand an expedition as a continued educational experience taking several days in which students and instructors venture into a remote natural area in a self-sufficient way. The present study analyzes courses of this type. Using interviews and semi-structured questionnaires, it

  17. Julgamento de colinearidade e percepção de distância exocêntrica em campo aberto

    Directory of Open Access Journals (Sweden)

    Javier Enrique Santillán

    2011-01-01

    Full Text Available O propósito foi investigar experimentalmente o desempenho dos observadores numa original tarefa de julgamento de colinearidade em campo aberto (dimensões 20 x 30 m. Participaram do experimento 30 observadores. Os estímulos foram estacas verticais de alturas variáveis, quatro fixos e quatro móveis. A tarefa consistiu em ajustar os dois estímulos móveis (mediante controle à distância para que ficassem colineares aos dos estímulos fixos nos extremos de cada diagonal. Foi realizada uma análise de variância (ANOVA fatorial sobre os erros de colinearidade, revelando somente efeito significativo para o fator ‘Estímulo Móvel’ (F(3,473=69,86 p<0,001 notando-se uma sistemática na distribuição dos erros. As pequenas variações na distância exocêntrica percebida (com erros constantes dez vezes menores que os encontrados ao avaliar as distâncias egocêntricas e a relação dos erros cometidos com as distâncias egocêntricas indicariam que o marco de referência eliciado por esta tarefa de colinearidade, embora possa estar baseado nos indícios exocêntricos, é escalado por um fator egocêntrico.

  18. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  19. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    OpenAIRE

    Laerte Francisco Filippsen; Denyse Maria Galvão Leite; Aparecido da Silva; Gilberto Alexandre Vargas

    2001-01-01

    O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames soro...

  20. Otimização econômica de explotações a céu aberto

    Directory of Open Access Journals (Sweden)

    Frederico Augusto Rosa do Carmo

    2006-09-01

    Full Text Available A determinação dos limites da cava final de qualquer projeto de mineração é um dos maiores desafios de um projeto de mineração. Tais limites precisam ser definidos já no início dos trabalhos de planejamento de lavra e devem ser reconsiderados, novamente e rotineiramente, durante toda a vida útil da mina. Um dos propósitos do plano de exaustão de minas a céu aberto é determinar a cava final ótima, baseando-se em um modelo econômico sujeito a restrições técnicas e visando à maximização do valor atual líquido do projeto. O primeiro algoritmo específico relacionado ao tema foi publicado por Lerchs e Grossmann (1965. O algoritmo de Lerchs e Grossmann tem sido aceito como padrão de teste em comparação com outros algoritmos equivalentes, que têm sido propostos, porque ele resolve o problema correspondente, segundo a teoria dos grafos, ao corte mínimo e fluxo máximo. Outros algoritmos de otimização de cavas finais de minas a céu aberto também são apresentados nesse trabalho. Além disto, um programa acadêmico para a otimização de cavas foi desenvolvido pelos autores sendo que os fundamentos deste são apresentados no presente artigo.The determination of the final pit limits of any mining project is one of the most important challenges in a mining project. Such limits need to be defined at the beginning of the mine planning and should be reconsidered, again and routinely, during all the useful life of a mine. One of the purposes of the open pit mine exhaustion plan is the determination of the optimal final pit, based on an economic model subject to technical restrictions and aimed to maximize the net present value. LERCHS e GROSSMANN (1965 published the first specific algorithm related to the theme. This algorithm has been accepted as standard in comparison to other equivalent algorithms which have been proposed, because it solves the corresponding problem, according to the graph theory, of the minimum cut and

  1. EPIDEMIOLOGICAL ASPECTS OF A FOCUS OF Tunga penetrans INFESTATION IN OUTDOOR PIG PRODUCTION ASPECTOS EPIDEMIOLÓGICOS DE UM FOCO DE TUNGÍASE (Tunga penetrans, SIPHONAPTERA EM UM SISTEMA INTENSIVO DE SUÍNOS CRIADOS AO AR LIVRE

    Directory of Open Access Journals (Sweden)

    Doralice Pedroso de Paiva

    2007-09-01

    Full Text Available

    The outdoors intensive-type pig production is characterized by maintaining swine during reproductive, pregnancy and nursing periods on pasture limited by wiring and/or electric fences. The aim of the present report was to describe the epidemiological aspects of an outbreak of Tunga penetrans in an outdoor pig production system. A total of six mature boars, 9 lactating sows, 13 pregnant sows, 9 mating sows, 20 suckling pigs and 34 weaned pigs were clinically examined. None of the boars were infested, while 50% of all sows examined had the parasite lesions, most frequently observed in the breast area, thus resulting in agalactia in lactating sows due to obstruction of the galactophorus channel, with subsequent involution of the mammary gland. In 90% of suckling piglets walking difficulty was observed, caused by the presence of the parasite in the hoofs, with 25% of these animals also showing hock lesions (farm number 1, n = 48. Similar lesions were observed in 100% of 40-47 days old weaned pigs (farm number 2, n = 24 and in 80% of 70 days old weaned pigs (farm number 3, n = 10, all of which had been transferred to finishing units in a confinement system. Therefore we conclude that Tunga penetrans can infest pigs reared or kept outdoors, causing agalactia in lactating sows, and walking disorders in suckling and weaned pigs.

    KEY-WORDS: Chiggers, agalactia in sows; outdoors pig production.

    O sistema intensivo de produção de suínos criados ao ar livre (SISCAL é caracterizado por manter os suínos em piquetes com cobertura vegetal, nas fases de reprodução, maternidade e creche, cercados com tela e/ou fios de arame eletrificado. Este trabalho teve por objetivo relatar

  2. Análise eletromiográfica de músculos do membro inferior em exercícios proprioceptivos realizados com olhos abertos e fechados

    Directory of Open Access Journals (Sweden)

    Daniela Cristina Silveira de Oliveira

    2012-08-01

    Full Text Available INTRODUÇÃO: A propriocepção é um termo utilizado para descrever todas as informações neurais originadas nos proprioceptores das articulações, músculos, tendões, cápsulas e ligamentos, que são enviadas por meio das vias aferentes ao sistema nervoso central. A eletromiografia (EMG é o estudo da função muscular por meio da averiguação do sinal elétrico que emana do músculo, sendo também, o estudo da atividade da unidade motora. OBJETIVO: Realizar uma análise eletromiográfica dos músculos reto femoral (RF e tibial anterior (TA, em diferentes exercícios proprioceptivos (disco de Freeman-DIS e balancim-BAL com os olhos abertos (OA e fechados (OF. MÉTODOS: A análise foi realizada com 10 indivíduos do gênero masculino, fisicamente ativos, em um tempo de coleta de 10 segundos em cada aparelho tanto com olhos abertos como fechados. RESULTADOS: De acordo com nossos achados, observamos uma diferença significativa quando os exercícios proprioceptivos são realizados com olhos abertos e olhos fechados, obtendo uma ativação muscular maior, de acordo com a análise eletromiográfica, nos exercícios com olhos fechados, ressaltando a importância do sistema visual e como ele interfere na posição do corpo quando este é submetido a variações de equilíbrio causadas pelos aparelhos pesquisados. CONCLUSÃO: Concluímos que o músculo reto femoral não apresentou diferenças significativas evidentes entre os aparelhos balancim e disco de Freeman, assim como quando o exercício era realizado com os olhos abertos ou fechados. A diferença significativa ocorrida foi entre o balancim OA e OF e entre balancim OA e disco de Freeman OF. Já o músculo tibial anterior, apresentou diferenças significativas maiores, principalmente com os olhos fechados, independente do aparelho, os quais não apresentaram diferenças significativas entre eles.

  3. Exposição ao mercúrio e ao arsênio em Estados da Amazônia: síntese dos estudos do Instituto Evandro Chagas/FUNASA Exposure to mercury and arsenic in Amazon States: a summary of studies by the Evandro Chagas Institute/FUNASA

    Directory of Open Access Journals (Sweden)

    Elisabeth C. de Oliveira Santos

    2003-06-01

    Full Text Available Este artigo é uma revisão das pesquisas da Seção de Meio Ambiente do Instituto Evandro Chagas/FUNASA sobre exposição ao mercúrio (Hg no vale do rio Tapajós e Estado do Acre, e exposição ao arsênio (As através de resíduos da exploração de manganês (Mn realizada pela ICOMI deixados no Porto de Santana-AP. Em relação ao mercúrio, têm sido pesquisadas populações sob risco através da via respiratória ou alimentar. No primeiro caso, os trabalhadores de casas de compra e venda de ouro têm apresentado teores mais elevados de Hg em urina do que os garimpeiros estudados. No segundo caso, as populações ribeirinhas têm mostrado níveis diferenciados de exposição (Hg em cabelo. Comunidades ribeirinhas situadas em áreas não afetadas pelo mercúrio da garimpagem e com hábitos alimentares semelhantes às de área de risco têm sido avaliadas, visando a construção de parâmetros de normalidade regional. São também pesquisados os teores de Hg em materiais ambientais e na biota aquática. Os estudos de saúde humana e ambiente na cidade de Santana-AP objetivaram avaliar as fontes e possíveis vias de exposição da população da comunidade do Elesbão ao arsênio. Verificou-se a existência de fonte de risco através dos rejeitos de Mn, porém os níveis de As na água consumida pela população mostraram-se dentro dos parâmetros de normalidade. As médias encontradas em sangue e cabelo coincidem com médias de normalidade referidas na literatura, em populações não expostas, e as associações entre variáveis epidemiológicas, avaliação clínico-laboratorial e os teores de arsênio não mostraram significância estatística.This article is a review of the studies carried out by Environmental Section of the Evandro Chagas Institute/FUNASA on mercury (Hg exposure in the Tapajós river basin, and arsenic exposure (As due to residues of the manganese (Mn exploration, performed by ICOMI and left at the port of Santana

  4. Estratégia da Estrutura de Capital sob os Efeitos das Fusões: Estudo de Caso das Instituições de Ensino Superior Brasileiras de Capital Aberto

    Directory of Open Access Journals (Sweden)

    Raul Carlos de Mello

    2010-11-01

    Full Text Available O objetivo deste artigo foi identificar os reflexos produzidos por uma estratégia de crescimento, que se utiliza das fusões, aquisições ou incorporações, sobre a estrutura de capital das instituições de ensino superior brasileiras de capital aberto. A pesquisa utilizada foi de caráter descritivo e o método empregado foi o dedutivo, tendo como meio de investigação o estudo de caso múltiplo. Desse modo, ao elaborar um mapeamento, para o período de 2004 a 2008, de todas as aquisições desenvolvidas pelas instituições de ensino superior brasileiras de capital aberto e dos indicadores relacionados às estruturas de capital, identificou-se uma influência da estratégia de aquisições sobre a estrutura de capital em duas fases: na própria definição da estratégia, ao identificar e usufruir das fontes necessárias para a implantação, e na sua implantação, ao decidir pela agregação das dívidas da empresa adquirida.

  5. A indústria de publicação contra o acesso aberto

    Directory of Open Access Journals (Sweden)

    Kenneth Rochel de Camargo Jr

    2012-12-01

    Full Text Available A publicação em revistas de acesso aberto cresceu expressivamente nos últimos anos. As publicações de acesso fechado, por sua vez, têm custo de acesso cada vez mais elevado, por se beneficiarem de um modelo econômico peculiar: o trabalho relevante e os insumos essenciais são entregues gratuitamente a fornecedores que contam com um mercado cativo, praticamente sem concorrência. O mercado editorial é altamente oligopolizado, característico de indústrias que trabalham com o regime de copyright. Isso contribui para a elevação dos preços de seus produtos. Políticas mandatórias de acesso aberto, como a determinada pela agência National Institutes of Health, constituem-se em ameaça a esse modelo de negócios e são enfrentadas pela indústria em várias frentes, incluindo a passagem de legislação para sabotar tais iniciativas. O objetivo deste comentário foi apresentar alguns aspectos principais desse enfrentamento e sugerir possíveis estratégias de incremento da publicação de acesso aberto em nosso meio.

  6. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L.) sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L.) under air exposure stress

    OpenAIRE

    Roberta Dias da Silva; Laudicéia Oliveira Rocha; Bruno Duarte Alves Fortes; Dirson Vieira; Maria Clorinda Soares Fioravanti

    2012-01-01

    No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus) sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM), a hemoglobina corpuscular média (HCM), a concentração de hemoglobina corpuscular média (CHCM), o leucograma, contagem diferencial de l...

  7. Influência do DNA mitocondrial no glaucoma primário de ângulo aberto sob a visão da cienciometria

    Directory of Open Access Journals (Sweden)

    Leonardo Mariano Reis

    2013-10-01

    Full Text Available OBJETIVO: O glaucoma primário de ângulo aberto é uma doença degenerativa do nervo óptico que se encontra entre as principais causas de cegueira no mundo. Aspectos familiares já foram implicados como fatores importantes e comprovados em inúmeros estudos. Nesse artigo, apresentamos uma revisão sistemática dos trabalhos sobre glaucoma primário de ângulo aberto e DNA mitocondrial e fazemos uma análise estatística à luz dos conceitos da cienciometria. MÉTODOS: A pesquisa bibliográfica de trabalhos envolvendo DNA mitocondrial e glaucoma primário de ângulo aberto foi realizada por meio da base de dados do sítio Scopus. Foi feito o levantamento a partir das palavras-chaves "Mitochondrial DNA" e "Glaucoma" em todos os campos para publicações no período compreendido de 1992 até agosto de 2012. Finalmente, foi realizada a estatística e cienciometria com os principais dados: autores que publicaram sobre o assunto DNA mitocondrial e glaucoma; revistas e outras publicações que tiveram trabalhos relacionados com o tema; Centros de Pesquisa e Universidades que mais publicaram e países onde foram realizados os estudos sobre DNA mitocondrial e glaucoma. RESULTADOS: Identificamos que esses estudos têm aumentado sobremaneira ao longo dos últimos anos, mas ainda se encontram confinados, na maior parte, a alguns centros de pesquisa e concentrados em seletos grupos de autores na área da oftalmologia em países desenvolvidos. No Brasil, ainda não temos pesquisas publicadas sobre o assunto até o momento. CONCLUSÃO: Esses estudos são de fundamental importância para a elucidação das causas genéticas do glaucoma e para o desenvolvimento de novas terapias que não visem tão somente a diminuição da pressão intraocular.

  8. PREVALÊNCIA DE DOENÇAS INFECCIOSAS EM REBANHO DE SUÍNOS CRIADOS AO AR LIVRE NA REGIÃO SUDOESTE DO PARANÁ, BRASIL PREVALENCE OF INFECTIOUS DISEASES IN A PIG BREEDING HERD RAISED OUTDOORS IN THE SOUTH-WESTERN REGION OF PARANÁ, BRAZIL

    Directory of Open Access Journals (Sweden)

    Laerte Francisco Filippsen

    2001-04-01

    Full Text Available O presente trabalho objetivou determinar a prevalência de doenças infecciosas em rebanho de suínos criados ao ar livre na região sudoeste do Paraná, no período de outubro de 1996 a junho de 1999. Foram examinados um total de 969 animais. Todas as ocorrências de enfermidades observadas nos animais foram registradas. Os animais mortos no período, além de um leitão por lote, sacrificado aos 28 dias pós-desmame, foram necropsiados. Amostras de sangue foram coletadas para realização de exames sorológicos para Aujeszky, parvovirose, leptospirose e brucelose. Foram coletadas amostras de fezes dos leitões com diarréia para realização de exames bacteriológicos. A principal causa de mortalidade em leitões lactentes criados ao ar livre foi o esmagamento. A prevalência de doenças infecciosas não foi elevada. A ocorrência mais freqüente foi diarréia em leitões lactentes. O índice de pneumonia no rebanho de suínos criados ao ar livre foi baixo. Não houve ocorrência de doenças infecciosas da reprodução.The aim of this work was to determine the prevalence of infectious diseases in an outdoor pig herd in the South-western region of Paraná, Brazil, from October 1996 to June 1999. A total of 969 animals were examined. All infections observed were registered. All animals found dead within the period of study and one piglet of each litter sacrified on the 28th post weaning day were autopsied. Blood samples were collected for Aujeszky, parvovirus, leptospirosis and brucellosis serological tests. Faecal samples from piglets with diarrhoea were taken for bacteriological tests. Crushing was the main cause of outdoor suckling piglets mortality. The prevalence of infectious diseases was not high. The most frequent occurrence in suckling piglets was diarrhoea. The pneumonia index in the herd raised outdoors was low. There was no occurrence of reproductive infectious diseases.

  9. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  10. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L. sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L. under air exposure stress

    Directory of Open Access Journals (Sweden)

    Roberta Dias da Silva

    2012-12-01

    Full Text Available No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM, a hemoglobina corpuscular média (HCM, a concentração de hemoglobina corpuscular média (CHCM, o leucograma, contagem diferencial de leucócitos, o plaquetograma, a glicose, a proteína total, o colesterol, o triglicerídeo e os eletrólitos (cálcio, cloretos, sódio e potássio. Os resultados revelaram que houve uma homogeneidade de distribuição para hemácias, volume globular, hemoglobina, índices hemantimétricos, proteína total, glicose, colesterol, e íons séricos, indicados pelos valores relativamente baixos do coeficiente de variação. Houve correlação positiva somente para leucócitos totais, células de defesa orgânica (neutrófilos e linfócitos, glicose, colesterol, sódio e cálcio. Quanto ao leucograma, à medida que os animais foram expostos ao ar, o número de leucócitos diminuiu gradativamente (leucopenia, ocorrendo simultaneamente neutrofilia e linfopenia. O índice glicêmico constituiu um bom indicador de estresse fisiológico, devido à hiperglicemia (82,0±20,88mg/dL demonstrada nos tratamentos. A exposição ao ar constituiu um fator de desequilíbrio na homeostase iônica, e na síntese de colesterol endógeno. Entretanto, o tempo de recuperação não ocasionou a completa reabilitação fisiológica frente ao desafio imposto.The present study evaluated the hematological and biochemical parameters of adult tilapia (Oreochromis niloticus under the influence of the physiological stress factor in animals submitted to air exposure during fattening in raceway system. Blood cell count, hemoglobin, hematocrit, mean corpuscular volume (MCV, mean

  11. Efeitos ambientais da produção de suínos ao ar livre: evolução e distribuição espacial das formas de P no solo e perdas de P na água de drenagem Environmental impact of outdoor pig production: soil P forms evolution spatial distribution and P losses in drainage waters

    Directory of Open Access Journals (Sweden)

    Carmo Horta

    2012-06-01

    Full Text Available A produção de suínos ao ar livre é considerada pelos consumidores como um modo de produção mais amigo do ambiente e do bem-estar animal. No entanto, os nutrientes contidos na ração e no "excreta" dos suínos são continuamente introduzidos no solo conduzindo a aumentos significativos desses nutrientes no solo, em especial do fósforo (P. Esta continua adição de P ao solo pode exceder a sua capacidade de retenção originando perdas significativas de P para as águas de drenagem e de escoamento superficial, contribuindo para a poluição difusa das águas superficiais. O principal objectivo deste trabalho foi avaliar o impacto da produção de suínos ao ar livre sobre o teor em P do solo avaliando a sua distribuição espacial e temporal, e avaliar também a perda de P através das águas de drenagem interna do solo. A unidade experimental de produção de suínos ao ar livre deste trabalho tem 2.8 ha, um declive entre 5 e 30% e uma carga animal de 9 adultos / ha. Observou-se um aumento do P do solo, quer do P biodisponível (P Olsen, P-Ol quer do P inorgânico (Pi ou orgânico (Po. No Inverno observaram-se elevadas perdas de P por erosão e escoamento superficial, mas ao longo do tempo observou-se um aumento global do P no solo. Um teor em P-Ol > 20 mg kg-1 originou um aumento significativo na perda de P para as águas de drenagem interna. Melhores práticas de maneio da unidade experimental, bem como uma escolha da área de produção menos susceptível à erosão, conduzirão a uma prevenção nos riscos de perda de P e na eutrofização das águas superficiais.When compared with intensive indoor production, outdoor pig production is considered by consumers as the production system that causes the least negative environmental effects and contributes to animal welfare. Nevertheless, the continuous input of nutrients in food or pig excretions, increases soil nutrients levels, as is the case with phosphorus (P. This continuous soil P

  12. Arsenic exposure assessment of children living in a lead mining area in Southeastern Brazil Avaliação da exposição de crianças ao arsênio em área de mineração de chumbo na Região Sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Alice Momoyo Sakuma

    2010-02-01

    Full Text Available Environmental contamination by arsenic compounds in the Ribeira River Valley, São Paulo, Brazil has already been observed. Lead mining and refining activities had been carried on since late colonial times and finished recently, at the end of 1995. The source of As in the region is known to be mainly from arsenopirite geological presence in the lead ore. Chronic exposure to arsenic compounds may cause peripheral vascular disorders, hyperpigmentation, hiperkeratosis and cancer of the skin, bladder, lung, liver and other internal organs. The purpose of this study was to assess children exposure to arsenic from environmental sources in the region. Urine samples from children between 7 to 14 years old were collected at the following localities: Cerro Azul (Paraná; urban areas of Ribeira (São Paulo and Adrianópolis (Paraná; Vila Mota neighborhood (rural area of Adrianópolis and Serra neighborhood (Iporanga, São Paulo, identified as groups 1, 2, 3 and 4, respectively. Group 1 was considered as non-exposed control group. Toxicologically relevant forms of As were determined by atomic absorption spectrometry with hydride generation system. The median values of urine arsenic levels obtained in groups 1, 2, 3 and 4 were respectively: 3.60, 6.30, 6.41 e 8.94μg/L.Contaminação ambiental por compostos de arsênio no Vale do Ribeira, São Paulo, Brasil, tem sido já observada. As atividades de mineração e refinamento do chumbo têm ocorrido desde a época colonial e foram encerradas recentemente, no final de 1995. A principal fonte de arsênio na região é arsenopirita que ocorre geologicamente no minério de chumbo. Exposição crônica aos compostos de arsênio podem causar desordens vasculares periféricas, hiperpigmentação, hiperqueratose, além de câncer de pele, bexiga, pulmão, fígado e outros órgãos. O objetivo do presente estudo foi avaliar a exposição de crianças ao arsênio proveniente de fontes ambientais na região. Amostras de

  13. THE AMBIGUOUS EXPERIENCE OF THE JOUISSANCE AND OF THE BODY IN THE NOVEL A CÉU ABERTO

    Directory of Open Access Journals (Sweden)

    Marcio Markendorf

    2010-07-01

    Full Text Available Taking as its object of study the book A céu aberto, written by João Gilberto Noll, this paper discusses the theme of ambiguity in contemporary literature. The analysis is focused on the evaluation of a doppelgänger body, indeterminate in relation to sexuality, gender and jouissance.

  14. O espaço político aberto pela leitura literária

    Directory of Open Access Journals (Sweden)

    Leonardo Pinto de Almeida

    2013-01-01

    Full Text Available O presente artigo se propõe questionar sobre o espaço político aberto pela leitura literária. Especificando a literatura como uma tentativa de compreensão de problemas relacionados à existência, sublinhamos como a leitura literária coloca em questão nossas convicções e verdades defendidas cotidianamente. Para tanto, compreendemos as relações tecidas entre a linguagem, o poder e a resistência no seio da experiência literária. Concluímos que a leitura literária é atravessada por formas de resistência às palavras de ordem que circulam de forma hegemônica em nossa sociedade, disponibilizando assim uma transformação em nossa rede afetiva e cognitiva.

  15. Impacto do sistema de aspiração traqueal aberto e fechado na incidência de pneumonia associada à ventilação mecânica: revisão de literatura Impact of the open and closed tracheal suctioning system on the incidence of mechanical ventilation associated pneumonia: literature review

    OpenAIRE

    Fernanda Maia Lopes; Marcelo Farani López

    2009-01-01

    A pneumonia é a infecção nosocomial mais comum em unidades de terapia intensiva, sendo a ventilação mecânica um fator fortemente associado ao seu desenvolvimento. O objetivo deste estudo foi descrever o impacto do sistema de aspiração traqueal aberto e fechado na incidência de pneumonia associada à ventilação mecânica. Realizou-se uma pesquisa na base de dados Pubmed para identificar tentativas controladas aleatórias, publicadas no período de 1990 a novembro de 2008. Nove estudos foram incluí...

  16. Papéis, conflitos e gratificações do enfermeiro de serviços abertos de assistência psiquiátrica

    Directory of Open Access Journals (Sweden)

    Raphael Valentino Marques de Lima

    2010-06-01

    Full Text Available Frente ao processo de transformação da assistência psiquiátrica, o papel de agente terapêutico é preconizado como um dos principais papéis do enfermeiro desta área específica, e, este estudo, objetivou identificar os papéis, conflitos e gratificações do enfermeiro de serviços abertos de assistência psiquiátrica. Trata-se de um estudo descritivo exploratório, onde foi utilizado um questionário, aplicado a onze enfermeiros dos serviços em questão, na cidade de Ribeirão Preto – São Paulo - Brasil. Os resultados mostraram que a maioria está na faixa etária entre 31 e 40 anos e possuem curso de especialização. Três cursaram mestrado e um cursou doutorado. Como papéis, destacaram os específicos do enfermeiro e os administrativos. Como conflitos, apontaram as condições de trabalho, a baixa remuneração, o não reconhecimento da sua liderança e a falta de recursos. O reconhecimento profissional e a reabilitação do portador de transtorno mental constituíram-se nas gratificações relatadas, permitindo concluir que esses enfermeiros identificam com propriedade o seu papel, apontam dificuldade para desempenhar parte deles, principalmente, frente às situações que enfrentam, identificam os seus conflitos e mostraram-se gratificados pelo reconhecimento da contribuição do seu trabalho na reabilitação do portador de transtorno mental, preservando, assim, certo idealismo relativo ao exercício de sua profissão.

  17. Open Access Serials: the High Dilution Research case. Publicaciones de acceso abierto: el caso de la investigación en altas diluciones Publicações de acesso aberto: o caso da pesquisa em altas diluições

    Directory of Open Access Journals (Sweden)

    Carlos Renato Zacharias

    2008-09-01

    ático, revisado por pares e de fácil acesso, capaz de alcançar parâmetros de alto impacto sem perder seu foco, onde os marcos de referência e conceitos teóricos possam ser apresentados e intensamente discutidos, abarcando do experimental ao teórico, pesquisa básica e aplicada, pesquisas clínicas, históricas e sociológicas. As características do sistema aberto se correspondem adequadamente com os requerimentos de um periódico para a comunidade ligada às altas diluições. Igualmente, o meio eletrônico permite divulgar textos e gráficos de maior tamanho, filmes, entrevistas, áudio e outros tipos de formatos multimedia. Por esse motivo, um periódico científico de acesso aberto dedicado às altas diluições seria muito bem recebido pela comunidade internacional. Palavras-chave: Acesso aberto, altas diluições, periódicos online.   Publicaciones de acceso abierto: el caso de la investigación en altas diluciones Resumen La publicación de acceso abierto parece ser el nuevo paradigma en publicación científica, representando una tendencia creciente en todos los segmentos de la sociedad. En particular, nos interesa la aplicación de este modelo en la investigación de altas diluciones. Tal área multidisciplinar está abierta a especialistas de todas las áreas del saber, necesitando aún ensayos y modelos experimentales, así como abordajes teóricos. Sin embargo, estos investigadores deben ser reunidos en torno de un periódico temático, revisado por pares y de fácil acceso, capaz de alcanzar parámetros de alto impacto sin perder su foco, adonde los marcos de referencia y conceptos teóricos puedan ser presentados e intensamente discutidos, abarcando desde lo experimental a lo te

  18. Análise fluido-dinâmica do escoamento em ensaio de permeabilidade ao ar de argamassas preparadas com cimento Portland de alto-forno Fluid-dynamic analysis of the flow in air permeability measurement of mortars prepared with blast-slag furnace Portland cement

    Directory of Open Access Journals (Sweden)

    V. M. Pereira

    2008-06-01

    Full Text Available O estudo dos fenômenos fluido-dinâmicos de escoamento em meios porosos tem sido de grande interesse por diversas áreas das ciências, de forma a se avaliar não só a permeabilidade do material, mas também analisar o comportamento do fluido permeante quando no interior destes materiais. Tratando-se de compósitos à base de cimento, a mensuração da permeabilidade torna-se fundamental para que sua durabilidade possa ser estimada, pois é a permeabilidade que controla a taxa de ingresso e movimentação de agentes deletérios no interior destes materiais. Dessa forma, diversas metodologias e equacionamentos matemáticos têm sido utilizados para prever a permeabilidade de materiais à base de cimento. No entanto, várias discrepâncias e disparidades nos resultados têm sido encontradas. Dentre as metodologias empregadas para mensurar a permeabilidade de meios porosos, encontra-se a desenvolvida por Thenoz, a qual tem demonstrado bons resultados em materiais à base de cimento. Dessa forma, este trabalho visa, por meio de ensaio de permeabilidade ao ar, realizado de acordo com a metodologia de Thenoz, avaliar o comportamento fluido-dinâmico do ar durante o ensaio de permeabilidade em argamassas. Para isto, foram utilizadas argamassas preparadas com dois tipos de cimento Portland (CP II E - 32 e CP III - 32, duas relações água/cimento (0,5 e 0,6 e ensaiadas em idades de 14 e 28 dias. Por meio dos resultados obtidos foi possível observar que durante o escoamento a compressibilidade do ar pode ser ignorada e o regime de escoamento pode ser considerado como laminar, demonstrando que a metodologia proposta por Thenoz e o equacionamento matemático empregado pode resultar em coeficientes de permeabilidade ao ar confiáveis, pois fenômenos e considerações que poderiam influenciar neste tipo de escoamento podem ser negligenciados.Fluid-dynamic phenomena study in porous media flow has been of great interest for diverse areas of sciences

  19. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  20. Sustentabilidade empresarial e o impacto no custo de capital próprio das empresas de capital aberto Sustainable development and consequences for equity costs in public companies

    Directory of Open Access Journals (Sweden)

    Lílian Simone Aguiar da Silva

    2006-12-01

    Full Text Available Este trabalho apresenta o impacto no custo de capital próprio para as empresas brasileiras de capital aberto face à adoção dos princípios de sustentabilidade. O conceito de desenvolvimento sustentável tem se aprimorado num processo contínuo de reavaliação da relação existente entre: crescimento econômico, a sociedade civil e o meio ambiente. O triple-bottom-line das dimensões econômica, ambiental e social da sustentabilidade tem emergido como um modelo de interpretação pelas empresas, embora cada uma dessas dimensões represente um grande desafio. O segmento corporativo vem atendendo às demandas cada vez maiores da sociedade frente a essas questões, ficando a dúvida quanto à legitimidade dessas ações e o questionamento relativo ao papel das empresas na economia e na sociedade. Para avaliar o impacto no custo de capital próprio, foi implementado um modelo de decomposição do beta em medidas contábeis de risco, incluindo uma variável referente à sustentabilidade. O resultado confirma a expectativa de que ao aderir aos padrões de sustentabilidade a empresa reduz o risco corporativo medido pelo risco sistemático, determinando a redução do custo de capital e aumento do valor econômico.This article provides an analysis of equity costs in Brazilian public companies regarding the adoption of sustainability principles. The concept of sustainable development has evolved considering the relation among economic growth, the society and the environment. The triple-bottom-line of economic, environmental, and social dimensions has emerged as an interpretation model by companies, although each of these dimensions may present a challenge. The corporate sector has faced an increasing demand from society regarding these sustainability concepts, though the actions and the role to be played by companies within this context are still being questioned. Equity costs were analyzed by a multivariate regression of beta on accounting measures

  1. Análise de vinte genótipos de sorgo (Sorghum bicolor (L.) Moench), de portes médio e alto, pertencentes ao ensaio nacional

    OpenAIRE

    Pesce Domingos Marcelo Cenachi; Goncalves Lúcio Carlos; Rodrigues José Avelino Santos; Rodriguez Norberto Mario; Borges Iran

    2000-01-01

    Os vinte genótipos de sorgo estudados foram cultivados e ensilados aos 104 dias de idade, em estádio de grão pastoso, em silos de laboratório de "PVC", com 10 cm de diâmetro e 40 cm de comprimento. Os silos foram abertos aos 150 dias após a ensilagem. O delineamento adotado foi o inteiramente casualizado. No material estudado (verde e ensilado), foram determinados os valores de fibra em detergente neutro (FDN), fibra em detergente ácido (FDA), hemicelulose, celulose, lignina, cinzas totais, m...

  2. MINERÍA A CÉU ABERTO: OS EMBATES DA COMUNA AFRODESCENDENTE PLAYA DE ORO, ESMERALDAS - EQUADOR

    OpenAIRE

    Janaina Lobo

    2014-01-01

    Antes de iniciar a narrativa sobre o caso da minería a céu aberto e seus efeitos na Comuna afrodescendente de Playa de Oro, eu gostaria de fazer alguns breves apontamentos sobre a eleição do lugar dessa pesquisa. Ou melhor, gostaria de situar o leitor nessa incursão etnográfica pelo Equador. Explico essa escolha: não é por acaso o meu deslocamento para uma comunidade negra na parte setentrional deste país que sequer faz fronteira com o Brasil. Por pelo menos dez anos eu estive envolvida entre...

  3. REGULARIDADE NO PAGAMENTO DE DIVIDENDOS E GOVERNANÇA CORPORATIVA: ESTUDO EM COMPANHIAS DE CAPITAL ABERTO LISTADAS NA BM&FBOVESPA

    Directory of Open Access Journals (Sweden)

    Ramon Kael Benassi Bachmann

    2012-08-01

    Full Text Available O objetivo deste estudo é verificar qual a relação entre nível de governança corporativa e regularidade do pagamento de dividendos das companhias de capital aberto listadas na BM&FBOVESPA, entre 2001 e 2010. Empresas listadas na bolsa compuseram três amostras, segregadas conforme (i pagamento de dividendos a acionistas ordinários, (ii preferenciais ou (iii dividendos totais pagos pela companhia. Para representar regularidade admitiu-se como métrica os coeficientes de variação (CV das séries de pagamento de dividendos das companhias, no período analisado. Para os níveis de governança corporativa foram atribuídas duas métricas: uma simples (NG, atribuindo 1 ponto por ano de enquadramento em algum dos níveis, o que considera-os em termos de tempo de enquadramento; e outra ponderada (NGP, atribuindo 1 ponto por ano de enquadramento no Nível 1 (N1, 2 pontos por ano no Nível 2 (N2 e 3 pontos por ano no Novo Mercado (NM, considerando tempo de enquadramento no nível de governança e tipo de nível. Na análise dos dados utilizou-se correlações de Pearson para verificar qual o tipo de relação entre CV e NG e entre CV e NGP, ambos para as 3 amostras. Os resultados indicam que o tempo de enquadramento em qualquer nível de governança, exceto o tradicional, tem relação inversa com regularidade de pagamento de dividendos, reafirmando possíveis gerenciamentos de resultados (income smoothing em companhias não enquadradas ou com pouco tempo de enquadramento. Constatou-se também que o tipo de nível de governança corporativa guarda relação apenas com a regularidade de pagamento de dividendos aos acionistas preferenciais.

  4. Produção e tolerância ao pendoamento de alface-romana em diferentes ambientes

    Directory of Open Access Journals (Sweden)

    Cárita Rodrigues de Aquino

    2014-08-01

    Full Text Available O experimento foi conduzido na área experimental da Universidade do Estado de Mato Grosso, localizada no município de Cáceres-MT, no período de maio a agosto de 2011, com o objetivo de avaliar a influência de diferentes ambientes e espaçamentos na produção e tolerância ao pendoamento de alface-romana cultivar Sophia. O delineamento experimental foi em blocos casualizados, arranjados em esquema fatorial 2 x 5, composto por dois espaçamentos (30 x 30 cm e 25 x 25 cm e cinco ambientes de cultivo (tela de sombreamento 30 e 50% , tela termorrefletora de 30 e 50% e ambiente aberto, perfazendo 10 tratamentos com quatro repetições cada. As parcelas experimentais foram constituídas por quatro linhas, com cinco plantas cada, totalizando 20 plantas por parcela. Consideraram-se como área útil para avaliação da produção as seis plantas centrais. As parcelas em que foi utilizado o espaçamento 30 x 30 cm apresentavam 1,8 m² cada, e as com o espaçamento 25 x 25 cm, 1,5 m² cada. As mudas foram transplantadas com 26 dias e a colheita realizada aos 46 dias após o transplantio. Observou-se que o espaçamento de 25 x 25 cm entre plantas e o ambiente aberto proporcionaram maior produtividade da alface-romana. Porém, o tempo para pendoamento das plantas no ambiente aberto foi menor que nos ambientes com as telas de sombreamento ou termorrefletora.

  5. Metodologia para validar IPS’s de código-fonte aberto

    OpenAIRE

    Trentin, Marco Antônio S; Linden, Gustavo S; Zandoná, Tomás Damo

    2004-01-01

    O presente trabalho tem por objetivo descrever uma metodologia para realizar testes com ferramentas IPS (Intrusion Prevention Systems). Essas ferramentas são mecanismos que são implementados como gateways (in-line) em uma rede de computadores para receber, analisar e encaminhar o tráfego para o seu destino. A análise é feita através da procura por pacotes que contenham assinaturas de ataques aos computadores da rede. Como se trata de uma nova tecnologia é necessário determinar métricas para a...

  6. Necessidades de qualificação da equipe de enfermagem para a assistência aos clientes portadores do HIV e da Aids Qualification needs of the nursing team for the assistance of Clients with HIV and Aids

    OpenAIRE

    Anna Luiza de Fátima Pinho Lins Gryschek; José Claudio Domingos; Cássio Rogério Dias Lemos Figueiredo; Lúcia Yasuko Izumi Nichiata; Leonida Maria Osório

    2000-01-01

    Discorre-se sobre as necessidades de qualificação específica das equipes de enfermagem dos Centros de Referência de Doenças Sexualmente Transmissíveis e Aids da Secretaria Municipal da Saúde de São Paulo, para a assistência aos clientes portadores do HIV e da Aids. Foram enviados questionários abertos, para todos os profissionais da equipe de enfermagem de todas as unidades do Programa Municipal de DST/Aids. Do total de 671 profissionais de enfermagem, 453 responderam ao questionário. Como ne...

  7. AO operations at Gemini South

    Science.gov (United States)

    Marin, Eduardo; Cardwell, Andrew; Pessev, Peter

    2014-08-01

    The 8m Gemini South telescope is entering an exciting new era of AO operations, which put it at the forefront of astronomical AO in terms of both wide field AO, and extreme-AO systems. Major milestones achieved were the successful commissioning of GeMS, in 2012, and GPI, in late 2013 and early 2014. Currently we are operating two of the worlds most advanced astronomical AO systems. Gemini, running primarily in queue, must balance the promise of AO with the demands of the community to use non-AO instruments. We discuss the current state of the two AO systems, and their operational models. The preparations that go into planning each AO run, the difficulties in scheduling around non-AO instruments, and the differences between scheduling LGS AO and non-LGS AO are discussed.

  8. Correlação entre a necrose de frutos associada ao Colletotrichum spp. com as características frutos por nó e produtividade entre genótipos de café arábica Correlation between fruit necrosis associated to Colletotrichum spp. with the fruits per node and yield traits of arabic coffee

    Directory of Open Access Journals (Sweden)

    Gustavo Hiroshi Sera

    2008-02-01

    Full Text Available O fungo Colletotrichum spp. vem sendo associado à graves perdas para a cafeicultura brasileira. Objetivou-se neste trabalho verificar a existência de relação entre a variável necrose de frutos associada ao Colletotrichum spp. ("COL" com a quantidade média de frutos por nó produtivo ("FN" e com a produção ("PRD" em genótipos de café arábica. O ensaio de campo foi realizado no IAPAR (Londrina, PR, Brasil em dezembro de 2004 e em cafeeiros com três anos de idade. A variável "COL" foi avaliada atribuindo-se notas de 1 a 5, onde 1 representam plantas com 0 % a 5 % de frutos necrosados. "FN" foi avaliada seguindo uma escala de notas de 1 a 5, onde 1 representa plantas com 0 a 3 frutos/ nó e nota 5 com mais do que 15 frutos/ nó. A avaliação visual subjetiva da produção foi estimada em litros de frutos em estádio cereja, por planta. A correlação de Pearson foi estimada para avaliar a existência de associações entre as variáveis. Foram observadas correlações positivas e significativas a 1 % entre "COL" e "FN" e entre "COL" e "PRD". A necrose de frutos foi mais intensa em cafeeiros com mais produção e com mais frutos por nó produtivo. Sugere-se que a avaliação da resistência de campo à necrose dos frutos associada à presença de Colletotrichum spp. seja realizada em cafeeiros com alta produção e com alta quantidade de frutos por nó produtivo.Different fungi species of genus Colletotrichum has been associated with losses to the Brazilian coffee crop. The aim of this research was to evaluate the association between the variable fruit necrosis associated to Colletotrichum spp. ("COL" with the fruits per productive node average ("FN" and between "COL" and the yield ("PRD" in Coffea arabica L. genotypes. The field assay was evaluated at IAPAR (Londrina, PR, Brazil, in December 2004 and on coffee trees with three years old. The "COL" variable was evaluated attributing scores from 1 to 5, where score 1 represents plants

  9. Exigências nutricionais da grápia ao fósforo e enxofre em Argissolo Vermelho distrófico arênico: efeito da adubação no crescimento Nutritional demand of grápia to phophorus and sulfur in paleaudalf soil: fertilization effects on growth

    Directory of Open Access Journals (Sweden)

    Evandro Luiz Missio

    2004-08-01

    Full Text Available A grápia (Apuleia leiocarpa Vog. Macbride é uma espécie de grande interesse madeireiro, encontrando-se, atualmente, bastante dizimada devido à exploração extrativista, sem haver reposição através de reflorestamento. O objetivo deste trabalho foi determinar os níveis ótimos de adubação de fósforo e enxofre no crescimento de plantas jovens de grápia. As plantas foram cultivadas em vasos contendo 3,5kg de solo Argissolo Vermelho distrófico arênico, sob condições de casa de vegetação não climatizada. O delineamento experimental foi o inteiramente casualizado com seis repetições. Foram avaliados 16 tratamentos em esquema bifatorial completo (4x4, representados pela combinação de quatro doses de P (0, 60, 120 e 180mg kg-1 e quatro de enxofre (0, 10, 20 e 30mg kg-1. A análise do crescimento das plantas foi realizada mensalmente através da altura da planta, diâmetro do caule e número de folhas remanescentes. Aos 130 dias após a emergência das plantas, avaliaram-se ainda o número de folhas caídas, matéria seca das folhas, caule, raízes e total da planta e a relação entre a matéria seca das raízes e da parte aérea. A produção de matéria seca total das plantas jovens de grápia respondeu positivamente à adubação conjunta de P e S, com dose de máxima eficiência técnica estimada de, respectivamente, 204 e 16mg kg-1 de solo. A adubação fosfatada na dose igual ou acima de 120mg kg-1 de solo induziu o aparecimento de clorose foliar típica da deficiência de Fe. A alta disponibilidade de P no solo favoreceu o crescimento da parte aérea em detrimento das raízes.Grápia (Apuleia leiocarpa Vog. Macbride is an important native forest species that has been in extinction process. The aim of this study was to determine the optimum levels of phosphorus and sulfur fertilization on the initial growth of grápia. Grápia plants were cultivated in pots containing 3.5kg of a Paleudalf soil, under unclimatized glasshouse

  10. AO Psc time keeping

    Science.gov (United States)

    Bonnardeau, Michel

    2015-07-01

    Eleven seasons, from 2004 to 2014, of photometric monitoring of the intermediate polar AO Psc are presented and are compared with previous observations. The spin up of the white dwarf is found to be slowing down. The amplitudes of the modulated and non-modulated components of the brightness are found to have undergone a major change in 2007.

  11. Impacto do sistema de aspiração traqueal aberto e fechado na incidência de pneumonia associada à ventilação mecânica: revisão de literatura Impact of the open and closed tracheal suctioning system on the incidence of mechanical ventilation associated pneumonia: literature review

    Directory of Open Access Journals (Sweden)

    Fernanda Maia Lopes

    2009-03-01

    Full Text Available A pneumonia é a infecção nosocomial mais comum em unidades de terapia intensiva, sendo a ventilação mecânica um fator fortemente associado ao seu desenvolvimento. O objetivo deste estudo foi descrever o impacto do sistema de aspiração traqueal aberto e fechado na incidência de pneumonia associada à ventilação mecânica. Realizou-se uma pesquisa na base de dados Pubmed para identificar tentativas controladas aleatórias, publicadas no período de 1990 a novembro de 2008. Nove estudos foram incluídos. Dos estudos revisados, sete não observaram redução significante da incidência de pneumonia associada à ventilação mecânica com o uso do sistema fechado comparado ao aberto, sendo que dois destes verificaram que o uso do sistema fechado resulta em incremento nas taxas de colonização sem incrementar sua incidência e um observou que o uso do sistema fechado não incrementa a colonização do trato respiratório e reduz a expansão de infecção resultando em redução nas taxas de sepse. Apenas dois estudos verificaram redução na incidência de pneumonia associada à ventilação mecânica com o uso do sistema fechado, e um destes revelou um risco 3.5 vezes maior de desenvolvimento desta infecção com o sistema aberto. Os resultados sugerem que o impacto do sistema de aspiração traqueal aberto e fechado é semelhante para o desenvolvimento da pneumonia associada à ventilação mecânica, assim a escolha do tipo de sistema de aspiração traqueal deve ser baseada em outros parâmetros. Entretanto, o sistema fechado aumenta o risco de colonização do trato respiratório, mas apresenta como vantagens a manutenção da ventilação mecânica e o menor prejuízo hemodinâmico.Pneumonia is the most common nosocominal infection in intensive care units and mechanical ventilation is a significant factor associated to its development. The objective of this study was to describe the impact of the open and closed tracheal suction

  12. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  13. Das políticas ao cotidiano: entraves e possibilidades para a educação do campo alcançar as escolas no rural De las políticas a la vida cotidiana: obstáculos y oportunidades para que la educación del campo alcance las escuelas rurales From policies to everyday life: barriers and opportunities for country education to access the rural schools

    Directory of Open Access Journals (Sweden)

    Ludmila Oliveira Holanda Cavalcante

    2010-09-01

    Full Text Available O presente artigo visa a trazer para o debate os questionamentos em torno da viabilidade das políticas de educação do campo nos territórios do rural brasileiro. Entre a política de direitos e a cultura de direitos, vale a reflexão de como a "educação do campo", ao alcançar o universo retórico e legalista das políticas educacionais brasileiras já no século XXI, pode de fato ser apropriada pelos (significativos pedaços do rural que não se encontram em "movimento" (este rural ainda sob a lógica da produção capitalista, muitas vezes inerte ao mundo de lutas e labutas dos movimentos sociais em diferentes cantos do Brasil nos últimos vinte anos. O texto aponta para a necessidade de aguçar o debate sobre questões importantes que circundam a educação do rural que se transforma em "campo" e que, ironicamente, pode estar ainda longe de ser implementada entre a noção de um campo ou outro.Este artículo pretende aportar al debate de los planteos relacionados con la viabilidad de las políticas de educación del campo en las zonas rurales de Brasil. Entre la política de derechos y la cultura de derechos vale la reflexión de cómo la "Educación del campo", al alcanzar el universo retórico y legalista de la política educativa brasileña ya en el siglo XXI, puede, de hecho, ser apropiada por partes (significativas de la población rural que no están en "movimiento" (este mundo rural, todavía bajo la lógica de la producción capitalista, muchas veces, ajeno al mundo de los afanes y las luchas de los movimientos sociales en los distintos rincones de Brasil en los últimos veinte años . El texto señala la necesidad de estimular el debate sobre cuestiones importantes de la educación de la zona rural que se convierte en "campo" y que, irónicamente, aún puede estar lejos de ser implementada entre la noción de un campo u otro.This present article aims to discuss the viability of country education policies at the rural territories

  14. Influência da temperatura e velocidade do ar na secagem de manjericão (Ocimum basilicum L. com relação aos teores de óleos essenciais e de linalol Influence of drying temperature and air velocity related to essential oil and linalol contents of the basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Rilvaynia Dantas Soares

    2007-08-01

    Full Text Available Neste trabalho, objetivou-se estudar a influência de quatro temperaturas de ar de secagem (40, 50, 60 e 70 ºC, em camada fina, e duas velocidades do ar (0,9 e 1,9 m/s sobre o teor de linalol do manjericão (Ocimum basilicum L. Utilizou-se um secador de bandejas especialmente desenvolvido, no laboratório de Secagem da UESB, Campus de Itapetinga-BA. Foram feitas quatro repetições, com 100 g de folhas frescas em cada uma das cinco bandejas da câmara de secagem. Na extração do óleo essencial, utilizou-se um sistema de destilação por arraste a vapor e a análise do óleo essencial foi realizada em um cromatógrafo conectado a um e espectrômetro de massa (CG-MS. Os maiores rendimentos de óleos essenciais de manjericão foram obtidos no processo de secagem com temperatura do ar igual a 40 ºC e 1,9 m/s de velocidade do ar. Os maiores rendimentos de linalol foram obtidos com temperatura do ar de secagem na faixa de 50 a 60 ºC e 1,9 m/s de velocidade do ar (2,23 e 2,47 ppm, respectivamente. Por análise de regressão, estimou-se que a temperatura de 54,4 ºC e a velocidade de 1,9 m/s forneceriam o maior rendimento de linalol. Concluiu-se que a composição química do óleo essencial do manjericão é afetada tanto pela temperatura como pela velocidade do ar de secagem.This work aimed to study the influence of four thin layer drying temperatures (40, 50, 60 and 70 ºC and two air velocities (0.9 and 1.9 m/s in the content of linalol of the Basil (Ocimum basilicum L.. It was used a tray dryer specially built for this experiment in the drying laboratory of the UESB at the "Campus de Itapetinga-Ba". There were made four repetitions with 100 g of fresh leaves in each one of the five trays in the dry chamber In the extraction of the essential oil, a vapor hauling system was used and the oil analysis was made in a gas chromatographer that was connected to a mass spectrometer (CG-MS. The greatest extracted profits of basil's essential oil were

  15. Sensibilidade da rosa 'Osiana' ao etileno

    Directory of Open Access Journals (Sweden)

    Delaine Cristina Cordeiro

    2011-01-01

    Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.

  16. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  17. do parasita ao ecossistema

    OpenAIRE

    Balazeiro, Clementina Furtado

    2011-01-01

    A triquinose é uma zoonose parasitária, cujo agente causal, um nemátode, pertence ao género Trichinella. Foram já identificadas e caracterizadas várias espécies pertencentes a este género, como T. spiralis, T. nativa, T. britovi, T. nelsoni, T. murreli, T. pseudospiralis, T. papuae e T. zimbabwensis bem como alguns genótipos, T6, T8, T9, e T12. A triquinose é uma doença transmitida por carnivorismo entre os seus hospedeiros. No Homem, a principal fonte de infecção é o consumo de carne infecta...

  18. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  19. Custo-utilidade do tratamento do glaucoma primário de ângulo aberto no Brasil

    Directory of Open Access Journals (Sweden)

    Ricardo Augusto Paletta Guedes

    2016-02-01

    Full Text Available RESUMO Objetivo: Determinar a estratégia mais custo-efetiva para o tratamento do glaucoma primário de ângulo aberto em fase inicial, comparando-se as seguintes alternativas: observação, tratamento clínico ou tratamento com laser. Métodos: Por meio de um modelo de Markov, sob a perspectiva do Sistema Único de Saúde (SUS e um horizonte da expectativa de vida média da população brasileira. Comparou-se a razão de custo-utilidade incremental (ICUR entre 3 alternativas de tratamento, assim como seus custos e o ganho em qualidade de vida, medido em QALY (Quality-adjusted life years. Resultados: A ICUR do tratamento inicial com laser e do tratamento inicial com colírios, em relação a não tratar foi de R$ 2.811,39/QALY e R$ 3.450,47/QALY, respectivamente. Ambas as estratégias foram custo-efetivas, com uma discreta vantagem para o tratamento a laser. Esta diferença diminui ainda mais quando se aumenta a idade de entrada no modelo. As duas alternativas propiciaram ganhos significativos de qualidade de vida (em torno de 2,5 QALYs para o tratamento com laser e de 5,0 QALYs para o tratamento com colírios. Conclusão: Tanto o tratamento primário com trabeculoplastia a laser quanto com medicações foram custo-efetivos e proporcionaram ganhos reais de qualidade de vida quando comparados com o não tratamento do GPAA.

  20. Grau de exposição a praguicidas organoclorados em moradores de aterro a céu aberto Levels of exposure to organochlorine pesticides in open-air dump dwellers

    Directory of Open Access Journals (Sweden)

    Eladio Santos Filho

    2003-08-01

    Full Text Available OBJETIVO: Estimar o grau de exposição interna aos praguicidas organoclorados (POP dos moradores de um atêrro a céu aberto. MÉTODOS: Estudo observacional, de aferição simultânea e controlado, cujo fator de estudo foi residir em área contaminada por POP e o efeito foi a concentração sanguínea dessas substâncias. A população de estudo foi de 238 pessoas residentes em um aterro a céu aberto (Pilões, no município de Cubatão, SP; e a população de controle ficou dimensionada em 258 pessoas, também residentes no mesmo município (Cota 200. Foram analisados os praguicidas HCB, p-p'DDT, p-p'DDE, p-p'DDD, o-p'DDT, a HCH; b HCH; g HCH; Aldrin; Dieldrin; Endrin; Heptaclor; Heptaclor-epoxi e Mirex. RESULTADOS: Os teores médios sangüíneos de HCB em Pilões foram de 4,66 µg/L, 155 vezes maior que a média na Cota 200 (0,03 µg/L. Em Pilões, os teores médios de DDT total foram de 3,71 µg/L, duas vezes maior do que na Cota 200 (1,85 µg/L e o HCH total apresentou concentrações sangüíneas seis vezes maiores em Pilões, 0,84 µg/L, contra 0,13 µg/L. CONCLUSÕES: Evidenciou-se associação positiva entre residir em Pilões e apresentar teores sangüíneos de POP, com risco muitas vezes maior quando comparado a localidades sem a presença desses contaminantes.OBJECTIVE: To estimate the degree of internal exposure to organochlorine pesticides (persistent organic pollutants, POP among inhabitants of an open-air dump. METHODS: This was an observational study with simultaneous measurement and control, in which the criterion for subjects was that they dwelled in an area contaminated by POP and the effect of such contamination was the concentration of such substances into the blood. The study population consisted of 238 people living on an open-air dump in Pilões, in the municipality of Cubatão, SP, Brazil, and the control population was formed by 258 people, also resident in that municipality, in the Cota 200 district. The following

  1. Seasonal dynamics of a drosophilid (Diptera assemblage and its potencial as bioindicator in open environments Dinâmica sazonal de uma assembléia de drosofilídeos (Diptera e seu potencial como bioindicadora em ambientes abertos

    Directory of Open Access Journals (Sweden)

    Luís Bizzo

    2010-09-01

    ção temporal na maioria dos grupos de espécies de Drosophila. O grupo D. willistoni foi mais abundante nos outonos, enquanto os grupos D. cardini e D. tripunctata foram, respectivamente, expressivos nos invernos e primaveras, e o grupo D. repleta em ambas as estações. As espécies exóticas D. simulans Sturtevant, 1919 (do grupo D. melanogaster e Zaprionus indianus Gupta, 1970 foram mais abundantes nos verões. Em geral, a estrutura desta assembléia não mostrou as mesmas características de ambientes florestais ou urbanos, mas mostrou-se similar às florestas nos invernos e aos urbanizados nos verões. Isto demonstra que esta localidade já pode estar sofrendo impacto da urbanização. Também, este pode ser interpretado como um local facilmente invadido por espécies exóticas, o que pode levar à homogeneização biótica e, portanto, pode por em cheque o uso de assembléias de drosofilídeos como bioindicadores em ambientes abertos.

  2. O combate ao escorpionismo

    Directory of Open Access Journals (Sweden)

    Octavio de Magalhães

    1946-09-01

    Full Text Available O outor estuda os processos de combate aos acidentes pelas picadas dos escorpiões, visando: a Profilaxia e b Terapêutica. Refere-se à luta nos campos e nas cidades e aqui, dentro e fora dos domicílios. Assinala os diferentes métodos para o combate a êsses artrópodos peçonhentos. Fala na luta direta, indireta, na vacinação pelo anaveneno, na propaganda pela educação racional da população contra o perigo dos acidentes. Refere-se à "cata" dos escorpiões, à luta química, ao emprêgo de animais escorpiófagos, á feitura de casas e jardins anti-escorpiões. Na primeira parte do presente trabalho o autor trata da luta química pelo d. D. T. contra os tityus bahiensis e serrulatus, concluindo que êste corpo químico é um poderoso elemento de luta contra êstes escorpiões. Na segunda parte do trabalho, o autor trata da terapêutica dos acidentes. Mostra a necessidade do emprêgo convenientemente da única terapêutica racional e eficaz contra a intoxicação escorpiônica: a soroterapia específica. Assinala a necessidade da injeção de doses maciças de um sôro de alta valência, preparado em bovídeos, para evitar o mais possível o choque anafilático, no menor tempo possível após as picadas. Aconselha o empêgo de anaveneno escorpiônico, para vacinação principalmente de crianças de baixa idade, nos lugares fortemente infestados pelos escorpiões (principalmente Tityus serrulatus, maximé quando no local não houver sôro anti-escorpiônico específico, como meio preventivo contra a gravidade das intoxicações. Cita finalmente os trabalhos recentes de Grasset, Shaasfsma e Hodgson, na África do Sul, que confirmam muitas idéias do autor e mostram a unidade universal do síndromo escorpiônico descrito no Brasil.

  3. Práticas de responsabilidade socioambiental nas empresas de capital aberto de Santa Catarina listadas na BM&FBOVESPA = Social responsibility practices in open capital companies from Santa Catarina listed on BM&FBOVESPA

    Directory of Open Access Journals (Sweden)

    Daniela Di Domenico

    2015-08-01

    Full Text Available Este artigo tem como objetivo identificar as práticas de ações de responsabilidade social corporativa das sociedades anônimas de capital aberto de Santa Catarina listadas na BM&FBovespa. A justificativa da pesquisa está atrelada à influência da evidenciação dessas informações para os investidores, pesquisadores e usuários das informações ambientais. Quanto aos procedimentos metodológicos o estudo caracteriza-se como exploratório quanto aos objetivos, documental em relação aos procedimentos e a abordagem do problema é predominantemente qualitativa. As empresas que fazem parte da amostra são: BRF S.A., BUETTNER S.A., CASAN, KARSTEN S.A e WEG S.A. Foram várias as práticas de responsabilidade social e ambiental evidenciadas, mas se pode identificar que todas têm como objetivo divulgar a empresa, além do objetivo principal da ação realizada. É possível destacar as principais práticas como sendo as ações e cuidados para o consumo consciente da água e energia, usando fontes que não sejam prejudiciais ao meio ambiente. Outra ação em destaque é o cuidado com a destinação dos resíduos sólidos e líquidos, gerados nos processos operacionais das empresas. A preocupação com a poluição da atmosfera também é evidente, por ser um dos principais problemas ambientais na atualidade.This article aims at identifying the practices of corporate social responsibility of corporations with open capital of Santa Catarina listed BM&FBovespa. The justification of this research is related to the influence of the disclosure of information for the investors, researchers and users of environmental information. In the methodological procedures, the study is characterized as exploratory as its goals, documental regarding the procedures and its approach to the problem is predominantly qualitative. The companies included in the sample are: BRF SA, BUETTNER SA, CASAN, KARSTEN SA and WEG SA. There were several social and environmental

  4. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  5. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  6. Criação intensiva de suínos em confinamento ou ao ar livre: estudo meta-analítico do desempenho zootécnico nas fases de crescimento e terminação e avaliação de carcaça e carne no Longissimus dorsi Intensive pig production in confinement or outdoor systems: a meta-analytical study of the production performance in the growing and finishing phases and carcass and meat evaluation from the Longissimus dorsi

    Directory of Open Access Journals (Sweden)

    Alice Bogoni Demori

    2012-07-01

    Full Text Available Uma meta-análise foi realizada para avaliar o desempenho e a qualidade de carcaça e carne de suínos em função do sistema de alojamento nas fases de crescimento/terminação. Foram selecionadas publicações indexadas com resultados de experimentos comparando variáveis de desempenho e de pós-abate de suínos alojados em sistemas intensivos convencionais ou ao ar livre. A base de dados contemplou 27 artigos publicados entre 1997 e 2009. Ao total, foram considerados 2.985 animais e 701 médias na análise de dados. A meta-análise foi realizada através de duas análises sequenciais: gráfica e de variância-covariância. O sistema de criação de suínos ao ar livre aumentou em 9% (P0,05 pelo sistema de alojamento dos suínos. Concluiu-se que o sistema de criação influencia no desempenho dos suínos, mas não interfere nas características de carcaça e carne estudadas.A meta-analysis was carried out to study performance and characteristics of carcass and meat in pigs in function of housing system during the growing/finishing period. Indexed publications with results of experiments comparing performance and post-slaughter variables of pigs housed in outdoor or conventional intensive systems were selected. In total, 2.985 animals and 701 averages were considered in the data analysis. Meta-analysis followed two sequential analyses: graphic and variance. The outdoor productive system increased in 9% (P0.05 by the housing system. It is concluded that the housing system influences the pig performance, but does not interfere in characteristics of carcass and meat.

  7. Teste de desencadeamento aberto no diagnóstico de alergia à proteína do leite de vaca Open challenge for the diagnosis of cow's milk protein allergy

    Directory of Open Access Journals (Sweden)

    Fernanda Ferreira Correa

    2010-04-01

    Full Text Available OBJETIVO: Relatar os resultados de testes de desencadeamento aplicados em crianças alimentadas com dieta de exclusão das proteínas do leite de vaca. DESCRIÇÃO: Estudo transversal que avaliou testes de desencadeamento oral aberto, com leite de vaca, realizados sob supervisão em ambiente hospitalar por 2,5 horas e ambulatoriamente por 30 dias quando não ocorreu reação imediata. Foram incluídos 121 pacientes, com idades entre 4 e 95 meses. O teste de desencadeamento com leite de vaca foi positivo em 28 (23,1% pacientes. Manifestação clínica de alergia ao leite de vaca diferente da apresentada por ocasião da suspeita diagnóstica ocorreu em 12 (42,9% pacientes com desencadeamento positivo. O desencadeamento positivo foi mais frequente (p = 0,042 nos pacientes alimentados com fórmulas extensamente hidrolisadas ou de aminoácidos (30,3% quando comparados com os alimentados com outras dietas de exclusão (14,5%. CONCLUSÃO: O teste de desencadeamento permitiu que fosse suspensa a dieta de exclusão de grande parte dos pacientes.OBJECTIVES: To report the results of open challenge tests performed in children fed with cow's milk-free diet. DESCRIPTIONS: Cross-sectional study evaluating cow's milk open challenge performed under supervision in a hospital setting during 2.5 hours and ambulatory follow-up for 30 days when no immediate reaction occurred. One hundred and twenty-one patients were included, with ages between 4 and 95 months. Cow's milk open challenge tests were positive in 28 patients (23.1%. A clinical manifestation of cow's milk allergy different from the one presented at diagnosis occurred in 12 (24.9% patients with positive challenge. Positive challenge was more frequent (p = 0.042 in patients fed with extensively hydrolyzed formulae or amino acid-based formulae (30.3% when compared to those fed with other exclusion diets (14.5%. CONCLUSION: Open challenge allowed the interruption of exclusion diet in a significant proportion

  8. Sistema aberto ou fechado de nutrição enteral para adultos críticos: há diferença? Open versus closed enteral nutrition systems for critically ill adults: is there a difference?

    Directory of Open Access Journals (Sweden)

    Stella Marys Rigatti Silva

    2012-04-01

    Full Text Available OBJETIVO: Comparar o volume, calorias totais e proteínas recebidos pelos pacientes críticos quando utilizada nutrição enteral (NE por sistema aberto (SA e sistema fechado (SF; identificar os principais motivos para interrupção da NE. MÉTODOS: Estudo de coorte em que foram acompanhados adultos internados no Centro de Terapia Intensiva (CTI em dois períodos: em novembro de 2009, quando se adotava SA de NE para a totalidade dos pacientes (n = 85; e entre outubro de 2010 e abril de 2011, quando foi utilizado SF de NE (n = 170. Foram utilizados testes paramétricos e não paramétricos para comparação das variáveis respeitando-se sua distribuição. RESULTADOS: Os grupos assemelharam-se quanto às características clínicas e demográficas. Diferenças de mínima magnitude matemática e de nenhuma relevância clínica foram observadas entre os grupos: mais calorias/quilo foram prescritas ao grupo SA (p OBJECTIVE: To compare the volume, total calories, and protein received by critically ill patients between open and closed enteral nutrition (EN systems and identify the main reasons for EN discontinuation. METHODS: A cohort study in which adult patients admitted to the intensive care unit (ICU were followed-up in two periods: throughout November 2009 with all patients (n = 85 receiving EN using the open system (OS group; and from October 2010 to April 2011 with patients (n = 170 receiving EN using the closed system (CS group. Parametric and nonparametric tests were used to compare the variables, taking into account their distribution. RESULTS: Demographic and clinical characteristics were similar in both groups. There were minor differences with no statistical significance between groups: more calories/kg were prescribed to the OS group (p < 0.001, and a higher volume (mL/kg, p = 0.002 and protein (g/kg, p = 0.001 were prescribed to the CS group. Fasting, enteral feeding or gastrointestinal problems, and performance of procedures and ICU

  9. Performance of cultivars of arugula under shade screens and open field /Desempenho de cultivares de rúcula sob telas de sombreamento e campo aberto

    Directory of Open Access Journals (Sweden)

    Sérgio Batista Silva de Souza

    Full Text Available Considering the increasing economic importance and due to the lack of technical information for growing arugula in tropical regions, it was evaluated the performance of arugula cultivated under different shade screens and at open field. Eight treatments were evaluated in a 2x4 factorial design, with two cultivars (Cultivada and Folha Larga x four crop environments (open field, greenhouse shading with 30%, 40% and 50%, with four replications in randomized blocks. The evaluated were plant height, leaf number, fresh and dry matter of the above ground part. Cultivars Folha Larga and Cultivada, showed satisfactory yield: that production in the open field showed acceptable values, showing viable cultivation in the winter in Cáceres-MT, even in warm temperatures, especially for early harvest at around 37 days after sowing. However, cultivation of arugula is favored using 50% shade screen, which can increase the production about 43%.Pelo crescente aumento da importância econômica e perante a escassez de informações técnicas para o cultivo da rúcula em regiões tropicais, avaliou-se o desempenho de rúcula cultivada sob diferentes telados de sombreamento e a campo aberto. Foram avaliados oito tratamentos em esquema fatorial 2x4, sendo duas cultivares (Cultivada e Folha Larga x quatro ambientes de cultivo (campo aberto, telado com sombrite 30%, 40% e 50% com quatro repetições, em blocos casualizados. As características avaliadas foram altura da planta, número de folhas e massas de matéria fresca e de matéria seca parte aérea. Foi observado que as cultivares Folha Larga e Cultivada apresentaram produção satisfatória: a produção em campo aberto apresentou valores aceitáveis, mostrando-se viável o cultivo no período de inverno em Cáceres-MT, mesmo sob temperaturas cálidas, principalmente para colheitas antecipadas por volta dos 37 dias após a semeadura. Porém, o cultivo de rúcula é favorecido sob tela preta 50%, que pode

  10. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  11. Progressão atípica de perda visual em paciente com glaucoma primário de ângulo aberto

    Directory of Open Access Journals (Sweden)

    Marcelo Mendes Lavezzo

    2014-01-01

    Full Text Available A dolicoectasia da artéria carótida interna (ACI é uma condição rara que pode ser acompanhada de manifestações neuro-oftalmológicas, como perda da acuidade e alteração do campo visual decorrente da compressão do nervo óptico (NO. O objetivo é relatar um caso de paciente do sexo masculino, 67 anos, portador de glaucoma primário de ângulo aberto (GPAA com evolução atípica, assimetria de escavação, palidez da rima do NO à esquerda, devido à neuropatia óptica compressiva à esquerda, por segmento dolicoectásico da ACI. O diagnóstico foi baseado na história clínica, aspecto do NO e exames de neuroimagem.

  12. A POTÊNCIA DIDÁTICA DOS RECURSOS EDUCACIONAIS ABERTOS PARA A DOCÊNCIA NA CONTEMPORANEIDADE. THE DIDACTICAL FRUITFULNESS OF OPEN EDUCATIONAL RESOURCES FOR TEACHING NOWADAYS

    OpenAIRE

    Lucila Pesce

    2013-01-01

    O presente artigo discute sobre a fecundidade didática dos recursos educacionais abertos (REA), para a docência na contemporaneidade, trazendo uma reflexão, a partir da contextualização política e cultural, em consonância com a necessária leitura crítica das tecnologias da informação e comunicação (TIC). Inicia com um panorama do atual contexto político brasileiro sobre formação de professores para o uso pedagógico das TIC. Prossegue com um brevíssimo delineamento de alguns dispositivos digit...

  13. Recursos Educacionais Abertos (REA: modelos para localização e adaptação / Open educational resources (OER: models for adaptation and localization

    Directory of Open Access Journals (Sweden)

    Tel Amiel

    2011-04-01

    Full Text Available Neste artigo apresentamos questões relativas à localização e adaptação de recursos educacionais digitais. Começamos com uma discussão sobre objetos de aprendizagem (OA e recursos educacionais abertos (REA. Apresentamos três estratégias que podem auxiliar designers, professores e usuários a refletir sobre a possibilidade de reuso, localização, e adaptação cultural de recursos educacionais digitais.AbstractIn this article we present concerns regarding localization of digital educational resources. We begin with a discussion regarding learning objects (LO and open educational resources (OER. Finally we present three strategies that can help designers, teachers, and users to think about the reuse, localization, and cultural repurposing of digital educational resources.

  14. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  15. Pulsed discharge production Ar* metastables

    Science.gov (United States)

    Han, Jiande; Heaven, Michael C.; Emmons, Daniel; Perram, Glen P.; Weeks, David E.; Bailey, William F.

    2016-03-01

    The production of relatively high densities of Ar* metastables (>1012 cm-3) in Ar/He mixtures, at total pressures close to 1 atm, is essential for the efficient operation of an optically pumped Ar* laser. We have used emission spectroscopy and diode laser absorption spectroscopy measurements to observe the production and decay of Ar* in a parallel plate pulsed discharge. With discharge pulses of 1 μs duration we find that metastable production is dominated by processes occurring within the first 100 ns of the gas break-down. Application of multiple, closely spaced discharge pulses yields insights concerning conditions that favor metastable production. This information has been combined with time-resolved measurements of voltage and current. The experimental results and preliminary modeling of the discharge kinetics are presented.

  16. Uma leitura da Carta ao pai de Kafka

    Directory of Open Access Journals (Sweden)

    Filipe Pereirinha

    2015-02-01

    Full Text Available ResumoPode uma carta chegar ao seu destino mesmo quando não é enviada? A Carta ao pai, de Kakfa, serve-nos aqui de balão de ensaio para esboçar uma possível resposta a esta questão. Não se trata, porém, de ler esta carta como se ela traduzisse finalmente, ao pé da letra, o conflito edipiano entre Kafka e o seu pai, mas antes de ver neste suposto conflito – e seus impasses – o limiar de outra coisa bem mais real. Palavras-chave: Kafka; Lacan; letra; sintoma; realFilipe Pereirinha é membro da Antena do Campo Freudiano (ACF - Portugal, associação psicanalítica ligada à New Lacanian School (NLS e à Associação Mundial de Psicanálise (AMP. O seu encontro com a psicanálise de orientação lacaniana aconteceu durante a licenciatura em Filosofia, na Universidade Nova de Lisboa (UNL, e foi determinante no rumo posterior dos seus estudos, tanto ao nível do mestrado em Filosofia, com uma tese sobre o desejo em Deleuze e Lacan, como ao nível do doutoramento em Filosofia Moderna e Contemporânea, com uma tese sobre a questão do sujeito em Lacan. Foi Professor e Investigador na Universidade Lusófona (ULHT, onde esteve ligado, em particular, desde a sua criação, ao Centro de Estudos de Psicanálise (CEP. Tem vários artigos publicados em livros e revistas, nomeadamente em Portugal, França e Brasil. Destacam-se os livros Psicanálise & Arredores e Uma Pedra no Caminho (no prelo. Está em preparação uma coletânea com os artigos mais recentes.

  17. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    Directory of Open Access Journals (Sweden)

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  18. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  19. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  20. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscien...cedbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscien

  1. MEMS AO for Planet Finding

    Science.gov (United States)

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; Jung, Paul

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  2. 40Ar/39Ar dating of Daqingshan thrust

    Institute of Scientific and Technical Information of China (English)

    LIU Zhenghong; XU Zhongyuan; YANG Zhensheng

    2003-01-01

    The Daqingshan thrust system, to the south of the Shiguai Mesozoic basin, is a complex system of top-to- the-north thrusting tectonic sheets. The thrust system has a complicated evolution due to multi-stage thrusting. In order to date the thrusting events, syntectonic muscovite and biotite grains are respectively analyzed with normal 40Ar/39Ar dating and laser 40Ar/39Ar dating, which yield 2 isochron ages, i.e. 193.74 ± 3.88 Ma and 121.6 ± 1.6 Ma. These ages suggest that faults within the Daqingshan thrust system formed during 2 stages of thrusting, one the early Indosinian and the other the late Yanshanian. The isotopic dating is consistent with field geological relations. Indosinan deformation is evidenced by top-to-the-north thrusting, with the occurrence of a series of large-scale east-west trending thrust faults and folds, while the Yanshanian thrusting is characterized by top-to-the-NNW thrusting. It is superposed on and modifies early Indosinian thrust faults.

  3. Comparação entre os tratamentos aberto e endovascular dos aneurismas da aorta abdominal em pacientes de alto risco cirúrgico Comparison between open and endovascular treatment of abdominal aortic aneurysms in high surgical risk patients

    Directory of Open Access Journals (Sweden)

    Célio Teixeira Mendonça

    2005-09-01

    Full Text Available OBJETIVO: Comparar os resultados dos tratamentos aberto e endovascular de aneurismas da aorta abdominal em pacientes de alto risco cirúrgico. MÉTODOS: O tratamento aberto foi realizado em 31 pacientes, e o endovascular, em 18. Sucesso no tratamento endovascular foi definido como perviedade da endoprótese sem endoleaks ou conversão para tratamento aberto. RESULTADOS: Não houve diferença na mortalidade perioperatória entre o tratamento aberto (dois óbitos [6,45%] em 31 e o endovascular (um óbito [5,55%] em 18 (P = 0,899; também não houve diferença entre a mortalidade tardia no tratamento aberto (dois óbitos [6,9%] em 29 e no endovascular (dois óbitos [11,7%] em 17 (P = 0,572. A taxa de sucesso imediato foi de 100% (31/31 no tratamento aberto e de 66,7% (12/18 no endovascular (P = 0,0006; a taxa de sucesso tardio foi de 100% (27/27 no tratamento aberto e de 73,3% (11/15 no endovascular (P = 0,0047. Os valores médios do tempo de internação na UTI, tempo de internação hospitalar e da perda de sangue para os grupos dos tratamentos aberto e endovascular foram: 65,6 versus 34,1 horas*, 9 versus 5,6 dias* e 932 versus 225 ml*, respectivamente (*P OBJECTIVE: To compare the results of open repair and endoluminal repair of abdominal aortic aneurysms in high surgical risk patients. METHODS: Open repair was performed in 31 patients, and endoluminal repair was performed in 18. Success in the endoluminal repair group was defined as continuing graft function without endoleak or conversion to open repair. RESULTS: No significant difference was found between the perioperative mortality rate for open repair (two deaths [6.45%] in 31 patients and endoluminal repair (one death [5.55%] in 18 patients (P = 0.899; similarly, no significant difference was seen in late mortality between open repair (two deaths [6.9%] in 29 patients and endoluminal repair (two deaths [11.7%] in 17 patients (P = 0.572; The rate of immediate success was 100% (31/31 for

  4. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  5. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  6. Estudo terapêutico aberto com sulfato de aminosidine na leishmaniose mucosa causada for Leishmania (viannia braziliensis

    Directory of Open Access Journals (Sweden)

    Gustavo A.S. Romero

    1996-12-01

    Full Text Available No período de setembro a novembro de 1994 foram tratados 21 pacientes com leishmaniose mucosa ativa, predominantemente adultos lavradores do sexo masculino, com sulfato de aminosidine intramuscular, I6mg/kg/dia por 20 dias. Treze pacientes eram virgens de tratamento e 8 haviam sido tratados sem sucesso com Glucantime®". O diagnóstico baseou-se inicialmente em crítêrios epidemiolôgicos, clínicos e nos resultados da intrademoireação de Montenegro e a imunofluorescência indireta para anticoipos séricos antileishmânia e durante o acompanhamento nos resultados dos estudos parasitológicos. Sessenta e sete por cento dos pacientes tiveram diagnóstico parasitológico confirmado sendo a inoculação do material de biópsia das lesões em hamsters o método mais sensível. O tempo médio de acompanhamento foi de 12,6 meses. A adesão ao tratamento foi de 100%. Os efeitos colaterais foram dor no local da injeção (86%, proteinúria leve (24%, elevação do nível sérico de creatinina (5% e perda auditiva subclínica em um dos dois pacientes que realizaram audiometria. Obsevou-se cura clínica em 48% dos pacientes e a percentagem acumulada de recidiva foi de 29% (4/14pacientes durante o acompanhamento.

  7. Restrição materna de polifenóis e dinâmica ductal fetal na gestação normal: um ensaio clínico aberto

    Directory of Open Access Journals (Sweden)

    Paulo Zielinsky

    2013-09-01

    Full Text Available FUNDAMENTOS: Recentemente demonstramos reversão da constrição ductal fetal após redução da ingesta materna de alimentos ricos em polifenóis (ARP, por sua ação inibidora da síntese das prostaglandinas. OBJETIVOS: Testar a hipótese de que fetos normais no 3º trimestre também melhoram a dinâmica ductal após restrição materna de polifenóis. MÉTODOS: Ensaio clínico aberto com 46 fetos com idade gestacional (IG > 28 semanas submetidos a dois estudos Dopplerecocardiográficos com intervalo de duas semanas, sendo os examinadores cegados para os hábitos alimentares maternos. Um questionário de frequência alimentar validado para esse objetivo foi aplicado e uma dieta com alimentos pobres em polifenóis (< 30 mg/100 mg foi orientada. Um grupo controle de 26 fetos no 3º trimestre foi submetido ao mesmo protocolo. Utilizou-se o teste-t para amostras independentes. RESULTADOS: A IG média foi 33 ± 2 semanas. A média do consumo materno diário de polifenóis (CMDP foi 1277 mg, caindo para 126 mg após orientação (p = 0,0001. Ocorreu diminuição significativa nas Velocidades Ductais Sistólica (VSD e Diastólica (VDD e na relação dos diâmetros ventriculares (VD/VE, assim como aumento do índice de pulsatilidade (IP [VSD = 1,2 ± 0,4 m/s (0,7-1,6 para 0,9 ± 0,3 m/s (0,6-1,3 (p = 0,018;VDD = 0,21 ± 0,09 m/s (0,15-0,32 para 0,18 ± 0,06 m/s (0,11-0,25 (p = 0,016; relação VD/VE = 1,3 ± 0,2 (0,9-1,4 para 1,1 ± 0,2 (0,8 - 1,3 (p = 0,004; IP do ducto = 2,2 ± 0,03 (2,0-2,7 para 2,4 ± 0,4 (2,2-2,9 (p = 0,04]. A IG média dos controles foi de 32 ± 4 semanas, não ocorrendo diferenças significativas no CMDP, nas velocidades ductais, no IP do ducto e na relação VD/VE. CONCLUSÃO: A restrição da ingesta de alimentos ricos em polifenóis no 3º trimestre por duas semanas melhora a dinâmica do fluxo no ducto arterioso fetal e as dimensões do VD.

  8. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  9. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  10. Combate ao niilismo e ao totalitarismo em Camus

    Directory of Open Access Journals (Sweden)

    Emanuel Ricardo Germano

    2013-05-01

    Full Text Available A partir de uma leitura da peça Calígula, elaborada entre 1941 e 1943, procurar-se-á contribuir na restituição das preocupações éticas, políticas e filosóficas em cena no teatro de Albert Camus, analisando o sentido de sua expressão teatral no contexto de dois combates,ao niilismo filosófico e ao totalitarismo político de seu tempo. Observaremos em Calígula um importante registro do amadurecimento das leituras de duas heranças filosóficas relevantes na formação intelectual de Camus, Nietzsche e Heráclito, à luz da experiência do totalitarismo, observando e ressaltando com isso a amplitude de seu intertexto filosófico e a importância do aporte ético e político de Camus como pensador multifacetado, engajado nos enfrentamentos históricos e solicitações críticas de seu tempo.

  11. What to teach to patients with heart failure and why: the role of nurses in heart failure clinics ¿Qué enseñar a los pacientes con insuficiencia cardiaca y por qué?: el papel de los enfermeros en clínicas de insuficiencia cardíaca O que ensinar aos pacientes com insuficiência cardíaca e por quê: o papel dos enfermeiros em clínicas de insuficiência cardíaca

    Directory of Open Access Journals (Sweden)

    Eneida Rejane Rabelo

    2007-02-01

    ón para el manejo de la enfermedad y el desarrollo de la capacidad de autoayuda. En este artículo revisaremos en detalle aspectos de la educación para pacientes con insuficiencia cardiaca dada por enfermeros.O principal objetivo do tratamento da insuficiência cardíaca (IC consiste em alcançar e manter a estabilidade clínica dos pacientes. Vários estudos demonstram que programas multidisciplinares para educação sistemática sobre a doença são estratégias positivas para estes pacientes. Enfermeiros engajados em clínicas de IC desempenham papel fundamental no processo de educação e acompanhamento dos pacientes. Os objetivos deste processo são ensinar, reforçar, melhorar e avaliar constantemente as habilidades dos pacientes para o autocuidado, que incluem a monitorização do peso, a restrição de sódio e de líquidos, a realização de atividade física, o uso regular das medicações, a monitorização de sinais e de sintomas de piora da doença e o contato precoce com a equipe assistencial. Desta forma, a educação para o entendimento da IC, e o desenvolvimento de habilidades para o autocuidado, são considerados chaves para melhorar a adesão, evitar crises de descompensação e conseqüentemente manter a estabilidade clínica dos pacientes. Neste artigo nos revisamos detalhadamente os aspectos envolvidos no processo de educação dispensados aos pacientes por enfermeiros no contexto das clínicas de IC.

  12. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  13. Occurrences of Excess 40Ar in Hydrothermal Tourmaline:Interpretations from 40Ar-39Ar Dating Results by Stepwise Heating

    Institute of Scientific and Technical Information of China (English)

    QIU Huaning; PU Zhiping; DAI Tongmo

    2007-01-01

    The occurrences of excess 40Ar within a hydrothermal tourmaline is discussed in term of the analysis data of syngenetic muscovite and tourmaline from the Lushui hydrothermal tin-tungsten deposit in western Yunnan, China, using the 40Ar-39Ar stepwise heating technique. About 80% excess 40Ar was released in the last step when the tourmaline was fused, corresponding to a release of only ~3% 39Ar (K), which indicates that most excess 40Ar was held in the mineral lattice rather than in the channels parallel to the Z-axis. This suggests that the excess 40Ar was incorporated during crystallization and not diffused into the tourmaline during the post-crystallization history.

  14. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    , but more precise (±0.10%) than, the previous 40Ar/39Ar age determined by intercalibration with astronomically tuned tephras from the Melilla Basin (Morocco). Using this proposed age for FCs, combined with measurements using the A1Ts as the neutron fluence monitor, a weighted mean Bishop Tuff 40Ar/39Ar...

  15. Template do programa Arena para simulação das operações de carregamento e transporte em minas a céu aberto

    Directory of Open Access Journals (Sweden)

    Augusto Nogueira Ramos Neto

    2004-03-01

    Full Text Available Esse artigo descreve um conjunto de módulos, do Template Mineração 1.0, que foi desenvolvido para utilização no programa ARENA, visando a melhorar a modelagem e a simulação de operações de carregamento e transporte em minas a céu aberto. Os módulos representam atividades de lavra, tais como carga, descarga, deslocamento vazio e carregado dos caminhões, além de paradas para manutenção dos equipamentos. Os sistemas de alocação dinâmica de caminhões, atualmente presentes em boa parte das minas, também possuem um módulo específico. Através de testes realizados com dados reais, o Template mostrou-se de uso bastante amigável e apresentou resultados satisfatórios quando comparado com a operação real e com resultados de outro simulador.This article describes a group of blocks of Template Mining 1.0, developed to be used with ARENA System. The objective is to improve modeling and simulation of open pit mining operations. The blocks represent the essential activities of open pit mining, like loading, unloading, loaded and unloaded haulage and equipment maintenance. The dynamic allocation system of trucks, nowadays used in the mining companies can also be represented. The Template has a friendly interface and it has been tested with real data. These tests have produced satisfactory results, which are similar to other simulation system.

  16. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  17. Paleozoic accretionary orogenesis in the eastern Beishan orogen: constraints from zircon U-Pb and 40Ar/39Ar geochronology

    Science.gov (United States)

    Ao, Songjian; Xiao, Wenjiao; Windley, Brian; Mao, Qigui

    2016-04-01

    The continental growth mechanism of the Altaids in Central Asia is still in controversy between models of continuous subduction-accretion versus punctuated accretion by closure of multiple oceanic basins. The Beishan orogenic belt, located in the southern Altaids, is a natural laboratory to address this controversy. Key questions that are heavily debated are: the closure time and subduction polarity of former oceans, the emplacement time of ophiolites, and the styles of accretion and collision. This paper reports new structural data, zircon ages and Ar-Ar dates from the eastern Beishan Orogen that provide information on the accretion process and tectonic affiliation of various terranes. Our geochronological and structural results show that the younging direction of accretion was northwards and the subduction zone dipped southwards under the northern margin of the Shuangyingshan micro-continent. This long-lived and continuous accretion process formed the Hanshan accretionary prism. Our field investigations show that the emplacement of the Xiaohuangshan ophiolite was controlled by oceanic crust subduction beneath the forearc accretionary prism of the Shuangyingshan-Mazongshan composite arc to the south. Moreover, we address the age and terrane affiliation of lithologies in the eastern Beishan orogen through detrital zircon geochronology of meta-sedimentary rocks. We provide new information on the ages, subduction polarities, and affiliation of constituent structural units, as well as a new model of tectonic evolution of the eastern Beishan orogen. The accretionary processes and crustal growth of Central Asia were the result of multiple sequences of accretion and collision of manifold terranes. Reference: Ao, S.J., Xiao, W., Windley, B.F., Mao, Q., Han, C., Zhang, J.e., Yang, L., Geng, J., Paleozoic accretionary orogenesis in the eastern Beishan orogen: Constraints from zircon U-Pb and 40Ar/39Ar geochronology. Gondwana Research, doi: http://dx.doi.org/10.1016/j

  18. Lévi-Strauss nos 90 voltas ao passado

    Directory of Open Access Journals (Sweden)

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  19. PF-AR upgrading project

    CERN Document Server

    Kasuga, T

    2002-01-01

    The upgrading project of the dedicated pulse X-ray source PF-AR has been completed by the end of the 2001 fiscal year. Machine commissioning exclusively using the injector linac was successfully accomplished in the beginning of January 2002. After fine tuning of the machine and cleaning of the vacuum system with the beams from the middle of January to the middle of March, routine operation for users has begun in April. The historical details, commissioning and results of the project are reported. (author)

  20. Aerosol Observing System (AOS) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  1. Avaliação da eficácia do bimatoprosta 0,03% (Glamigan, Germed, Brasil na redução da pressão intraocular em pacientes com glaucoma primário de ângulo aberto e hipertensão ocular

    Directory of Open Access Journals (Sweden)

    Juliana Almodin

    2012-08-01

    Full Text Available OBJETIVO: Avaliar a eficácia do colírio bimatoprosta 0,03% (Glamigan, Germed, Brasil na redução da pressão intraocular (PIO em pacientes com glaucoma primário de ângulo aberto (GPAA ou hipertensão ocular (HO, bem como avaliar os efeitos colaterais decorrentes do uso da droga no desenho epidemiológico randomizado, controlado. MÉTODOS: Foram avaliados pacientes portadores de GPAA ou HO, acima de 18 anos de idade. Todos os pacientes receberam o colírio Glamigan® como primeira droga a ser introduzida no tratamento, tendo sido utilizada uma gota uma vez ao dia (à noite, e 30 dias após foram submetidos à tonometria de aplanação (Goldmann para mensuração da PIO. RESULTADOS: A amostra do estudo foi composta por 35 (66 olhos pacientes portadores de GPAA e HO, sendo 16 do sexo masculino (45,7% e 19, do feminino (54,3%. A média de idade foi de 66,7 anos, sendo a idade máxima 84 anos. A média de redução da PIO após 30 dias de uso do Glamigan® foi de 6,5mmHg. Em relação aos efeitos colaterais, 17 (26,6% pacientes referiram hiperemia conjuntival, 10 (15,6% a dor, 8 (12,5% o ardor, 5 (7,8% o prurido ocular e 2 (3,1% o embaçamento visual. CONCLUSÃO: A medicação Glamigan® foi eficiente na redução da PIO após 30 dias de uso contínuo, na dose de 1x/dia. Acerca dos efeitos colaterais, os mais observados foram hiperemia ocular (26,6% e dor (15,6%, porém estudos com maior tempo de seguimento dos pacientes se fazem necessários a fim de investigar a importância daqueles na terapia com o Glamigan®.

  2. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  3. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  4. Acesso aberto à informação científica: políticas e iniciativas governamentais Acceso abierto a la información científica: políticas e iniciativas gobernamentales

    Directory of Open Access Journals (Sweden)

    Adriana Rosecler Alcará

    2010-03-01

    Full Text Available Trata das políticas de acesso aberto à informação científica e das propostas de ação com ênfase para as iniciativas governamentais em diferentes países. Descreve as recomendações da Unesco e da IFLA. Identifica as principais iniciativas, ações e recomendações internacionais. Finaliza evidenciando peculiaridades de áreas e de formas de tratamento da questão nas políticas já estabelecidas.

  5. POTENCIAL DOS RECURSOS EDUCACIONAIS ABERTOS PARA INTEGRAÇÃO DAS TECNOLOGIAS E CONVERGÊNCIA ENTRE AS MODALIDADES NA UFSM. POTENTIAL OF OPEN EDUCATIONAL RESOURCES FOR TECHNOLOGY INTEGRATION AND CONVERGENCE BETWEEN THE MODALITIES AT UFSM

    Directory of Open Access Journals (Sweden)

    Elena Maria Mallmann

    2013-11-01

    Full Text Available O foco de análise é a implementação e o fomento de práticas escolares, para potencializar a integração das tecnologias e a convergência entre as modalidades na Universidade Federal de Santa Maria (UFSM, Brasil, por meio de Recursos Educacionais Abertos. Objetivamos sistematizar princípios conceituais e práticas que balizam a utilização de recursos educacionais abertos, com vistas a maximizar diálogo e produção curricular mediados por tecnologias. Os procedimentos metodológicos de pesquisa-ação (planejamento participativo, observação e questionários survey geraram dados para análise referente à programação e à problematização de Recursos Educacionais Abertos, em cursos de graduação e pós-graduação mediados pelo Moodle institucional. Os resultados de acoplamento da pesquisa à ação didático-metodológica inovadora na UFSM evidenciam crescimento exponencial na programação semanal de recursos e atividades de estudo no Moodle. A afirmação conclusiva destaca que a disponibilização e o suporte técnico institucional de tecnologias em rede ampliam condições para integração e convergência entre as modalidades, especialmente no âmbito dos recursos educacionais abertos como hipertextos programados em html. The analysis focus is the implementation and the fomentation of school practices in order to enhance the technology integration and the convergence between the modalities at the Federal University of Santa Maria (UFSM, Brazil, through open educational resources. We aimed to systematize conceptual principles and practices that beacon the use of open educational resources, aspiring to maximize dialogue and curricular production mediated by technologies. The action research methodological procedures (participatory planning, observation and survey questionnaires generated analysis data relative to the programming and problematization of open educational resources, in undergraduate and graduate courses mediated

  6. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian....... XRD-data indicated that some mineral separates prepared for Ar-Ar stepwise heating analysis were monomineralic, whereas others were composed of two white micas (muscovite with paragonite or margarite), or biotite and chlorite. In monomineralic samples 37Ar/39Ar and 38Ar/39Ar (proportional to Ca....../K and Cl/K ratios) did not change and the resulting ages can be interpreted unambiguously. In mineral separates containing two white micas, Ca/K and Cl/K ratios were variable, reflecting non-simultaneous laboratory degassing of the two heterochemical Ar-reservoirs. These ratios were used to identify each...

  7. Efeito de níveis de água, coberturas do solo e condições ambientais na temperatura do solo e no cultivo de morangueiro em ambiente protegido e a céu aberto Effect of water levels, soil covers and enviroment in maximum soil temperature in strawberry crop in field and greenhouse

    Directory of Open Access Journals (Sweden)

    Regina C. de M. Pires

    2004-12-01

    Full Text Available A temperatura do solo é um importante parâmetro no cultivo do morangueiro, pois interfere no desenvolvimento vegetativo, na sanidade e na produção. O objetivo do presente trabalho foi avaliar o efeito de diferentes níveis de água, coberturas de canteiro em campo aberto e em ambiente protegido, na temperatura máxima do solo no cultivo do morangueiro. Foram realizados dois experimentos: um em cultivo protegido e outro a campo aberto, em Atibaia - SP, em esquema fatorial 2 x 3 (coberturas do solo e níveis de irrigação, em blocos ao acaso, com cinco repetições. As coberturas de solo utilizadas foram filmes de polietileno preto e transparente. A irrigação localizada foi aplicada por gotejo sempre que o potencial de água no solo atingisse -0,010 (N1, -0,035 (N2 e -0,070 (N3 MPa, em tensiômetros instalados a 10 cm de profundidade. A temperatura do solo foi avaliada por termógrafos, sendo os sensores instalados a 5 cm de profundidade. Houve influência do ambiente de cultivo, da cobertura do solo e dos níveis de irrigação na temperatura máxima do solo. A temperatura do solo sob diferentes coberturas dependeu não somente das características físicas do plástico, como também da forma de instalação no canteiro. A temperatura máxima do solo aumentou com a diminuição do potencial da água no solo, no momento da irrigação.The soil temperature is an important parameter in strawberry crop, because, it interferes in vegetative development, plant health conditions and yield. The aim of this work was to evaluate the effect of different water levels, soil covers in field conditions and greenhouse in maximum soil temperature in strawberry crop. Two experiments were accomplished, one in greenhouse and other in field conditions, at Atibaia - SP, Brazil. The experimental design was a factorial 2 x 3 (soil covers and water levels, with 5 repetitions. The soil covers were clear and black plastics. The trickle irrigation was applied

  8. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  9. Concentração de propriedade e desempenho: um estudo nas empresas brasileiras de capital aberto do setor de energia elétrica

    Directory of Open Access Journals (Sweden)

    Naiara Leite dos Santos Sant'Ana

    2016-01-01

    Full Text Available Resumo A concentração de propriedade há muito vem sendo estudada para verificar se impacta no desempenho das empresas. O presente artigo tem por objetivo verificar se a estrutura de propriedade, mais especificamente a concentração de propriedade, tem algum impacto no desempenho das empresas do setor elétrico. Embora sejam numerosos os trabalhos que tratam sobre a relação de Desempenho e Concentração de Propriedade, este se propõe a apresentar uma proposta de abordagem metodológica por meio de uma nova combinação de variáveis. O trabalho busca reacender a discussão da concentração de propriedade no Brasil e a identidade desses acionistas em um cenário peculiar de escândalos de má gestão, controle de resultados e corrupção de empresas no Brasil, sob a óptica da relação entre capital privado e público, com a análise sendo feita no setor de energia elétrica. O estudo foi realizado por meio da análise de dados em painel. A amostra compôs-se de 22 empresas brasileiras de capital aberto do setor de energia elétrica analisadas nos anos de 2010 a 2014. Verificou-se melhor desempenho das empresas privadas em comparação com as públicas, das empresas com ações ordinários nas mãos de apenas um acionista majoritário e relação positiva com o lucro líquido. Por outro lado, as variáveis relativas às ações ordinárias nas mãos de dois maiores acionistas e ativo total apresentaram relação negativa com o desempenho.

  10. Conteúdos abertos e compartilhados: novas perspectivas para a educação Open and shared contents: new perspectives for education

    Directory of Open Access Journals (Sweden)

    Osmar Mantovani

    2006-04-01

    Full Text Available Mudanças em curso no cenário de produção e divulgação de conhecimentos bem como algumas questões importantes indutoras de tais mudanças são apontadas. A principal é o desbalanceamento, cada vez maior, entre os interesses da indústria cultural e os da sociedade, em favor da primeira, provocado, em anos recentes, por mudanças sucessivas no direito de propriedade intelectual por pressão da mesma indústria cultural que tem, hoje, o seu modelo de negócio ameaçado por práticas apoiadas por novas tecnologias de informação e comunicação e, especificamente, pela Internet. Tal desbalanceamento cerceia, em particular, a escola na escolha dos recursos mais apropriados para a educação de seus alunos. Um contramovimento promove "conteúdos abertos". Um ambiente que foi desenhado para apoiar a comunidade escolar na publicação e no compartilhamento de conteúdos para, dessa forma, ajudá-la a promover uma educação com parâmetros mais democráticos e adequados às transformações em curso é apresentado.Ongoing changes in the scenario of knowledge production and dissemination as well as some of the important issues that induced them are pointed out. The main one is an increasing shift of balance from the interests of society to those of the culture industry promoted, these last years, by successive amendments to the intellectual property rights. These were passed under the pressures of that industry whose business model is nowadays threatened by the practices supported by the new information and communication technologies and the Internet in particular. Such shift of balance specifically limits schools in their choices of the most appropriate resources to educate their students. A counter-movement is promoting "open contents" through an environment, presented here, designed to support the school community in publishing and sharing tasks. It is aimed at helping that community promote an education with more democratic and better

  11. 40Ar/39Ar Interlaboratory Calibration into the Holocene.

    Science.gov (United States)

    Heizler, M. T.; Jicha, B.; Koppers, A. A. P.; Miggins, D. P.

    2015-12-01

    Advances in 40Ar/39Ar analytical precision for very young rocks requires collaborative efforts amongst argon geochronology labs to demonstrate age reproducibility commensurate with high precision. NM Tech (NMT), the University of Wisconsin (UW) and Oregon State University (OSU) have each dated Quaternary flux monitor standard AC-2 sanidine (~1.185 Ma), a blind sanidine described as being 50-100 ka (BS) and sanidine from the Qixiangshan (QIX) flow (~10 ka), Changbaishan volcano, China. The samples were irradiated in a single package with FC-2 sanidine (28.201 Ma) as the flux monitor and the irradiated material was distributed amongst the labs. Heizler was present during analysis at both OSU and UW and Jicha attended OSU during analysis. Physical presence was key towards gaining understanding of individual protocols and prompted valuable discussions. Analyses were carried out on single crystals using total fusion and/or step heating approaches. Age agreement was achieved within 2s uncertainty that ranged between (0.03-0.3%, 0.13-0.37% and 1.8-2.6%) for AC-2, BS and QIX, respectively. Each lab found AC-2 to vary somewhat beyond a normal distribution and to yield an age relative to FC-2 of ~1.185 Ma that is ~1.3% (~5-10 sigma) lower than some published estimates. A key cause of the variation between this study and previous results may be variable gas pressure equilibration times between extraction line and mass spectrometer coupled with variable choices to estimate time zero by other laboratories. The majority of our efforts concentrated on the QIX sanidine where prior data obtained by our labs revealed a factor of two spread in age (~11 and 23 ka) based on experiments carried out by total fusion and bulk incremental heating. By conducting single crystal age spectrum analysis we were able to mitigate effects of melt inclusion hosted excess argon and xenocrystic contamination towards obtaining analytical agreement with apparent ages near 10 ka. However, philosophical

  12. MagAO: Status and Science

    CERN Document Server

    Morzinski, Katie M; Males, Jared R; Hinz, Phil M; Esposito, Simone; Riccardi, Armando; Briguglio, Runa; Follette, Katherine B; Pinna, Enrico; Puglisi, Alfio; Vezilj, Jennifer; Xompero, Marco; Wu, Ya-Lin

    2016-01-01

    "MagAO" is the adaptive optics instrument at the Magellan Clay telescope at Las Campanas Observatory, Chile. MagAO has a 585-actuator adaptive secondary mirror and 1000-Hz pyramid wavefront sensor, operating on natural guide stars from $R$-magnitudes of -1 to 15. MagAO has been in on-sky operation for 166 nights since installation in 2012. MagAO's unique capabilities are simultaneous imaging in the visible and infrared with VisAO and Clio, excellent performance at an excellent site, and a lean operations model. Science results from MagAO include the first ground-based CCD image of an exoplanet, demonstration of the first accreting protoplanets, discovery of a new wide-orbit exoplanet, and the first empirical bolometric luminosity of an exoplanet. We describe the status, report the AO performance, and summarize the science results. New developments reported here include color corrections on red guide stars for the wavefront sensor, a new field stop stage to facilitate VisAO imaging of extended sources; and eye...

  13. Cartografar é traçar um plano comum

    Directory of Open Access Journals (Sweden)

    Virgínia Kastrup

    2013-08-01

    Full Text Available A pesquisa de campo sobre produção da subjetividade enfrenta o problema de construir conhecimento envolvendo pesquisadores e pesquisados, com territórios e semióticas singulares. Surgem questões relativas ao protagonismo dos participantes e a como traçar com eles um plano comum, garantindo o caráter participativo da pesquisa. No contexto do método da cartografia, o artigo tem como objetivo tratar do tema do comum num duplo aspecto. Num primeiro, discute o acesso ao plano comum. Com base em Gilles Deleuze e Felix Guattari, tal plano não é dito homogêneo nem reúne atores que manteriam entre si relações de identidade, mas opera comunicação entre singularidades, sendo pré-individual e coletivo. Num segundo aspecto, aponta que, enquanto pesquisa-intervenção, a cartografia se compromete com a criação de um mundo comum e heterogêneo. O artigo mostra que o traçado do comum tem como diretriz metodológica a tranversalidade e examina os procedimentos de participação, inclusão e tradução.

  14. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  15. Study of the symbiotic star AR Pavonis

    Directory of Open Access Journals (Sweden)

    C. Quiroga

    2001-01-01

    Full Text Available We present a study of the optical spectra and linear polarization of the eclipsing binary AR Pavonis. The optical spectra were obtained between 1990 and 1998, and polarimetric data between 1995 and 1998. From spectroscopic variations along the orbital motion we analized the nature of the system. Polarimetric studies indicate that AR Pav has intrinsic polarization.

  16. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  17. Revised error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, Pieter

    2015-12-01

    The main advantage of the 40Ar/39Ar method over conventional K-Ar dating is that it does not depend on any absolute abundance or concentration measurements, but only uses the relative ratios between five isotopes of the same element -argon- which can be measured with great precision on a noble gas mass spectrometer. The relative abundances of the argon isotopes are subject to a constant sum constraint, which imposes a covariant structure on the data: the relative amount of any of the five isotopes can always be obtained from that of the other four. Thus, the 40Ar/39Ar method is a classic example of a 'compositional data problem'. In addition to the constant sum constraint, covariances are introduced by a host of other processes, including data acquisition, blank correction, detector calibration, mass fractionation, decay correction, interference correction, atmospheric argon correction, interpolation of the irradiation parameter, and age calculation. The myriad of correlated errors arising during the data reduction are best handled by casting the 40Ar/39Ar data reduction protocol in a matrix form. The completely revised workflow presented in this paper is implemented in a new software platform, Ar-Ar_Redux, which takes raw mass spectrometer data as input and generates accurate 40Ar/39Ar ages and their (co-)variances as output. Ar-Ar_Redux accounts for all sources of analytical uncertainty, including those associated with decay constants and the air ratio. Knowing the covariance matrix of the ages removes the need to consider 'internal' and 'external' uncertainties separately when calculating (weighted) mean ages. Ar-Ar_Redux is built on the same principles as its sibling program in the U-Pb community (U-Pb_Redux), thus improving the intercomparability of the two methods with tangible benefits to the accuracy of the geologic time scale. The program can be downloaded free of charge from

  18. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  19. 40Ar/39Ar and K-Ar data bearing on the metamorphic and tectonic history of western New England.

    Science.gov (United States)

    Sutter, J.F.; Ratcliffe, N.M.; Mukasa, S.B.

    1985-01-01

    40Ar/39Ar ages of coexisting biotite and hornblende from Proterozoic Y gneisses of the Berkshire and Green Mt massifs, as well as 40Ar/39Ar and K/Ar mineral and whole-rock ages from Palaeozoic metamorphic rocks, suggest that the thermal peaks for the dominant metamorphic recrystallization in western New England occurred 465 + or - 5 m.y. (Taconian). 40Ar/39Ar age data from a poorly-defined terrain along the eastern strip of the area suggests that the area has been retrograded during a metamorphism that peaked at least 376 + or - 5 m.y. (Acadian). Available age and petrological data from western New England indicate the presence of at least three separate metamorphic-structure domains of Taconic age: 1) a small area of relict high-P and low-T metamorphism, 2) a broad area of normal Barrovian metamorphism from chlorite to garnet grade characterized by a gentle metamorphic gradient and, 3) a rather narrow belt of steep-gradient, Barrovian series metamorphic rocks. Areas of maximum metamorphic intensity within the last domain coincide with areas of maximum crustal thickening in the later stage of Taconic orogeny. -L.di H

  20. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  1. A EDUCAÇÃO DE ADULTOS E O PROGRAMA DE COMBATE AO ANALFABETISMO EM PRESIDENTE PRUDENTE

    Directory of Open Access Journals (Sweden)

    Cristiano A. G. Di Giorgi

    2009-12-01

    Full Text Available Neste artigo, após traçar breve quadro do histórico e da situação atual da Educação de Adultos no País, descrevemos o programa "Combate ao Analfabetismo" desenvolvido pela Prefeitura Municipal de Presidente Prudente, cuja direção pedagógica esta a cargo da FCT/UNESP - Campus de Presidente Prudente. Apontamos os principais problemas didático-pedagógicos e administrativos colocados ao programa e as soluções que foram encontradas.

  2. Spatial evaluation of Ar-systematics in rocks from the British Channel Islands: a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Sherlock, S.; Kelley, S. P.

    2010-12-01

    The Ar-Ar method is a powerful tool for constraining thermal histories of metamorphic and plutonic rocks, most commonly undertaken on potassium rich mineral separates rather than whole rocks. While this approach usually yields reasonable thermal histories, it is rarely as precise as dating volcanics, and such rocks are also frequently contaminated by excess argon, artificially elevating the Ar-Ar ages. Understanding the evolution of excess argon represents a challenge; whilst it is possible to discern the ‘sink’ as the host mineral now contaminated by excess argon, examining the ‘source’ and ‘transport’ mechanism is more challenging. The approach we have taken here is to combine measurements of potassium rich and potassium poor minerals to understand the argon reservoirs and argon transfer between minerals, grain boundaries and fluids. Considering the system as a whole provides a method for understanding the complete history of the rock and thus assessing any interactions which may impact on the interpretation of ages and thermal history [Kelley, 2002, Chem. Geol. 188]. Here we have studied a series of plutonic and metamorphic basement samples from the British Channel Islands with different ages and post-emplacement histories, namely Icart Gneiss, Perelle Quartz Diorite, L’Ancresse Granodiorite, and Bordeaux Diorite. The formation age of Icart Gneiss is ~2000 Ma [D’Lemos et al., 1990, Geol. Soc. Spec. Pub. 51]. Ar-Ar ages of hornblendes and biotites from quartz diorites on Guernsey and Sark range between 606 and 596 Ma [Dallmeyer et al. 1991, J. Geol. Soc. London 148], whilst U-Pb zircon ages are in the range 710 to 613 Ma [Dallmeyer et al. 1991; Samson & D’Lemos 1998, J. Geol. Soc. London 155; Miller et al. 1999, Tectonophysics 132]. Detailed petrograpic (microscope, electron microprobe) investigations established the crystallization and deformation history of the samples, and revealed that post-magmatic alteration is unevenly distributed. This

  3. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  4. Necessidades de qualificação da equipe de enfermagem para a assistência aos clientes portadores do HIV e da Aids Qualification needs of the nursing team for the assistance of Clients with HIV and Aids

    Directory of Open Access Journals (Sweden)

    Anna Luiza de Fátima Pinho Lins Gryschek

    2000-09-01

    Full Text Available Discorre-se sobre as necessidades de qualificação específica das equipes de enfermagem dos Centros de Referência de Doenças Sexualmente Transmissíveis e Aids da Secretaria Municipal da Saúde de São Paulo, para a assistência aos clientes portadores do HIV e da Aids. Foram enviados questionários abertos, para todos os profissionais da equipe de enfermagem de todas as unidades do Programa Municipal de DST/Aids. Do total de 671 profissionais de enfermagem, 453 responderam ao questionário. Como necessidades de qualificação foram apontadas: biossegurança, preparo e administração de medicamentos específicos e assistência de enfermagem aos clientes com HIV e Aids.This study discourses about the especific training needs of the nursing teams of the Centers of Reference of Sexual Transmissible Diseases (STD and Aids from the STD/Aids Program of the Health Secretary of the Township of São Paulo for the assistance of clients with HIV and Aids. From a total of 671 nursing workers, 453 answered the questionnaire. They identified the following training needs: contents related to standard precautions, preparation and administration of specific drugs and other general nursing care to HIV + clients.

  5. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  6. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  7. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  8. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  9. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  10. Differential AR algorithm for packet delay prediction

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Different delay prediction algorithms have been applied in multimedia communication, among which linear prediction is attractive because of its low complexity. AR (auto regressive) algorithm is a traditional one with low computation cost, while NLMS (normalize least mean square) algorithm is more precise. In this paper, referring to ARIMA (auto regression integrated with moving averages) model, a differential AR algorithm (DIAR) is proposed based on the analyses of both AR and NLMS algorithms. The prediction precision of the new algorithm is about 5-10 db higher than that of the AR algorithm without increasing the computation complexity.Compared with NLMS algorithm, its precision slightly improves by 0.1 db on average, but the algorithm complexity reduces more than 90%. Our simulation and tests also demonstrate that this method improves the performance of the average end-to-end delay and packet loss ratio significantly.

  11. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  12. Ilha das Flores, estatura e peso em crianças dos 6 aos 11 anos.

    OpenAIRE

    Antunes, Maria A. G.

    1990-01-01

    IV Expedição Científica do Departamento de Biologia – Flores 1989. 0s estudos de crescimento físico humano têm-se revelado de grande interesse pois permitem conhecer as características de diferentes populações e a variabilidade existente intra e interpopulações. Mas um dos aspectos mais importantes destes estudos talvez o de, ao se analisar o estado de crescimento e tempo de desenvolvimento do indivíduo, permitir destrinçar factores que influenciam nefastamente o crescimento. ...

  13. The mass of $^{32}Ar$ and $^{33}Ar$ for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides ^32Ar (T_1/2=98 ms) and ^33Ar (T_1/2=173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10_-8 (deltam=1.8 keV) and 1.4 x 10_-8 (deltam=0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaric-multiplet mass equation IMME. Furthermore, the improved accuracy for the mass of ^32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for ^44Ar and ^45Ar, and a 20sigma deviation for ^44Ar from the literature value was found and interpreted.

  14. Avaliação da sensibilidade da goiabeira 'Pedro Sato' ao ozônio

    Directory of Open Access Journals (Sweden)

    Regina Maria de Moraes

    2011-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a sensibilidade da goiabeira 'Pedro Sato' ao ozônio (O3, em comparação à cultivar Paluma, descrita como sensível. Oito plantas de cada cultivar foram submetidas separadamente a ar filtrado e a ar filtrado + O3, cinco horas por dia, durante quatro dias. Foram avaliadas fotossíntese (Asat, injúrias foliares visíveis e concentração de antocianinas e taninos. Plantas das duas cultivares também foram expostas, durante três meses, a condições ambientais em local contaminado por O3, tendo-se avaliado fotossíntese, injúrias foliares e crescimento. Plantas fumigadas com O3 apresentaram redução de Asat e da atividade fotoquímica, além de manifestação de injúrias foliares. 'Paluma' apresentou maior redução de Asat, injúrias foliares mais severas e redução de taninos. Quando exposta ao ambiente contaminado, 'Paluma' apresentou trocas gasosas mais altas, mas apresentou redução de Asat 30 dias antes que 'Pedro Sato'. O crescimento não foi afetado em 'Pedro Sato', cujas injúrias foliares tiveram menor incidência, severidade e precocidade do que em 'Paluma'. A menor taxa de crescimento de 'Paluma' indica maior sensibilidade ao O3. Apesar de responder com menor intensidade ao estresse induzido pelo O3, a cultivar Pedro Sato não pode ser considerada tolerante, pois apresenta danos fotoquímicos, injúrias foliares e alterações nos conteúdos de metabólitos secundários quando exposta a esse poluente.

  15. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  16. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  17. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  18. O museu aberto e comunicativo : fundamentação e proposta para estudos de públicos à luz de um enfoque info-comunicacional

    OpenAIRE

    Beites, Alexandre Manuel Rodrigues

    2011-01-01

    Os estudos de públicos aplicados ao universo museológico sofreram uma evolução que transitou sem grande efectividade ate um momento - o actual, em que lhes são exigidos resultados uteis. Vive-se uma "encruzilhada" metodológica para a qual esta dissertação pretende contribuir com uma proposta. Apostar no registo e tratamento dos dados info-comunicacionais do visitante como matéria-prima será o ponto de partida para uma estratégia, que se quer qualitativa, integradora de varias disciplinas e co...

  19. Revis\\~ao da Constru\\c{c}\\~ao de Modelos Supersim\\'etricos

    CERN Document Server

    Rodríguez, M C

    2001-01-01

    Foi com base neste estudo que fizemos a constru\\c{c}\\~ao da vers\\~ao supersim\\'etrica dos modelos de simetria $SU(3)_{C} \\otimes SU(3)_{L} \\otimes U(1)_{N}$ \\cite{susy331}, apresentado no final da minha tese de doutorado \\cite{mcr1}. Bem como dos estudos fenomenol\\'ogicos subsequente \\cite{mcr}.

  20. Into the Blue: AO Science with MagAO in the Visible

    CERN Document Server

    Close, Laird M; Follette, Katherine B; Hinz, Phil; Morzinski, Katie M; Wu, Ya-Lin; Kopon, Derek; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando

    2014-01-01

    We review astronomical results in the visible ({\\lambda}<1{\\mu}m) with adaptive optics. Other than a brief period in the early 1990s, there has been little astronomical science done in the visible with AO until recently. The most productive visible AO system to date is our 6.5m Magellan telescope AO system (MagAO). MagAO is an advanced Adaptive Secondary system at the Magellan 6.5m in Chile. This secondary has 585 actuators with < 1 msec response times (0.7 ms typically). We use a pyramid wavefront sensor. The relatively small actuator pitch (~23 cm/subap) allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We use a CCD AO science camera called "VisAO". On-sky long exposures (60s) achieve <30mas resolutions, 30% Strehls at 0.62 microns (r') with the VisAO camera in 0.5" seeing with bright R < 8 mag stars. These relatively high visible wavelength Strehls are made possible by our powerful combination of a next generation ASM and a Pyramid WFS with 378 controlled modes and 1000...

  1. Into the blue: AO science with MagAO in the visible

    Science.gov (United States)

    Close, Laird M.; Males, Jared R.; Follette, Katherine B.; Hinz, Phil; Morzinski, Katie; Wu, Ya-Lin; Kopon, Derek; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando

    2014-08-01

    We review astronomical results in the visible (λresponse times (0.7 ms typically). We use a pyramid wavefront sensor. The relatively small actuator pitch (~23 cm/subap) allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We use a CCD AO science camera called "VisAO". On-sky long exposures (60s) achieve Pyramid WFS with 378 controlled modes and 1000 Hz loop frequency. We'll review the key steps to having good performance in the visible and review the exciting new AO visible science opportunities and refereed publications in both broad-band (r,i,z,Y) and at Halpha for exoplanets, protoplanetary disks, young stars, and emission line jets. These examples highlight the power of visible AO to probe circumstellar regions/spatial resolutions that would otherwise require much larger diameter telescopes with classical infrared AO cameras.

  2. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This is an Operating System Setup Guide. This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  3. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  4. A refined astronomically calibrated 40Ar/39Ar age for Fish Canyon sanidine

    NARCIS (Netherlands)

    Rivera, T.A.; Storey, M.; Zeeden, C.; Hilgen, F.J.; Kuiper, K.

    2011-01-01

    Intercalibration between the astronomical and radio-isotopic dating methods provides a means to improving accuracy and reducing uncertainty of an integrated, multi-chronometer geologic timescale. Here we report a high-precision 40Ar/39Ar age for the FishCanyon sanidine (FCs) neutron fluence monitor,

  5. Craving decrease with topiramate in outpatient treatment for cocaine dependence: an open label trial Diminuição da fissura com topiramato no tratamento ambulatorial para dependência de cocaína: um ensaio clínico aberto

    Directory of Open Access Journals (Sweden)

    Alessandra Diehl Reis

    2008-06-01

    Full Text Available OBJECTIVE: To evaluate anticraving action and tolerability of topiramate in cocaine user treatment. METHOD: Male users of inhaled cocaine which met criteria for cocaine dependence (Diagnostic and Statistical Manual of Mental Disorders, fourth edition were selected for outpatient 12-week, open label trial with topiramate; individual dosage ranged between 25-300 mg/day. Main clinical variables were abstinence rate, craving intensity, frequency and duration, adherence, dropouts, side effects and impulsivity measure through Barratt Impulsivity Scale. Patients received assertive strategic counseling for abstinence assistance and medication monitoring evaluation every two weeks. Comparative analysis was made with intention to treat, missing values were replaced (last observation carried forward, and significance level was 5%. RESULTS: Adherence to treatment was 57% (at least three evaluations, 32% dropped out (one evaluation. There were no severe side effects. Negative test average was 25.4% (31.2. Significant reduction in craving intensity and duration was observed in 25% of the sample. No statistical significant reduction in craving frequency was observed in 7.1%. Increase in frequency was observed in 10.7% and 82.1% did not present any variation. No significant statistical variations in Barratt Impulsivity Scale or in the total score were found in the final evaluation when compared to baseline. CONCLUSION: More randomized placebo-controlled trials with topiramate for cocaine dependants should be performed to evaluate preliminary evidence.OBJETIVO: Avaliar a ação anticraving e tolerabilidade do topiramato em usuários de cocaína. MÉTODO: Homens usuários de cocaína inalada que preenchiam critérios para dependência de cocaína (Manual Diagnóstico e Estatístico de Desordens Mentais, quarta edição foram selecionados para 12 semanas de tratamento ambulatorial, em ensaio clínico aberto com topiramato; dosagens escalonadas entre 25-300 mg

  6. Modeling Augmented Reality User Interfaces with SSIML/AR

    Directory of Open Access Journals (Sweden)

    Arnd Vitzthum

    2006-06-01

    Full Text Available Augmented Reality (AR technologies open up new possibilities especially for task-focused domains such as assembly and maintenance. However, it can be noticed that there is still a lack of concepts and tools for a structured AR development process and an application specification above the code level. To address this problem we introduce SSIML/AR, a visual modeling language for the abstract specification of AR applications in general and AR user interfaces in particular. With SSIML/AR, three different aspects of AR user interfaces can be described: The user interface structure, the presentation of relevant information depending on the user’s current task and the integration of the user interface with other system components. Code skeletons can be generated automatically from SSIML/AR models. This enables the seamless transition from the design level to the implementation level. In addition, we sketch how SSIML/AR models can be integrated in an overall AR development process.

  7. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    OpenAIRE

    2008-01-01

    O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  8. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    analog enabling precise measurement of very small 36Ar signals for accurate correction for atmospheric-derived 40Ar; (iii) higher mass resolution allows pseudo resolution of hydrocarbon isobaric interferences from 36Ar through to 40Ar; (iv) multi-collection, allowing more data to be gathered in a fixed...

  9. Neutrino Capture Reactions on $^{40}$Ar

    CERN Document Server

    Suzuki, Toshio

    2012-01-01

    Gamow-Teller (GT) strength in $^{40}$Ar is studied by shell-model calculations with monopole-based universal intearction, which has tensor components of $\\pi$\\rho$-meson exchanges. Calculated GT strength is found to be consistent with the experimental data obtained by recent ($p, n$) reactions. Neutrino capture cross sections on $^{40}$Ar for solar neutrinos from $^{8}$B are found to be enhanced compared with previous calculations. The reaction cross sections for multipoles other than $0^{+}$ and $1^{+}$ are obtained by random-phase approximation (RPA). Their contributions become important for neutrino energies larger than 50 MeV.

  10. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  11. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  12. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  13. The Subaru Coronagraphic Extreme AO Project

    Science.gov (United States)

    Martinache, Frantz; Guyon, O.; Lozi, J.; Tamura, M.; Hodapp, K.; Suzuki, R.; Hayano, Y.; McElwain, M. W.

    2009-01-01

    While the existence of large numbers of extrasolar planets around solar type stars has been unambiguously demonstrated by radial velocity, transit and microlensing surveys, attempts at direct imaging with AO-equipped large telescopes remain unsuccessful. Because they supposedly offer more favorable contrast ratios, young systems consitute prime targets for imaging. Such observations will provide key insights on the formation and early evolution of planets and disks. Current surveys are limited by modest AO performance which limits inner working angle to 0.2", and only reach maximum sensitivity outside 1". This translates into orbital distances greater than 10 AU even on most nearby systems, while only 5 % of the known exoplanets have a semimajor axis greater than 10 AU. This calls for a major change of approach in the techniques used for direct imaging of the direct vicinity of stars. A sensible way to do the job is to combine coronagraphy and Extreme AO. Only accurate and fast control of the wavefront will permit the detection of high contrast planetary companions within 10 AU. The SCExAO system, currently under assembly, is an upgrade of the HiCIAO coronagraphic differential imaging camera, mounted behind the 188-actuator curvature AO system on Subaru Telescope. This platform includes a 1000-actuator MEMS deformable mirror for high accuracy wavefront correction and a PIAA coronagraph which delivers high contrast at 0.05" from the star (5 AU at 100 pc). Key technologies have been validated in the laboratory: high performance wavefront sensing schemes, spider vanes and central obstruction removal, and lossless beam apodization. The project is designed to be highly flexible to continuously integrate new technologies with high scientific payoff. Planned upgrades include an integral field unit for spectral characterization of planets/disks and a non-redundant aperture mask to push the performance of the system toward separations less than lambda/D.

  14. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  15. Condicionamento de ar em salas de operação e controle de infecção - uma revisão

    Directory of Open Access Journals (Sweden)

    May Socorro Martinez Afonso

    2006-04-01

    Full Text Available Revisão bibliográfica, realizada junto aos bancos de dados MED LINE, LILACS, SCIELO, Ministério da Saúde e outros buscadores, com o objetivo de identificar os fatores que torna o ar condicionado fonte de contaminação ambiental. O ar é contaminado por partículas que transportam microrganismos. As fontes de partículas incluem pacientes e equipe cirúrgica. O controle da temperatura, umidade relativa, pressão, número de trocas de ar realizadas por hora, paramentação, tráfego, número de pessoas nas salas e manutenção e limpeza do sistema de ar condicionado dos centros cirúrgicos, são fatores importantes na redução do número de microrganismos no ambiente de sala de operação.

  16. Modification of stearic acid in Ar and Ar-O{sub 2} pulsed DC discharges

    Energy Technology Data Exchange (ETDEWEB)

    Bernardelli, E.A.; Souza, T.; Maliska, A.M.; Kleinjohann, K.J.; Bendo, T. [Federal University of Santa Catarina (UFSC), Florianopolis, SC (Brazil); Mafra, M. [Nancy-Universite (France). Institut Jean Lamour; CNRS, Nancy (France); Belmonte, T. [Federal University of Technology from Parana (UTFPR), Curitiba, PR (Brazil)

    2010-07-01

    Stearic acid (C{sub 1}8H{sub 36}O{sub 2}) was treated into Ar and Ar-O{sub 2}(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O{sub 2} plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O{sub 2} in all states) strongly enhance the etching process with regards to A{sup *} species, regardless of their concentration. After treatment by Ar and Ar-O{sub 2} plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O{sub 2} plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  17. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  18. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  19. "Ars Dictaminis" and Modern Rhetorical Practice.

    Science.gov (United States)

    Sewell, Ernestine P.

    Although not all the problems of writing are solved by practice in letter writing, a review of the classical texts on "ars dictaminis"--letter writing--creates a strong argument for its increased use as an exercise in college composition classrooms. By incorporating the lessons of dictamen as a device for achieving rhetorical modes--narration,…

  20. 78 FR 9448 - Arkansas Disaster #AR-00061

    Science.gov (United States)

    2013-02-08

    ... ADMINISTRATION Arkansas Disaster AR-00061 AGENCY: U.S. Small Business Administration. ACTION: Notice SUMMARY: This is a Notice of the Presidential declaration of a major disaster for Public Assistance Only for the... Disaster Assistance, U.S. Small Business Administration, 409 3rd Street SW., Suite 6050, Washington,...

  1. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  2. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  3. A indústria de publicação contra o acesso aberto La industria de publicación contra el acceso abierto The publishing industry against open access journals

    Directory of Open Access Journals (Sweden)

    Kenneth Rochel de Camargo Jr

    2012-12-01

    Full Text Available A publicação em revistas de acesso aberto cresceu expressivamente nos últimos anos. As publicações de acesso fechado, por sua vez, têm custo de acesso cada vez mais elevado, por se beneficiarem de um modelo econômico peculiar: o trabalho relevante e os insumos essenciais são entregues gratuitamente a fornecedores que contam com um mercado cativo, praticamente sem concorrência. O mercado editorial é altamente oligopolizado, característico de indústrias que trabalham com o regime de copyright. Isso contribui para a elevação dos preços de seus produtos. Políticas mandatórias de acesso aberto, como a determinada pela agência National Institutes of Health, constituem-se em ameaça a esse modelo de negócios e são enfrentadas pela indústria em várias frentes, incluindo a passagem de legislação para sabotar tais iniciativas. O objetivo deste comentário foi apresentar alguns aspectos principais desse enfrentamento e sugerir possíveis estratégias de incremento da publicação de acesso aberto em nosso meio.La publicación en revistas de acceso abierto creció expresivamente en los últimos años. Las publicaciones de acceso cerrado, por su parte, tienen costo de acceso cada vez más elevado, por beneficiarse de un modelo económico peculiar: el trabajo relevante y los insumos esenciales son entregados gratuitamente a los proveedores que cuentan con un mercado cautivo, prácticamente sin concurrencia. El mercado editorial es altamente monopolizado, característico de industrias que trabajan con el régimen de copyright. Esto contribuye a la elevación de los precios de sus productos. Políticas obligatorias de acceso abierto, como la determinada por el National Institutes of Health, constituyen amenazas a este modelo de negocios y son enfrentadas por la industria en varios ángulos, incluyendo el paso de legislación para sabotear tales iniciativas. El objetivo de este comentario fue presentar algunos aspectos principales de este

  4. Theoretical prediction on vibrational spectra of [Ar…Ar-H]+

    Institute of Scientific and Technical Information of China (English)

    李巍; 赵新生

    2003-01-01

    Centrosymmetric linear [Ar-H-Ar]+ and asymmetric linear [Ar…Ar-H]+ are two stable configurations of [Ar2H]+. Based on the global potential energy surface of [Ar2H]+ provided by our group recently, we calculated the vibrational spectra of [Ar…Ar-H]+ with total angular momentum J = 0 by time-dependent quantum mechanical method, and the influence of quantum tunneling effect on vibrational spectra was found. With the help of the observation on the eigenstate functions and the modified potential energy surface, assignments were made to the spectra. The strong coupling between the excited bending mode of [Ar-H-Ar]+ and the vibrational states of [Ar…Ar-H]+ was discussed.

  5. FATORES ASSOCIADOS AO BAIXO PESO AO NASCER NO ESTADO DE GOIÁS

    Directory of Open Access Journals (Sweden)

    Ruth Minamisava

    2004-12-01

    Full Text Available Recém-nascidos de baixo peso ao nascer (RNBP são considerados problemas de saúde pública pela associação com altas taxas de mortalidade e morbidade. Nenhum estudo prévio sobre fatores associados ao RNBP na região central do Brasil foi encontrado na literatura. Assim, este estudo teve como objetivo identificar as prevalências e os fatores associados ao baixo peso ao nascer entre nascidos vivos no Estado de Goiás, Brasil. Foi realizado um estudo transversal tendo como fonte de dados o Sistema de Informações de Nascidos Vivos ligado ao Ministério da Saúde. Examinou-se todos os 92.745 recém-nascidos de gestação única residentes no estado de Goiás, no ano 2000. Usou-se análise de regressão logística para identificar os fatores associados ao RNBP (< 2500 g. Em Goiás, os RNBP apresentaram uma prevalência de 5,96% e os fatores associados ao baixo peso ao nascer foram: prematuridade, baixa e avançada idade materna, mulheres não casadas, menos de sete consultas de pré-natal, parto não hospitalar e neonatos do sexo feminino. Ações intersetoriais são necessárias para reduzir as desigualdades da saúde materna e infantil.

  6. MEMS DM development at Iris AO, Inc.

    Science.gov (United States)

    Helmbrecht, Michael A.; He, Min; Kempf, Carl J.; Besse, Marc

    2011-03-01

    Iris AO is actively developing piston-tip-tilt (PTT) segmented MEMS deformable mirrors (DM) and adaptive optics (AO) controllers for these DMs. This paper discusses ongoing research at Iris AO that has advanced the state-of-the-art of these devices and systems over the past year. Improvements made to open-loop operation and mirror fabrication enables mirrors to open-loop flatten to 4 nm rms. Additional testing of an anti snap-in technology was conducted and demonstrates that the technology can withstand 100 million snap-in events without failure. Deformable mirrors with dielectric coatings are shown that are capable of handling 630 W/cm2 of incident laser power. Over a localized region on the segment, the dielectric coatings can withstand 100kW/cm2 incident laser power for 30 minutes. Results from the first-ever batch of PTT489 DMs that were shipped to pilot customers are reported. Optimizations made to the open-loop PTT controller are shown to have latencies of 157.5 μs and synchronous array update rates of nearly 6.5 kHz. Finally, plans for the design and fabrication of the next-generation PTT939 DM are presented.

  7. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  8. Análise de Risco aplicada aos alimentos no Brasil: perspectivas e desafios Risk Analysis applied to food safety in Brazil: prospects and challenges

    OpenAIRE

    Ana Virgínia de Almeida Figueiredo; Maria Spínola Miranda

    2011-01-01

    Trata-se de um estudo de caso no qual se discutiram as ideias do Comitê do Codex Alimentarius do Brasil (CCAB), coordenado pelo Instituto Nacional de Metrologia, Normalização e Qualidade Industrial (Inmetro) sobre a norma Codex Alimentarius de Análise de Risco aplicada aos alimentos (AR). Os objetivos deste trabalho foram identificar e analisar a opinião dos membros do CCAB sobre AR e levantar as propostas para a adoção desta norma no país, destacando as limitações e as potencialidades locais...

  9. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  10. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  11. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  12. Into the Blue: AO Science in the Visible with MagAO

    Science.gov (United States)

    Close, Laird; Males, Jared; Morzinski, Katie; Kopon, Derek; Follette, Kate; Rodigas, Timothy; Hinz, Philip; Wu, Ya-Lin; Puglisi, Alfio; Esposito, Simone; Riccardi, Armando; Pinna, Enrico; Xompero, Marco; Briguglio, Runa; Uomoto, Alan; Hare, Tison

    2013-12-01

    The Magellan Clay telescope is a 6.5m Gregorian telescope located in Chile at Las Campanas Observatory. We have fabricated an 85 cm diameter aspheric adaptive secondary with our subcontractors and partners, MagAO passed acceptance tests in spring 2012, and the entire System was commissioned from Nov 17 to Dec 7, 2012. This secondary has 585 actuators with < 1 msec response times (0.7 ms typically). We fabricated a high order (585 mode) pyramid wavefront sensor (similar to that of LBT's FLAO). The relatively high actuator count allows moderate Strehls to be obtained in the visible (0.63-1.05 microns). We have built an CCD science camera called "jVisAO". On-sky long exposures (60s) achieve 30% Strehls at 0.62 microns (r') with the VisAO camera in 0.5" seeing with bright R < 8 mag stars. These relatively high optical wavelength Strehls are made possible by our powerful combination of a next generation ASM and a Pyramid WFS with 200-400 controlled modes and 1000 Hz loop frequencies. To minimize non-common path errors and enable visible AO the VisAO science camera is fed by an advanced triplet ADC and is piggy-backed on the WFS optical board itself. Despite the ability to make 25 mas images we still have ~4 mas of resolution loss to residual vibrations. We will discuss what the most difficult aspects are for visible AO on ELTs scaling from our experience with MagAO.

  13. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  14. Comparação entre os sistemas aberto e fechado de aspiração: revisão sistemática Comparison between open and closed suction systems: a systematic review

    Directory of Open Access Journals (Sweden)

    Izabela Menezes Pagotto

    2008-12-01

    Full Text Available OBJETIVOS: Este estudo foi realizado para tentar esclarecer qual sistema de aspiração é mais eficiente. O objetivo foi comparar os sistemas fechado e aberto de aspiração através de revisão sistemática. MÉTODOS: A busca de artigos científicos foi realizada nas bases de dados MedLine, LILACS e Cochrane abrangendo o período entre 1997 e agosto de 2007 utilizando as palavras-chave: endotracheal suction e closed suction. Foram incluídos os estudos que compararam o sistema aberto e fechado de aspiração, realizados em adultos humanos e que eram ensaios aleatórios e controlados. RESULTADOS: Dos 78 artigos encontrados apenas 15 preencheram os critérios e foram detalhados na revisão. Dentre estes, nove artigos comparavam a incidência de pneumonia associada à ventilação mecânica entre os dois sistemas, seis comparavam a saturação de oxigênio, quatro comparavam pressão arterial e freqüência cardíaca, três comparavam volumes pulmonares, dois comparavam remoção de secreção e quatro; custos. Não houve diferença em relação às variáveis comparadas: incidência de pneumonia associada à ventilação mecânica, mortalidade, tempo de unidade de terapia intensiva, tempo de ventilação mecânica, PaCO2, PaO2, pressão arterial média, freqüência cardíaca e remoção de secreção no uso do sistema aberto e fechado de aspiração. Porém, houve sempre diminuição de SpO2 e dos volumes pulmonares com o uso do sistema aberto; e custos maiores na maioria dos trabalhos quando utilizado o sistema fechado. CONCLUSÕES: O sistema fechado de aspiração parece aumentar o risco de colonização, mas traz as vantagens de não diminuir os volumes pulmonares e não acarretar queda de saturação especialmente em pacientes com insuficiência respiratória grave e em uso de níveis mais altos de pressão expiratória final positiva.OBJECTIVES: This study attempted to identify which is the more effective suction system. The objective was

  15. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  16. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    OpenAIRE

    Ney Procópio Lopes; Márcia Lara; Marcelo Libânio

    2011-01-01

    A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvazi...

  17. On concentration of $^{42}$Ar in the Earth's atmosphere

    CERN Document Server

    Barabash, A S

    2016-01-01

    Data from the DBA liquid argon ionization chamber experiment have been used to obtain an estimate on the concentration of $^{42}$Ar in the Earth's atmosphere, $6.8^{+1.7}_{-3.2}\\cdot10^{-21}$ atoms of $^{42}$Ar per atom of $^{40}$Ar corresponding to the $^{42}$Ar activity of $1.2^{+0.3}_{-0.5}$ $\\mu$Bq per cubic meter of air.

  18. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  19. Avaliação da tolerabilidade e do controle de ciclo de dois contraceptivos orais de baixa dose: estudo comparativo aberto Assessment of the tolerability and cycle control of two low-dose oral contraceptives: an open-label study

    Directory of Open Access Journals (Sweden)

    Edmund C. Baracat

    1998-06-01

    Full Text Available Realizou-se um estudo aberto comparativo em nove centros brasileiros para avaliar a tolerabilidade e o controle de ciclo obtido com o uso de dois contraceptivos orais de baixa dose contendo 20 mg etinilestradiol/75 mg gestodeno e 20 mg etinilestradiol/150 mg desogestrel, durante seis ciclos de tratamento. Foram selecionadas 167 mulheres saudáveis com vida sexual ativa (77 no grupo do gestodeno e 90 no grupo do desogestrel, das quais 138 completaram os seis ciclos de tratamento. Em um subgrupo de novas usuárias realizou-se também perfil lipídico e hemostático. Foram avaliados 867 ciclos no total. Ocorreu sangramento irregular em 4,6% dos ciclos com gestodeno e em 8,1% com desogestrel. A tolerabilidade a ambas preparações foi boa, mas houve significativamente mais náusea no grupo do desogestrel. O controle de ciclo foi bom com os dois contraceptivos, sendo que houve freqüência significativamente menor de sangramento irregular no grupo do gestodeno quando se leva em conta que todos os ciclos foram considerados. Não houve alterações clinicamente significativas no perfil hemostático. O perfil lipídico mostrou tendência a tornar-se mais favorável após seis ciclos de tratamento com as duas preparações. Não ocorreu alteração no peso médio das mulheres no grupo do gestodeno; no grupo do desogestrel houve aumento significativo no peso médio de aproximadamente 1 kg após seis meses de tratamento. A adesão ao tratamento foi boa com as duas preparações. Os resultados deste estudo mostram que preparações contendo baixa dose de gestodeno ou desogestrel associados a 20 mg de etinilestradiol são contraceptivos bem tolerados que permitem bom controle de ciclo, sem efeitos colaterais significantes.An open-label comparative study was conducted in nine centers in Brazil to evaluate the tolerability and cycle control of two low-dose oral contraceptives containing 20 mg ethynylestradiol/75 mg gestodene and 20 mg ethynylestradiol/150 mg

  20. Growth Rate Estimates of Supergene Manganese Nodule by 40Ar/39Ar Isotopic Dating

    Institute of Scientific and Technical Information of China (English)

    Li Jianwei; Vasconcelos P M

    2004-01-01

    Increasing world-class, high-grade, and metals-enriched supergene manganese ore deposits have been discovered in the last two decades, making them more and more economically important. However, data on the timing and duration of their formation are sparse, mainly due to the difficulties extracting datable minerals suited to traditional radiometric dating methods. Hollandite, cryptomelane, coronadite, todorokite, and manjiroite are common manganese oxide minerals in supergene environments. These minerals host potassium of variable amounts from 0.1 wt% to 5.0 wt% in their structural sites. This geochemical property provides possibility to date supergene manganese ores by using K-Ar and 40Ar/39Ar methods. In this study, we perform 40Ar/39Ar dating on a 7.1-cm-thick botryoidal manganese nodule from an ancient weathering profile at Mount Tabor, central Queensland, Australia. Laser microprobe incremental analyses of distinct growth bands, from the inner core through the intermediate bands to the outermost crusts of the nodule, have yielded high quality 40Ar/39Ar ages at 27.3 Ma, 20.9 Ma, 19.2 Ma, and 16.1 Ma, respectively. The age results permit preliminary estimates on the average growth rates of the nodule varying from 4.7×10-3 mm/ka to 7.6×10-3 mm/ka to 9.0×10-3 mm/ka, from the core to the rim. Results of this study are of significance in our understanding of the mode, mechanism, process, and climatic conditions in the formation of supergene manganese ore deposits.

  1. Antarlides: A New Type of Androgen Receptor (AR) Antagonist that Overcomes Resistance to AR-Targeted Therapy.

    Science.gov (United States)

    Saito, Shun; Fujimaki, Takahiro; Panbangred, Watanalai; Igarashi, Yasuhiro; Imoto, Masaya

    2016-02-18

    Prostate cancer is treated with androgen receptor (AR) antagonists but most patients experience disease progression after long-term treatment with these compounds. Therefore, new AR antagonists are required for patient follow-up treatment. In the course of screening for a new AR antagonist, we isolated the novel compounds antarlides A-E (1-5) from Streptomyces sp. BB47. Antarlides are mutually isomeric with respect to the double bond and have a 22-membered-ring macrocyclic structure. The full stereostructure of 1 was established by chemical modifications, including methanolysis, the Trost method, acetonide formation, and the PGME method. 1-5 inhibited the binding of androgen to ARs in vitro. In addition, 2 inhibited the transcriptional activity of not only wild-type AR but also mutant ARs, which are seen in patients with acquired resistance to clinically used AR antagonists. Therefore, antarlides are a potent new generation of AR antagonists that overcome resistance.

  2. Esta é minha carta ao mundo

    Directory of Open Access Journals (Sweden)

    Fernanda Mourão

    2009-01-01

    Full Text Available A partir da primeira carta de Emily Dickinson (1830-1886 a Thomas Higginson, que então seria seu “preceptor” e interlocutor para sempre, este texto propõe uma leitura da obra da escritora norte-americana a partir do biografema da carta e da ideia de sua obra como “carta ao mundo” – conforme um de seus mais famosos poemas –, com todas as implicações trazidas pelo termo, e à luz das teorias de Roland Barthes, Maurice Blanchot e Silvina Rodrigues Lopes, entre outros.

  3. AoA Region: South Asian Seas

    Digital Repository Service at National Institute of Oceanography (India)

    Naqvi, S.W.A.

    the North Indian Ocean account for roughly one quarter of the world’s population, which makes the region’s coastal environment and resources especially vulnerable to human infl uences. AoA Region: South Asian Seas Wajih Naqvi © Wajih Naqvi Mandovi Estuary... important coastal fi sheries and provides direct sustenance to coastal communities from timber and other products. It is endowed also with rich biodiversity and wildlife. The most extensive mangrove forest in the region and the world’s second largest...

  4. Tracking fluid action in Little Sark Pluton (Channel Islands, UK): a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Schwanethal, J.; Tindle, A. G.; Kelley, S. P.; Sherlock, S. C.

    2011-12-01

    Little Sark pluton (Channel Islands, UK) is a weakly to moderately deformed pluton of quartz diorite composition. Zircon from Little Sark has been dated as 611.4(+2.1/-1.3) Ma [Miller et al. 1991, Tectonophysics, 312], whereas titanite has an age of 606.2±0.6 Ma. Hornblende yields an Ar-Ar age of 606.4±3.4 Ma [Dallmeyer et al., 1991, J. Geol. Soc. London 148]. The rocks show evidence for post-magmatic hydrous alteration including chloritisation of biotite, and sericite formation in feldspar. We investigated the alteration in order to understand its influence on the Ar-Ar system. Detailed petrographic investigations of two samples indicate different deformation levels - S1, (less deformed), and S2 (more deformed). The feldspar is andesine to oligoclase in composition, but contains K-rich areas with patchy and sometimes cleavage guided sericitization. Mafic minerals include hornblende and biotite (the latter partially chloritized). Ar-Ar investigations were carried out using high spatial resolution UV laser ablation gas release in combination with a Nu instruments Noblesse gas mass spectrometer using spots of 80 to 140 μm diameter. Mafic minerals in S1 have highly variable 38Ar/39Ar and 37Ar/39Ar ratios and unusually high atmospheric contents for such old samples, possibly reflecting the presence of fluid inclusions associated with the sericite, particularly in the feldspar. The apparent ages in their entirety range from 429 to 668 Ma. Hornblende yields homogeneous apparent ages, whereas the younger and older ages are measured in both micas and feldspars, whose apparent ages range from 245-670 Ma. The modal age for feldspar is around 400-450 Ma, but this may not have geological meaning. Sample S2 shows many of the same features as S1. Mafic minerals span a slightly smaller age range and feldspars display apparent ages of ~245-645 Ma with a mode around 480 Ma. The alteration of both samples appears to have been accompanied by the introduction of 40Ar-rich fluids

  5. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  6. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  7. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  8. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  9. AO Observations of Three Powerful Radio Galaxies

    Energy Technology Data Exchange (ETDEWEB)

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  10. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  11. Contribuição ao manejo sustentável do complexo ferruginoso nectandra na floresta nacional de Ibirama, SC Contribution to sustainable forest management of the nectandra ferruginous complex in the Ibirama national forest, SC, Brazil

    Directory of Open Access Journals (Sweden)

    Fernando Campanhã Bechara

    2009-02-01

    Full Text Available Diante do mercado aberto para a produção de madeiras tropicais, o complexo ferruginoso Nectandra (CFN, formado pelo grupo de espécies Nectandra lanceolata, N. oppositifolia e N. rigida (canelas-ferrugem, possui aspectos promissores, pois apresenta madeira de alto valor mercadológico e com potencial silvicultural. Esse grupo de espécies é de difícil distinção em campo, justificando-se o manejo do complexo em conjunto. Essas são as primeiras espécies madeireiras a se tornarem abundantes em florestas secundárias na Região Sul do país, favorecidas pela abertura de pequenas clareiras. Realizaram-se estudos demográficos desse grupo, na FLONA de Ibirama, SC, objetivando alicerçar o manejo sustentável de madeira para serraria. Numa Floresta Ombrófila Densa de 38 ha, foram inventariados todos os indivíduos do CFN presentes em 14 parcelas aleatórias de 40 x 40 m. Caracterizou-se a distribuição espacial das árvores, bem como a produção de madeira. A população apresentou distribuição espacial aleatória, sendo 58% de toras de boa qualidade. Ocorreram 43 indivíduos/ha na regeneração, o que caracteriza a formação de banco de plântulas. Foi possível explorar 11 árvores/ha (com DAP > 16 cm, o que representaria 3,5 m³ de madeira/ha. Um ciclo de corte de 20 anos renderia quase 7 m³ de madeira de alta qualidade ao ano. Dez por cento das árvores adultas apresentaram três rebrotas/indivíduo, estabelecendo o potencial de segunda rotação. As árvores classificadas como toras de "baixa qualidade" (32% do total e com DAP > 40 cm podem ser deixadas como porta-sementes. Recomendam-se estudos mais detalhados de demografias espacial e temporal, autoecologia e análise econômica para alicerçar o manejo sustentável.In view of the opening of the tropical wood production market, the Nectandra ferruginous complex (NFC, defined as a group of Nectandra species - N. lanceolata, N. oppositifolia and N. rigida - offers promising

  12. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  13. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  14. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  15. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  16. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  17. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  18. Cosmologia e Representa\\c{c}\\~ao

    CERN Document Server

    Ribeiro, Marcelo Byrro

    2013-01-01

    This work presents a brief and non-technical description of the main results and concepts of the modern scientific cosmology, viewing it from an epistemological perspective which allows a dialog with other modes of thinking like e.g. history, philosophy, sociology and religion. This epistemological viewpoint is based on the philosophical theses advanced by Ludwig Boltzmann (1844-1906) which states that scientific theories are nothing more than representations, or images, of nature (arXiv:physics/0701308v1). By being representations one cannot know how nature really is because the intrinsic and indispensable properties that characterize nature are unreachable by science. In other words, the true essences that constitute nature are unknowable. Therefore, all answers proposed by science are partial, simplified and replaceable. Another way of putting forward this viewpoint is to state that all scientific truths are provisional, a result which naturally leads to the conclusion that the same set of phenomena, or sc...

  19. A psicologia positiva aplicada ao contexto escolar

    OpenAIRE

    Ramôa, Maria Manuel Valente Braz Sepúlveda

    2016-01-01

    Relatório de estágio apresentado à Escola Superior de Educação de Paula Frassinetti para a obtenção de grau de mestre em educação pré-escolar e ensino do 1º ciclo do ensino básico A Psicologia positiva é considerada uma nova perspetiva de investigação e intervenção, promovendo o estudo das condições e processos que contribuem para o florescimento ou funcionamento ótimo das pessoas, grupos ou instituições, pretendendo debruçar-se sobre as experiências positivas tais como as emoções positiva...

  20. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  1. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  2. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  3. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  4. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  5. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  6. The role of mitochondrial fusion and StAR phosphorylation in the regulation of StAR activity and steroidogenesis.

    Science.gov (United States)

    Castillo, Ana F; Orlando, Ulises; Helfenberger, Katia E; Poderoso, Cecilia; Podesta, Ernesto J

    2015-06-15

    The steroidogenic acute regulatory (StAR) protein regulates the rate-limiting step in steroidogenesis, i.e. the delivery of cholesterol from the outer (OMM) to the inner (IMM) mitochondrial membrane. StAR is a 37-kDa protein with an N-terminal mitochondrial targeting sequence that is cleaved off during mitochondrial import to yield 30-kDa intramitochondrial StAR. StAR acts exclusively on the OMM and its activity is proportional to how long it remains on the OMM. However, the precise fashion and the molecular mechanism in which StAR remains on the OMM have not been elucidated yet. In this work we will discuss the role of mitochondrial fusion and StAR phosphorylation by the extracellular signal-regulated kinases 1/2 (ERK1/2) as part of the mechanism that regulates StAR retention on the OMM and activity.

  7. Fluvoxamina no transtorno depressivo maior: um estudo multicêntrico aberto Fluvoxamine in the treatment of major depressive disorder: an open multicentric study

    Directory of Open Access Journals (Sweden)

    José Alberto Del Porto

    2007-01-01

    Full Text Available OBJETIVO: Este trabalho estudou a eficácia e a tolerabilidade da fluvoxamina no tratamento, de forma aberta, sem comparação com placebo ou outros agentes, por 6 semanas, de pacientes com o diagnóstico de transtorno depressivo maior (TDM. Constitui-se em objetivo secundário do estudo avaliar os efeitos da fluvoxamina sobre o sono dos pacientes. MÉTODOS: Foram incluídos 104 pacientes, maiores de 18 anos, com o diagnóstico de TDM, de acordo com os critérios do Manual Diagnóstico e Estatístico de Transtornos Mentais, 4ª edição (DSM-IV, e com escores, na Escala de Hamilton para Depressão, versão de 17 itens (HAM-D 17, de 17 pontos ou mais. Avaliou-se a eficácia da fluvoxamina por meio das Escalas HAM-D 17 e da CGI (Impressão Clínica Global. A análise dos itens 4, 5 e 6 da HAM-D 17 foi utilizada para a avaliação do sono dos pacientes. Avaliaram-se a segurança e a tolerabilidade da fluvoxamina ao longo das 6 semanas, registrando-se quaisquer eventos adversos. A fluvoxamina foi inicialmente ministrada em doses de 50 ou 100 mg/dia, podendo haver aumentos progressivos até 300 mg/dia. RESULTADOS: Dos 104 pacientes incluídos, 81 (78% concluíram o estudo. Obtiveram resposta favorável (diminuição de 50% ou mais na HAM-D 17 69% dos pacientes, e a taxa de remissão (HAM-D 17 OBJECTIVE: This research studied the efficacy and tolerability of fluvoxamine in the treatment of major depressive disorder (MDD, during 6 weeks, in an open trial, without placebo or active comparator. A secondary objective was the evaluation of the effects of fluvoxamine on the sleep of the pacients. METHODS: 104 patients were inicially included, with the diagnosis of MDD in accordance to the criteria of the Diagnostic and Statistical Manual for Mental Disorders, 4th edition (DSM-IV. Patients should have scores > 17 in the Hamilton Depression Scale for Depression 17 itens (HAM-D 17. The efficacy of fluvoxamine was studied through the HAM-D 17 and CGI (Clinical

  8. Behavior of argon gas release from manganese oxide minerals as revealed by 40Ar/39Ar laser incremental heating analysis

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Manganese oxides in association with paleo- weathering may provide significant insights into the multiple factors affecting the formation and evolution of weathering profiles, such as temperature, precipitation, and biodiversity. Laser probe step-heating analysis of supergene hollandite and cryptomelane samples collected from central Queensland, Australia, yield well-defined plateaus andconsistent isochron ages, confirming the feasibility dating very-fined supergene manganese oxides by 40Ar/39Ar technique. Two distinct structural sites hostingAr isotopes can be identified in light of their degassing behaviors obtained byincremental heating analyses. The first site, releasing its gas fraction at thelaser power 0.2-0.4 W, yields primarily 40Aratm, 38Aratm, and 36Aratm (atmospheric Ar isotopes). The second sites yield predominantly 40Ar* (radiogenic 40Ar),39ArK, and 38ArK (nucleogenic components), at ~0.5-1.0 W. There is no significant Ar gas released at the laser power higher than 1.0 W, indicating the breakdown of the tunnel sites hosting the radiogenic and nucleogenic components. The excellent match between the degassing behaviors of 40Ar*, 39ArK, and 38ArK suggests that these isotopes occupy the same crystallographic sites and that 39ArK lossfrom the tunnel site by recoil during neutron irradiation and/or bake-out procedure preceding isotopic analysis does not occur. Present investigation supports that neither the overwhelming atmospheric 40Ar nor the very-fined nature of the supergene manganese oxides poses problems in extracting meaningful weathering geochronological information by analyzing supergene manganese oxides minerals.

  9. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  10. Androgen Receptor-Mediated Growth Suppression of HPr-1AR and PC3-Lenti-AR Prostate Epithelial Cells.

    Directory of Open Access Journals (Sweden)

    Young-Chae Kim

    Full Text Available The androgen receptor (AR mediates the developmental, physiologic, and pathologic effects of androgens including 5α-dihydrotestosterone (DHT. However, the mechanisms whereby AR regulates growth suppression and differentiation of luminal epithelial cells in the prostate gland and proliferation of malignant versions of these cells are not well understood, though they are central to prostate development, homeostasis, and neoplasia. Here, we identify androgen-responsive genes that restrain cell cycle progression and proliferation of human prostate epithelial cell lines (HPr-1AR and PC3-Lenti-AR, and we investigate the mechanisms through which AR regulates their expression. DHT inhibited proliferation of HPr-1AR and PC3-Lenti-AR, and cell cycle analysis revealed a prolonged G1 interval. In the cell cycle, the G1/S-phase transition is initiated by the activity of cyclin D and cyclin-dependent kinase (CDK complexes, which relieve growth suppression. In HPr-1AR, cyclin D1/2 and CDK4/6 mRNAs were androgen-repressed, whereas CDK inhibitor, CDKN1A, mRNA was androgen-induced. The regulation of these transcripts was AR-dependent, and involved multiple mechanisms. Similar AR-mediated down-regulation of CDK4/6 mRNAs and up-regulation of CDKN1A mRNA occurred in PC3-Lenti-AR. Further, CDK4/6 overexpression suppressed DHT-inhibited cell cycle progression and proliferation of HPr-1AR and PC3-Lenti-AR, whereas CDKN1A overexpression induced cell cycle arrest. We therefore propose that AR-mediated growth suppression of HPr-1AR involves cyclin D1 mRNA decay, transcriptional repression of cyclin D2 and CDK4/6, and transcriptional activation of CDKN1A, which serve to decrease CDK4/6 activity. AR-mediated inhibition of PC3-Lenti-AR proliferation occurs through a similar mechanism, albeit without down-regulation of cyclin D. Our findings provide insight into AR-mediated regulation of prostate epithelial cell proliferation.

  11. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  12. LGS-AO Imaging of Every Kepler Planet Candidate: the Robo-AO KOI Survey

    Science.gov (United States)

    Baranec, Christoph; Law, Nicholas; Morton, Timothy; Ziegler, Carl; Nofi, Larissa; Atkinson, Dani; Riddle, Reed

    2015-12-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging, to search for blended nearby stars which may be physically associated companions and/or responsible for transit false positives. We will present the results from searching for companions around over 3,000 Kepler planet hosts in 2012-2015. We will describe our first data release covering 715 planet candidate hosts, and give a preview of ongoing results including improved statistics on the likelihood of false positive planet detections in the Kepler dataset, many new planets in multiple star systems, and new exotic multiple star systems containing Kepler planets. We will also describe the automated Robo-AO survey data reduction methods, including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for extremely large adaptive optics surveys. Our first data release covered 715 objects, searching for companions from 0.15” to 2.5” separation with contrast up to 6 magnitudes. We measured the overall nearby-star-probability for Kepler planet candidates to be 7.4+/-1.0%, and we will detail the variations in this number with stellar host parameters. We will also discuss plans to extend the survey to other transiting planet missions such as K2 and TESS as Robo-AO is in the process of being re-deployed to the 2.1-m telescope at Kitt Peak for 3 years and a higher-contrast Robo-AO system is being developed for the 2.2-m UH telescope on Maunakea.

  13. Rentabilidade da tangerineira 'Ponkan' submetida ao raleio químico comparada com ao manejo convencional

    Directory of Open Access Journals (Sweden)

    Maria do Céu Monteiro Cruz

    2011-10-01

    Full Text Available A pesquisa foi conduzida em um pomar comercial, localizado no município de Perdões, região sul de Minas Gerais, com o objetivo de analisar e comparar a rentabilidade da produção da tangerineira 'Ponkan' (Citrus reticulata Blanco submetida ao raleio químico com o manejo convencional. Para se montar a matriz de coeficientes técnicos dos custos de produção e os indicadores de rentabilidade da cultura, os dados foram obtidos com os produtores da região e baseados em trabalho de pesquisa realizado no pomar, no período de dezembro de 2006 a julho de 2008. Foram utilizadas plantas com dez anos de enxertadas sobre limoeiro 'Cravo' (Citrus limonia Osbeck. No primeiro ano, o raleio químico foi realizado com aplicação de Ethephon na concentração de 600 mg L-1,e por ocasião da colheita foi avaliado o rendimento da produção nas plantas submetidas ao raleio químico e ao manejo convencional. No segundo ano, foi determinada a alternância de produção e a produtividade. A prática do raleio químico proporcionou maior rentabilidade, em termos de produtividade da tangerina 'Ponkan', que o manejo convencional, sem a adoção do raleio.

  14. Adesão ao tratamento da Hanseníase: dificuldades inerentes aos portadores

    Directory of Open Access Journals (Sweden)

    Izaildo Tavares Luna

    2010-12-01

    Full Text Available Esta pesquisa, realizada em Guaiúba, CE, Brasil, objetivou identificar as dificuldades de adesão ao tratamento pelos portadores de hanseníase, relacionando os fatores associados. Estudo qualitativo, cujos dados foram coletados a partir de uma visita domiciliária com roteiro de entrevista contendo sete questões norteadoras. Participaram pacientes com diagnóstico de hanseníase e histórico de não adesão ao tratamento. Utilizou-se o Modelo de Atividade de Vida de Roper, Logan e Tierney. As falas dos sujeitos foram categorizadas de acordo com as doze atividades de vida. A utilização do modelo possibilitou uma abordagem holística sobre as barreiras vivenciadas pelo hanseniano na adesão ao tratamento medicamentoso, de modo a conhecer as atividades de vida destes pacientes para possível adequação de ações voltadas a essa clientela.

  15. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone.

  16. Disciplina partidária e apoio ao governo no bicameralismo brasileiro

    Directory of Open Access Journals (Sweden)

    Pedro Robson Pereira Neiva

    2011-06-01

    Full Text Available O artigo avalia a disciplina dos partidos políticos no poder Legislativo brasileiro e o apoio que proporcionam ao governo, sob uma perspectiva bicameral. Busco dois objetivos principais. O primeiro é o de incluir o Senado na discussão sobre o relacionamento entre o poder Executivo e o poder Legislativo no país, comparando-o com a Câmara dos Deputados. Em segundo lugar, procuro avaliar os partidos individualmente, levando em consideração as suas características peculiares, que não são inerentes ao sistema partidário. A análise foi feita a partir das votações nominais realizadas na Câmara dos Deputados e no Senado Federal no período de 1989 a 2008, comparando o comportamento dos partidos entre si e com eles mesmos, ao longo do tempo. A abordagem cross-section e longitudinal permitiu observar resultados até então não identificados pela literatura que trata do relacionamento entre o poder Executivo e o poder Legislativo no país. Apesar de reforçar a corrente da literatura que afirma serem os partidos coesos, disciplinados e previsíveis, argumento que eles diferem substancialmente entre si, seja em suas estratégias, seja em sua forma de articulação. Dada a elevada fragmentação e as características peculiares de cada um dos partidos, não parece apropriado falar-se em atributos sistêmicos, que se estendam para todos eles; menos ainda quando se leva em consideração as duas casas legislativas.

  17. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  18. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  19. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  20. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  1. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  2. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  3. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  4. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  5. VARIABILIDADE TEMPORAL DA TEMPERATURA DO AR EM JABOTICABAL – SP

    Directory of Open Access Journals (Sweden)

    GARCIA, Anice

    2015-05-01

    Full Text Available The study aimed to obtain a monthly average temperature equation estimated from the analysis of the variability of temperatures (maximum, average and minimum, to Jaboticabal /SP. The analysis of the parameters was made monthly, seasonal, annual and interannual. Data (1971-2013 were collected in a Agrometeorological Station of the Universidade Estadual Paulista (UNESP at Jaboticabal Campus(Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. On the data were applied statistical methods (mean, standard deviation and coefficient of variation. Were also correlated the monthly averages obtained by the standard method (INMET and by the method of extreme temperatures. The results showed that standard deviation of the temperatures had a slow variations with low coefficient of variation. The equations obtained between the mean values of standard INMET and the mean of the extreme, can be used for micro region of Jaboticabal with good accuracy in results. Este estudo teve como objetivo analisar a variabilidade de temperatura e obter uma equação mensal de estimativa de temperatura média do ar a partir da análise das temperaturas (máxima, média e mínima, para Jaboticabal –SP. A análise dos elementos foi feita mensal, sazonal, anual e interanualmente. Os dados, referentes ao período de 1971 a 2013, foram coletados na Estação Agroclimatológica da Universidade Estadual Paulista (UNESP – Campus de Jaboticabal (Lat; 21o14’05”S; Long: 48o17’09”O;. Alt: 616.01m. Sobre os dados foram aplicados métodos estatísticos (média, desvio padrão e coeficiente de variação. Foram, também, correlacionadas as médias mensais obtidas pelo método padrão (INMET e pelo método das temperaturas extremas. Os resultados obtidos mostraram que os desvios das temperaturas (máximas, medias e mínimas tiveram variações discretas com consequentes coeficientes de variação baixos para os elementos estudados. As equações obtidas entre as m

  6. Application of the antibiotic disk diffusion method to multivariate profiling of soil bacterial community: comparing the power to discriminate different soils and dimension of the discrimination with that of the Biolog method Aplicação do método de difusão de disco de antibiótico para traçar o perfil da comunidade bacteriana no solo: comparação de seu poder discriminatório e dimensão da discriminação em relação ao método Biolog

    Directory of Open Access Journals (Sweden)

    Ryoichi Doi

    2003-12-01

    Full Text Available The antibiotic disk diffution (ADD method was compared with the Biolog method in terms of power to discriminate soils and dimension of the discrimination. Soils from a forest and a citrus field in Thailand were profiled with these methods. These methods differentiated the soils in the principal component score plots. Then, Wilk's lambda statistic was determined to estimate power of these methods to discriminate the soils. The ADD method scored Wilk's lambda of 0.003 (p = 0.144 and 0.000 (p=0.020, for direct and ratio-transformed calculation, respectively. The Biolog method recorded Wilk's lambda of 0.001 (p=0.067, 0.003 (p=0.144 and 0.035 (p=0.440, at 0.25, 0.50 and 0.75 average well color developments (AWCDs, respectively. The ADD method showed high discrimination power, or at least comparable to that of the Biolog method. Redundancy analysis (RDA resulted in ordination diagrams, which revealed a difference in dimension of the soil discrimination among the methods and the AWCDs. The soil environmental factors significantly related to the bacterial profiles at p=0.05 were: available phosphorus (ADD method and Biolog 0.25 AWCD, and pH (Biolog 0.50 and 0.75 AWCD. These results indicated that the profiling methods and the AWCDs revealed the multidimensionality of the discrimination. The possibility of the application of the ADD method to extraction of such pieces of information for effective land management was suggested.O método de Difusão de Disco de Antibiótico (ADD foi comparado ao método Biolog quanto ao seu poder de discriminar solos e quanto à dimensão da discriminação, analisando-se os solos de uma floresta e de um campo de cítricos na Tailândia. A diferenciação dos solos por esses métodos foi feita de acordo com o score plot do componente principal.Em seguida, determinou-se o valor de lambda de Wilk para estimar o poder discriminatório desses métodos. O método ADD resultou em lambda de Wilk de 0,003 (p=0,144 e 0,035 (p=0

  7. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  8. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  9. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  10. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  11. Brachyuran Crabs collected at Curaçao

    NARCIS (Netherlands)

    Rathbun, Mary J.

    1924-01-01

    In 1920 a report ¹) on Dr. BOEKE’S collection of crabs and shrimps from Curaçao and other Dutch West Indian Islands was published. Dr. VAN DER HORST’S collection forms an important addition to the fauna of Curaçao, especially as to the Xanthids and Majids, or spider crabs. Four new species were disc

  12. Aspectos Tectônicos das Intrusões dos Granitos do Cerne, Passa Três e Rio Abaixo, Sudeste do Pré-cambriano Paranaense. Estudo Baseado em Datações 39Ar-40Ar em Micas

    Directory of Open Access Journals (Sweden)

    Leonardo Fadel Cury

    2008-04-01

    Full Text Available Os stocks graníticos do Cerne, Passa Três e Rio Abaixo são representados por corpos elípticos, alongados segundo NE-SW(granitos do Cerne e Passa Três e com formas “ovóides” (Granito Rio Abaixo, intrusivos nas seqüências metavulcanossedimentaresda porção sudeste do Cinturão Ribeira, no Estado do Paraná. Esses corpos são representados principalmente por biotitasienogranitos,monzogranitos e quartzo-sienitos porfiríticos, com megacristais de microclínio, isótropos ou com foliação de fluxomagmático, podendo apresentar termos deformados em regiões restritas às zonas de contato. Mostram afinidades petrológicas,geoquímicas e geocronológicas, com características semelhantes aos granitos tipo-A, porém, enriquecidos em Ba, Sr e Zr. Análises40Ar-39Ar em biotitas do Granito do Cerne indicaram idade integrada de 557 ± 2 Ma, valor este relativamente próximo à idade decristalizaç��o dos zircões de aproximadamente 563 Ma, definida por Cury (2003. Determinações 40Ar-39Ar obtidas em rochasencaixantes (muscovitas xistos das vizinhanças do Granito do Cerne apresentam idades mais antigas (800-1200 Ma, o quepermite concluir que a intrusão do granito, bem como o evento metamórfico regional ocorrido durante o Ciclo Brasiliano, nãoatingiram temperaturas suficientes para apagar o registro isotópico das muscovitas (T < 300oC. Os stocks graníticos do Cerne,Passa Três e Rio Abaixo representam magmatismo tardi-orogênico no contexto das deformações presentes no Domínio Apiaí eao arco-magmático Três Córregos-Cunhaporanga (630-590 Ma, relacionado aos estágios finais de transpressão, onde suacolocação é intimamente associada às zonas de cisalhamento transcorrente e desenvolvimento das grandes antiformas e sinformas.Tal período (Proterozóico Superior/Cambriano representa um importante marco na região, associado aos ajustes finais relacionadosà aglutinação do Supercontinente Gondwana.

  13. Conservação de rúcula minimamente processada produzida em campo aberto e cultivo protegido com agrotêxtil Conservation of minimally processed rocket produced under open field conditions and non woven polypropylene

    Directory of Open Access Journals (Sweden)

    Angela F Gonzalez

    2006-09-01

    Full Text Available Folhas de rúcula produzidas em campo aberto e sob cultivo protegido com agrotêxtil foram minimamente processadas, embaladas inteiras ou picadas em bandejas de poliestireno expandido e cobertas com filme de PVC de 14 micras. O delineamento adotado foi o inteiramente casualizado em esquema fatorial 2x2x2 (ambiente de cultivo, forma de preparo e refrigeração a 0(0C e 10(0C, com quatro repetições por tratamento, totalizando 32 bandejas. Os tratamentos foram armazenados a 0ºC e 10ºC por 10 dias, quando foram avaliadas as variáveis perda de massa (%; pH; sólidos solúveis; acidez titulável; cor e aparência. A conservação a 0ºC promoveu uma diminuição da perda de peso da rúcula minimamente processada. A utilização de folhas inteiras ou minimamente processadas foi significativa para sólidos solúveis sendo os maiores valores encontrados para as folhas inteiras. Para folhas picadas observou-se valores de acidez significativamente maiores para as produzidas sob ambiente natural. Independente da forma de preparo, a rúcula produzida em ambiente natural apresentou menor valor de pH. A cor e aparência da rúcula não foram influenciadas pelos tratamentos.Leaves of rocket salad produced under open field and non woven polypropylene were minimally processed and packed entire or pricked in polyestyrene trays covered with PVC film of 14 micras. The treatments were stored at 0(0C and 10(0C per 10 days, when the variables weight loss (%; pH; soluble solids; titratable acidity; colour and appearance were evaluated. The conservation under 0(0C promoted a reduction of weight loss on rocket salad minimally processed. Using entire or minimally processed leaves were significant for soluble solids the biggest values being found for entire leaves. For pricked leaves bigger values of acidity were observed for the produced ones under natural environment. Independent of the preparation form rocket salad produced under natural environment presented minor

  14. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Directory of Open Access Journals (Sweden)

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  15. Atividade colinesterásica cerebral e comportamento de ratos após exposição perinatal ao diclorvós Brain cholinesterase activity and the behavior of rats after perinatal exposure to dichlorvos

    Directory of Open Access Journals (Sweden)

    Jaqueline Pérola de Souza

    2006-04-01

    Full Text Available O organofosforado diclorvós impregnado em coleiras plásticas é um recurso utilizado em medicina veterinária que visa ao controle de ectoparasitas de cães e gatos. O objetivo deste trabalho foi avaliar os efeitos do uso de coleiras plásticas impregnadas com diclorvós (8,37% em ratas Wistar durante o período de gestação e lactação, como possível fonte de alterações comportamentais e da atividade colinesterásica cerebral dos filhotes. Na desmama, não houve diferença na atividade colinesterásica cerebral entre as mães tratadas com diclorvós e o grupo controle, bem como entre os respectivos filhotes. O tratamento com diclorvós também não influenciou no comportamento geral dos animais, avaliado no campo aberto, nem no nível de ansiedade testado no labirinto em cruz elevado, ambos aos 35 dias pós-natal.The organophosphate dichlorvos impregnated into plastic collars (8.37% is used in veterinary practice as an alternative for the control of ectoparasites in dogs and cats. The aim of this work was to determine the possible toxic effects of these collars in female Wistar rats during pregnancy and lactation, as a possible cause of alterations in brain cholinesterase activity and behavior of offspring. At weaning, there was no difference in brain cholinesterase activity between control and treated dams, nor between their respective offspring as well. The treatment did not affect the general behavior of the offspring, when evaluated in the open field, nor anxiety in the elevated plus-maze, both evaluated on the 35th postnatal day.

  16. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  17. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  18. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  19. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  20. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  1. Amando de olhos abertos: Emma Goldman e o dissenso político nos EUA Loving with open eyes: Emma Goldman and the political dissent in the Unites States

    OpenAIRE

    Cecilia Azevedo

    2007-01-01

    Este artigo apresenta a trajetória de Emma Goldman, grande nome do anarquismo, pacifismo e feminismo nos EUA, procurando apresentá- la como uma representante da chamada tradição de dissenso neste país que, ao longo de toda sua história, tem disputado os sentidos a serem atribuídos aos ideais nacionais. Em meio à atual guerra no Iraque, a memória e o legado de Emma Goldman vêm sendo recuperados no embate político em torno do sentido do americanismo.This article presents the life of Emma Goldma...

  2. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  3. AR Sco: A White Dwarf Synchronar

    CERN Document Server

    Katz, J I

    2016-01-01

    The emission of the white dwarf-M dwarf binary AR Sco is driven by the rapid synchronization of its white dwarf, rather than by accretion. This requires a comparatively large magnetic field $\\sim 100$ gauss at the M dwarf and $\\sim 10^8$ gauss on the white dwarf, larger than the fields of most intermediate polars but within the range of fields of known magnetic white dwarfs. The spindown power is dissipated in the atmosphere of the M dwarf by magnetic reconnection, accelerating particles that produce the observed synchrotron radiation. The displacement of the optical maximum from conjunction may be explained either by dissipation in a bow wave as the white dwarf's magnetic field sweeps past the M dwarf or by a misaligned white dwarf's rotation axis and oblique magnetic moment. In the latter case the rotation axis precesses with a period of decades, predicting a drift in the orbital phase of maximum. Binaries whose emission is powered by synchronization may be termed synchronars, in analogy to magnetars.

  4. First closed-loop visible AO test results for the advanced adaptive secondary AO system for the Magellan Telescope: MagAO's performance and status

    Science.gov (United States)

    Close, Laird M.; Males, Jared R.; Kopon, Derek A.; Gasho, Victor; Follette, Katherine B.; Hinz, Phil; Morzinski, Katie; Uomoto, Alan; Hare, Tyson; Riccardi, Armando; Esposito, Simone; Puglisi, Alfio; Pinna, Enrico; Busoni, Lorenzo; Arcidiacono, Carmelo; Xompero, Marco; Briguglio, Runa; Quiros-Pacheco, Fernando; Argomedo, Javier

    2012-07-01

    The heart of the 6.5 Magellan AO system (MagAO) is a 585 actuator adaptive secondary mirror (ASM) with response times (0.7 ms typically). This adaptive secondary will allow low emissivity and high-contrast AO science. We fabricated a high order (561 mode) pyramid wavefront sensor (similar to that now successfully used at the Large Binocular Telescope). The relatively high actuator count (and small projected ~23 cm pitch) allows moderate Strehls to be obtained by MagAO in the “visible” (0.63-1.05 μm). To take advantage of this we have fabricated an AO CCD science camera called "VisAO". Complete “end-to-end” closed-loop lab tests of MagAO achieve a solid, broad-band, 37% Strehl (122 nm rms) at 0.76 μm (i’) with the VisAO camera in 0.8” simulated seeing (13 cm ro at V) with fast 33 mph winds and a 40 m Lo locked on R=8 mag artificial star. These relatively high visible wavelength Strehls are enabled by our powerful combination of a next generation ASM and a Pyramid WFS with 400 controlled modes and 1000 Hz sample speeds (similar to that used successfully on-sky at the LBT). Currently only the VisAO science camera is used for lab testing of MagAO, but this high level of measured performance (122 nm rms) promises even higher Strehls with our IR science cameras. On bright (R=8 mag) stars we should achieve very high Strehls (>70% at H) in the IR with the existing MagAO Clio2 (λ=1-5.3 μm) science camera/coronagraph or even higher (~98% Strehl) the Mid-IR (8-26 microns) with the existing BLINC/MIRAC4 science camera in the future. To eliminate non-common path vibrations, dispersions, and optical errors the VisAO science camera is fed by a common path advanced triplet ADC and is piggy-backed on the Pyramid WFS optical board itself. Also a high-speed shutter can be used to block periods of poor correction. The entire system passed CDR in June 2009, and we finished the closed-loop system level testing phase in December 2011. Final system acceptance (

  5. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Science.gov (United States)

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  6. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  7. Suscetibilidade do capim-colonião e de cultivares de milho ao flúor

    Directory of Open Access Journals (Sweden)

    Rimena Ramos Domingues

    2011-01-01

    Full Text Available A emissão de fluoretos à atmosfera oriunda da produção de superfosfatos e de cerâmica tem causado preocupação pelo efeito tóxico às plantas, contudo são poucos os estudos desenvolvidos acerca do problema com espécie de interesse econômico agrícola. Desenvolveu-se o estudo para avaliar o efeito do flúor (F atmosférico em plantas de capim-colonião e de cultivares de milho, utilizando como referência espécies bioindicadoras do tipo sensível e tolerante. As plantas foram expostas à contaminação pelo F atmosférico por curtos períodos durante 32 dias em sistema de nebulização com 0,16 mol L-1 de ácido fluorídrico no ambiente interno de uma câmara (~0,20 mmol m-3 de F, havendo um controle não exposto, com quatro repetições. A exposição das plantas ao F causou aumento da concentração do elemento nas folhas até 60 mg kg-1 para o capim-colonião, e entre 100 mg kg-1 nas folhas novas e 170 mg kg-1 nas folhas velhas para quatro cultivares de milho, o que demonstrou o efeito cumulativo do elemento no ambiente. Sintomas visuais da toxicidade foram observados nas plantas e se caracterizaram pela ocorrência de cloroses e necroses na lâmina foliar. O capim-colonião é uma espécie bastante sensível ao poluente no ar. As cultivares de milho DKB 390 e Ômega 8315 também são mais sensíveis ao F quando comparadas às AG7088 e 2B707. Os teores de clorofila a nas plantas foram mais afetados pelo F em relação aos teores de clorofila b.

  8. Dicty_cDB: FC-AR11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  9. Dicty_cDB: FC-AR19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  10. Dicty_cDB: FC-AR15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  11. Dicty_cDB: FC-AR07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  12. Dicty_cDB: FC-AR24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  13. Dicty_cDB: FC-AR13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  14. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  15. 40Ar/39Ar geochronology and exhumation of mylonitized metamorphic complex in Changle-Nanao ductile shear zone

    Institute of Scientific and Technical Information of China (English)

    王志洪; 卢华复

    1997-01-01

    New 40Ar/39Ar plateau ages from rocks of Changle-Nanao ductile shear zone are 107.9 Ma(Mus), 108.2 Ma(Bi), 107. 1 Ma(Bi), 109. 2 Ma(Hb) and 117. 9 Ma(Bi) respectively, which are concordant with their isochron ages and record the formation age of the ductile shear zone. The similarity and apparent overlap of the cooling ages with respective closure temperatures of 5 minerals document initial rapid uplift during 107-118 Ma following the collision between the Min-Tai microcontinent and the Min-Zhe Mesozoic volcanic arc. The 40Ar/39Ar plateau ages, K-Ar date of K-feldspar and other geochronologic information suggest that the exhumation rate of the ductile shear zone is about 0.18-1.12 mm/a in the range of 107-70 Ma, which is mainly influenced by tectonic extension.

  16. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  17. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    International Nuclear Information System (INIS)

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  18. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Science.gov (United States)

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  19. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  20. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Science.gov (United States)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcanic sequences of Monte Vulture (Southern Italy) were analysed using Ar-Ar stepwise heating. In all samples phlogopite and sanidine are internally inhomogeneous as observed in a plot of Cl/K ratio vs step-age. At least two phases that are degassed during different temperature steps can be distinguished, resulting in internal discordance. Hence, all samples are affected by impurities and have to be treated as heterochemical mixtures. These effects are strongest in phlogopite. The high uncertainty of the calculated ages mirrors the statistically significant age discordance. The calculation of average ages was focused on isochemical steps. Isochron calculations necessarily give less precise ages because of the excessive scatter of datapoints. Moreover, most coarse grained phlogopites could contain excess 40Ar (as suggested by non-atmospheric intercepts in isochron plots) which could be of mantle origin. The analysed phlogopites from carbonatitic and melilite-foiditolite rocks of the upper stratigraphical sequence of Monte Vulture are Mg-rich, which indicates a mantle provenance (Stoppa and Woolley, 1997). All calculated phlogopite ages have, therefore, to be considered with caution. One sample, PG5, contains both sanidine and matrix phlogopite. This offers the possibility to directly compare the analytical results and further decipher possible inconsistencies. Ages were calculated as the average of isochemical steps, and errors are indicated at the 95% confidence level. Sanidine gives a weighted average age of 752±13 ka in agreement with the phlogopite age of 801±88 ka. In comparison to these average step ages, an isochron over five sanidine-steps yields an age of 737±35 ka (MSWD=1.5) and an atmospheric intercept of 295±49. The eruptive time-span covered by the analysed samples is 75±20 ka, confirming that the eruption history of Monte Vulture has been organised in clusters of activity

  1. Surface modification and biocompatible improvement of polystyrene film by Ar, O2 and Ar + O2 plasma

    International Nuclear Information System (INIS)

    Highlights: ► NVP is successfully grafted onto the different discharge gases (Ar, O2, and Ar + O2) plasma-treated PS film surface by Ar plasma induced graft polymerization. ► Compare with Ar and O2 plasma, the Ar + O2 plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. ► According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. ► Cellular compatibility tests indicate that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O2, and Ar + O2) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  2. A new approach to cosmogenic corrections in 40Ar/39Ar chronometry: Implications for the ages of Martian meteorites

    Science.gov (United States)

    Cassata, W. S.; Borg, L. E.

    2016-08-01

    Anomalously old 40Ar/39Ar ages are commonly obtained from Shergottites and are generally attributed to uncertainties regarding the isotopic composition of the trapped component and/or the presence of excess 40Ar. Old ages can also be obtained if inaccurate corrections for cosmogenic 36Ar are applied. Current methods for making the cosmogenic correction require simplifying assumptions regarding the spatial homogeneity of target elements for cosmogenic production and the distribution of cosmogenic nuclides relative to trapped and reactor-derived Ar isotopes. To mitigate uncertainties arising from these assumptions, a new cosmogenic correction approach utilizing the exposure age determined on an un-irradiated aliquot and step-wise production rate estimates that account for spatial variations in Ca and K is described. Data obtained from NWA 4468 and an unofficial pairing of NWA 2975, which yield anomalously old ages when corrected for cosmogenic 36Ar using conventional techniques, are used to illustrate the efficacy of this new approach. For these samples, anomalous age determinations are rectified solely by the improved cosmogenic correction technique described herein. Ages of 188 ± 17 and 184 ± 17 Ma are obtained for NWA 4468 and NWA 2975, respectively, both of which are indistinguishable from ages obtained by other radioisotopic systems. For other Shergottites that have multiple trapped components, have experienced diffusive loss of Ar, or contain excess Ar, more accurate cosmogenic corrections may aid in the interpretation of anomalous ages. The trapped 40Ar/36Ar ratios inferred from inverse isochron diagrams obtained from NWA 4468 and NWA 2975 are significantly lower than the Martian atmospheric value, and may represent upper mantle or crustal components.

  3. Ar Ar dating of authigenic K-feldspar: Quantitative modelling of radiogenic argon-loss through subgrain boundary networks

    Science.gov (United States)

    Mark, D. F.; Kelley, S. P.; Lee, M. R.; Parnell, J.; Sherlock, S. C.; Brown, D. J.

    2008-06-01

    We have analysed two distinct generations of authigenic K-feldspar in Fucoid Bed sandstones from An-t-Sron and Skiag Bridge, NW Highlands, Scotland, which have experienced post-growth heating to levels in excess of the predicted Ar-closure temperature. Authigenic K-feldspars show microtextural similarities to patch perthites; that is subgrains separated by dislocation-rich boundary networks that potentially act as fast diffusion pathways for radiogenic argon. The two generations of authigenic K-feldspar in the Fucoid Bed sandstones can be distinguished by different microtextural zones, bulk mineral compositions, fluid-inclusion populations, and inferred temperatures and chemistries of parent fluids. Ar-Ar age data obtained using high-resolution ultraviolet laser ablation, show that the first cementing generation is Ordovician and the second cementing generation is Silurian. Modelling of Ar diffusion using subgrain size as the effective diffusion dimension and a simplified tectono-thermal thrust model assuming transient heating of the Fucoid Beds is inconsistent with observed data. Removal of heat from the thrust zone through rapid flushing of heated fluids rather than transient heating can be invoked to explain the observed Ar-Ar ages for both generations of cement. Alternatively, Ar-diffusion modelling using overgrowth thickness as the effective diffusion dimension instead of subgrain size also yields models that are consistent with both the Fucoid Bed palaeothermal maxima and determined Ar-Ar age ages for the two generations of K-feldspar cement. Based on this alternate explanation, we propose a theoretical microtextural model that highlights fundamental differences between the microtextures of deuterically formed patch perthites and authigenic K-feldspars, explaining the apparent robustness of authigenic K-feldspar with respect to Ar-retention.

  4. New 40Ar/39Ar Ages From Southwest Bolivia Refine the Timing of APVC Volcanism

    Science.gov (United States)

    Salisbury, M.; de Silva, S. L.; Jicha, B.; Singer, B.; Jiménez, N.; Ort, M.

    2008-12-01

    The Altiplano-Puna Volcanic Complex (APVC) of the Central Andes has produced prodigious silicic volcanism (at least 11,000 km3 of magma) over the last 10 Ma including some of the largest known ignimbrites on Earth. Despite excellent exposure, little previous work had been conducted on the timing and distribution of ignimbrite volcanism in the Lípez region of southwestern Bolivia, the heart of the APVC. To address this deficiency we have performed ~612 single crystal laser-fusion 40Ar/39Ar analyses from 39 pumice and bulk matrix samples collected from the main ignimbrite units within the Lípez region. Geochemistry of pumice and mineral samples, and paleomagnetic data are also being used to correlate individual ignimbrite units. Our new 40Ar/39Ar results establish new or refined eruption ages (with 2σ error) from the Vilama caldera at 8.41±0.02 Ma, Pastos Grandes caldera at 5.45±0.02 and 2.94±0.01 Ma, and Guacha caldera at 5.65±0.01, and 3.57±0.02 Ma. New ages were also determined for eruptions from the Panizos ignimbrite shield (6.86±0.03 Ma), Juvina ignimbrite shield (5.23±0.01 Ma), and the Laguna Colorado ignimbrite shield (2.21±0.05 and 1.95±0.03 Ma). The oldest ignimbrite we have found in the area is 10.33±0.64 Ma, a local unit beneath the Vilama ignimbrite. The youngest units have been identified west of the Guacha caldera with eruption ages of 1.70±0.6 Ma and 0.70±0.01 Ma. These results demonstrate that ignimbrite-producing eruptions in the Lípez region span the age of APVC volcanism previously established, with the largest eruptions occurring from long-lived, cyclic supervolcano caldera systems like Guacha and Pastos Grandes. The aggregate data from the APVC support the hypothesis that the APVC developed predominantly during distinct pulses of massive ignimbrite eruptions at ~8, 6, and 4 Ma and attest to episodic behavior of the magmatic system. Ignimbrites of geothermal presence and active local surface deformation suggest that the magma

  5. Antecedentes e consequencia da atitude frente ao anuncio nos idosos

    OpenAIRE

    Sanchez, Javier; Estrada, Marta; Moliner, Miguel Angel; Fandos, Juan Carlos

    2011-01-01

    A importancia sócio-economica adquirida nos ultimos anos na Espanha e em outros paises europeus pelo emergente mercado dos idosos toma necessaria o estudo de suas particularidades como consumidores. As mudanças ocorridas durante o proceso do envelhecimento exercem uma influencia na percepçao do fenómeno publicitario e, par conseguinte, na atitude manifestada frente ao anúcio. o estudo nos idosos dos antecedentes da atitude frente ao anuncio e suas consequencias no contexto do modelo de mediaç...

  6. The Robo-AO automated intelligent queue system

    CERN Document Server

    Riddle, Reed L; Papadopoulos, Athanasios; Baranec, Christoph; Law, Nicholas M

    2014-01-01

    Robo-AO is the first automated laser adaptive optics instrument. In just its second year of scientific operations, it has completed the largest adaptive optics surveys to date, each comprising thousands of targets. Robo-AO uses a fully automated queue scheduling system that selects targets based on criteria entered on a per observing program or per target basis, and includes the ability to coordinate with US Strategic Command automatically to avoid lasing space assets. This enables Robo-AO to select among thousands of targets at a time, and achieve an average observation rate of approximately 20 targets per hour.

  7. AVALIAÇÃO DA QUALIDADE DO AR INTERIOR DO HOSPITAL UNIVERSITÁRIO PEDRO ERNESTO

    Directory of Open Access Journals (Sweden)

    Eduardo Delfino Sodré

    2014-12-01

    Full Text Available DOI: 10.12957/sustinere.2014.14126A “Síndrome do Edifício Doente” é um termo utilizado para definir a má qualidade do ar de ambientes interiores e tem sido de preocupação crescente da comunidade científica. A avaliação da qualidade do ar, nos locais amostrados no HUPE, fundamentada na resolução n° 9 de 2003 da Agência Nacional de Vigilância Sanitária, teve como objetivos conhecer e informar para que a Comissão de Controle de Infecção Hospitalar avalie a interação deste fator com as infecções nosocomiais e decida pela necessidade, ou não, de medidas corretivas e contribuir para o conhecimento e desenvolvimento de técnicas e controle da poluição “Indoor”. As amostras foram coletadas com um amostrador de ar tipo impactador linear, de um estágio (MERCK e a interpretação dos resultados utilizou dois critérios contidos na norma vigente: o valor máximo aceitável (VMA de fungos em ambientes internos (750UFC/m3 e o limite aceitável entre a contaminação interna e externa (I/E ≤ 1,5. Entre os sessenta ambientes avaliados nos três primeiros pavimentos do HUPE 20% do total encontravam-se em desacordo com relação ao número de UFC/m3 e 16,6% em relação à relação I/E. Conclui-se que 28% dos setores avaliados do 1° pavimento do HUPE e 26% dos contidos no 2° pavimento não estão tendo a renovação de ar desejada, propiciando o acúmulo de fungos.

  8. TEMPERATURA DO AR NO INTERIOR DO CANAL DE CULTIVO E CRESCIMENTO DA ALFACE EM FUNÇÃO DO MATERIAL DE COBERTURA DA MESA DE CULTIVO HIDROPÔNICO - NFT

    Directory of Open Access Journals (Sweden)

    MATTOS KAREN MARIA DA COSTA

    2001-01-01

    Full Text Available Estudou-se o efeito de diferentes tipos de material de cobertura de mesas de cultivo hidropônico-NFT na temperatura do interior das canaletas e no crescimento da alface (Lactuca sativa L., cv. Verônica. Em comparação ao tratamento-controle (tubos de polipropileno, utilizaram-se mantas de polietileno dupla face (branco e preto e de Tetra-Pak®. O experimento foi realizado no Núcleo Experimental de Campinas, do Instituto Agronômico (22°54'S, 47°05'W, 674 m de altitude, usando-se mesas de cultivo com 24 m de comprimento, dividida em quatro blocos simétricos com os tratamentos distribuídos ao acaso. Sessenta termopares foram instalados no interior dos tubos para avaliar a temperatura interna do ar; armazenaram-se os sinais em um datalogger. Os valores medidos no interior dos tubos foram sempre superiores aos externos. Entretanto, nos tubos protegidos com Tetra-Pak®, os dados da temperatura interna do ar foram sempre de menor magnitude e, os de massa fresca de plantas de alface, superiores aos demais tratamentos. Essas diferenças foram estatisticamente significativas pelo teste de Tukey ao nível de 5%. No período noturno, nenhuma diferença de comportamento foi obtida entre os três tratamentos usados.

  9. Adjuvantes e assistência de ar em pulverizador de barras sobre a deposição da calda e controle de Phakopsora pachyrhizi (Sydow & Sydow

    Directory of Open Access Journals (Sweden)

    Hélio Oliveira Aguiar Júnior

    2011-09-01

    Full Text Available Com o intuito de melhorar a cobertura da pulverização e diminuir as perdas na produtividade da cultura da soja, o estudo objetivou avaliar o efeito da adição de adjuvantes à calda combinado ou não ao uso da assistência de ar sobre a deposição da pulverização, controle de Phakopsora pachyrhizi H. Sydow & P. Sydow, perdas de produção (peso de 1000 grãos e produtividade da cultura (kg ha-1. Dois experimentos a campo foram conduzidos na cultura da soja, variedade Conquista, safra agrícola 2008/09. Um deles no delineamento em blocos ao acaso com três doses de adjuvantes associados a um marcador cúprico combinadas a dois níveis de ar na barra de pulverização (0 e 29 km h-1, totalizando 6 tratamentos e 4 repetições. Outro experimento foi instalado no mesmo local do anterior. O delineamento experimental utilizado foi o de blocos ao acaso com 7 tratamentos: fungicida e dois adjuvantes associados ao fungicida, combinados a dois níveis de ar na barra de pulverização (0 e 29 km h-1, mais testemunha, e 4 repetições. Após a pulverização do fungicida piraclostrobina + epoxiconazole com diferentes tecnologias, procedeu-se a avaliação da severidade da doença através da estimativa da área abaixo da curva de progresso da doença (AACPD e da produtividade da cultura da soja. A assistência de ar na velocidade máxima gerada pelo ventilador (29 km h-1, combinada ao fungicida piraclostrobina + epoxiconazole mais o adjuvante organosiliconado Silwet L-77 contribuiu para melhor controle da ferrugem asiática, proporcionando incremento na produtividade e no peso de 1000 grãos.

  10. A Survey on Web-based AR Applications

    CERN Document Server

    Parhizkar, Behrang; Lashkari, Arash Habibi; Bartaripou, Mohammad Mehdi; Babae, Hossein Reza

    2011-01-01

    Due to the increase of interest in Augmented Reality (AR), the potential uses of AR are increasing also. It can benefit the user in various fields such as education, business, medicine, and other. Augmented Reality supports the real environment with synthetic environment to give more details and meaning to the objects in the real word. AR refers to a situation in which the goal is to supplement a user's perception of the real-world through the addition of virtual objects. This paper is an attempt to make a survey of web-based Augmented Reality applications and make a comparison among them.

  11. Wellness- joogatyöpajojen tuotekehitys: case ArsMondo

    OpenAIRE

    Koukonen, Heidi; Lintunen, Maiju

    2012-01-01

    Tässä opinnäytetyössä tutkitaan, miten ArsMondo Oy:n joogamatkoja voisi kehittää entistä asiakaslähtöisempään suuntaan tulevaisuudessa. Aihe valittiin, sillä se on erittäin mielenkiintoinen ja ajankohtainen aihe matkailun alalla. ArsMondo on suomalainen kulttuurialan yritys, joka räätälöi kulttuuri- ja liikuntamatkoja Italiaan. Työ rajattiin vain ArsMondo- yrityksen joogamatkoihin Italiassa. Teoreettisessa viitekehyksessä avataan jooga- wellness- matkailun käsite sekä kerrotaan wellness- ...

  12. Mass Spectrometric and Langmuir Probe Measurements in Inductively Coupled Plasmas in Ar, CHF3/Ar and CHF3/Ar/O2 Mixtures

    Science.gov (United States)

    Kim, J. S.; Rao, M. V. V. S.; Cappelli, M. A.; Sharma, S. P.; Meyyappan, M.; Arnold, Jim (Technical Monitor)

    2000-01-01

    Absolute fluxes and energy distributions of ions in inductively coupled plasmas of Ar, CHF3/Ar, and CHF3/Ar/O2 have been measured. These plasmas were generated in a Gaseous Electronics Conference (GEC) cell modified for inductive coupling at pressures 10-50 mTorr and 100-300 W of 13.56 MHz radio frequency (RF) power in various feedgas mixtures. In pure Ar plasmas, the Ar(+) flux increases linearly with pressure as well as RF-power. Total ion flux in CHF3 mixtures decreases with increase in pressure and also CHF3 concentration. Relative ion fluxes observed in the present studies are analyzed with the help of available cross sections for electron impact ionization and charge-exchange ion-molecule reactions. Measurements of plasma potential, electron and ion number densities, electron energy distribution function, and mean electron energy have also been made in the center of the plasma with a RF compensated Langmuir probe. Plasma potential values are compared with the mean ion energies determined from the measured ion energy distributions and are consistent. Electron temperature, plasma potential, and mean ion energy vary inversely with pressure, but increase with CHF3 content in the mixture.

  13. Experimental study of NO2 reduction in N2/Ar and O2/Ar mixtures by pulsed corona discharge.

    Science.gov (United States)

    Zhu, Xinbo; Zheng, Chenghang; Gao, Xiang; Shen, Xu; Wang, Zhihua; Luo, Zhongyang; Cen, Kefa

    2014-11-01

    Non-thermal plasma technology has been regarded as a promising alternative technology for NOx removal. The understanding of NO2 reduction characteristics is extremely important since NO2 reduction could lower the total NO oxidation rate in the plasma atmosphere. In this study, NO2 reduction was experimentally investigated using a non-thermal plasma reactor driven by a pulsed power supply for different simulated gas compositions and operating parameters. The NO2 reduction was promoted by increasing the specific energy density (SED), and the highest conversion rates were 33.7%, 42.1% and 25.7% for Ar, N2/Ar and O2/Ar, respectively. For a given SED, the NO2 conversion rate had the order N2/Ar>Ar>O2/Ar. The highest energy yield of 3.31g/kWh was obtained in N2/Ar plasma and decreased with increasing SED; the same trends were also found in the other two gas compositions. The conversion rate decreased with increasing initial NO2 concentration. Furthermore, the presence of N2 or O2 led to different reaction pathways for NO2 conversion due to the formation of different dominating reactive radicals. PMID:25458679

  14. Correlação e correspondência topográfica entre espessura da camada de fibras nervosas da retina e campo visual no glaucoma primário de ângulo aberto Correlation and topographic match between nerve fiber layer thickness and visual field in primary open angle glaucoma

    Directory of Open Access Journals (Sweden)

    Paula Boturão de Almeida

    2001-04-01

    Full Text Available Objetivo: Verificar a correlação e a correspondência topográfica entre a espessura da camada de fibras nervosas da retina, medidas pelo polarímetro de varredura a laser GDxTM Scanning Laser System® e o campo visual, medido pelo perímetro automatizado Humphrey® ("white-white" em portadores de glaucoma primário de ângulo aberto. Métodos: Foram investigadas as seguintes correlações: 1- Correlação entre a média da sensibilidade dos quadrantes e do ponto de fixação do campo visual, em decibéis, e a média da espessura da camada de fibras nervosas da retina correspondente, em micra, sem classificação dos olhos dos pacientes quanto ao estadio do comprometimento perimétrico. 2- A mesma correlação anterior, porém, com os olhos dos pacientes distribuídos em classes quanto à alteração perimétrica. 3- Correlação entre os índices globais do campo visual e os índices numéricos do analisador de espessura da camada de fibras nervosas da retina. 4- Correlação entre a média dos valores do gráfico "total deviation" do campo visual e o desvio da normalidade da camada de fibras nervosas da região correspondente. 5- Investigou-se a freqüência de correspondência topográfica entre os defeitos perimétricos e as alterações da camada de fibras nervosas da retina. Utilizou-se o coeficiente de correlação de Spearman, sendo o nível de rejeição para a hipótese de nulidade fixado num valor menor ou igual a 0,05 (5%. Resultados: Observou-se as seguintes correlações estatisticamentes significantes, mas de forma muito pouco intensa: 1- GDX total e Campo visual total; GDX superior e Campo visual nasal inferior; GDX inferior e Campo visual nasal superior; GDX nasal e Campo visual temporal; GDX superior e Campo visual inferior; GDX inferior e Campo visual superior. 2- GDX inferior e Campo visual nasal (medial superior dos pacientes classificados como graves. 3- Nos olhos classificados como normais: PSD e EM; CPSD e SI.Nos olhos

  15. An efficient algorithm for generating AoA networks

    Directory of Open Access Journals (Sweden)

    Nasser Eddine Mouhoub

    2012-01-01

    Full Text Available The activities, in project scheduling, can be represented graphically in two different ways, by either assigning the activities to the nodes 'AoN directed acyclic graph (dag or to the arcs 'AoA dag. In this paper, a new algorithm is proposed for generating, for a given project scheduling problem, an Activity-on-Arc dag starting from the Activity-on-Node dag using the concepts of line graphs of graphs.

  16. Dicty_cDB: FC-AR08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR08 (Link to dictyBase) - - - Contig-U15118-1 FC-AR08Z (Li...nk to Original site) - - FC-AR08Z 542 - - - - Show FC-AR08 Library FC (Link to library) Clone ID FC-AR08 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR08Q.Seq.d/ Representative seq. ID FC-AR...08Z (Link to Original site) Representative DNA sequence >FC-AR08 (FC-AR08Q) /CSM/FC/FC-AR/FC-AR08Q.Seq....esfilgfmgyr tscrynrwssqlpirycs*knddasrsc*yslfkhlgllgkdchp*rsncllqrcfikch qrfrwcfs

  17. Dicty_cDB: FC-AR06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR06 (Link to dictyBase) - - - - FC-AR06Z (Link to Original site) - - FC-AR...06Z 316 - - - - Show FC-AR06 Library FC (Link to library) Clone ID FC-AR06 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...06Q.Seq.d/ Representative seq. ID FC-AR06Z (Link to Original s...ite) Representative DNA sequence >FC-AR06 (FC-AR06Q) /CSM/FC/FC-AR/FC-AR06Q.Seq.d/ XXXXXXXXXXTGATCCAAGAAAAGG

  18. Dicty_cDB: FC-AR18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR18 (Link to dictyBase) - G03231 DDB0229952 Contig-U16528-1 FC-AR...18E (Link to Original site) - - - - - - FC-AR18E 567 Show FC-AR18 Library FC (Link to library) Clone ID FC-AR...8-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR18Q.Se...q.d/ Representative seq. ID FC-AR18E (Link to Original site) Representative DNA sequence >FC-AR18 (FC-AR18Q) /CSM/FC/FC-AR/FC-AR...QNRALVAGPHSGVERHIINFKWIN LTPLKVNIQRGARINTLIAAIKAADLETKIAALSAVKKINARATKSNQTDFERFKANLIR RKLNKKVSGEVKKLVNIANRAA

  19. Dicty_cDB: FC-AR14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR14 (Link to dictyBase) - - - Contig-U16311-1 FC-AR14Z (Li...nk to Original site) - - FC-AR14Z 593 - - - - Show FC-AR14 Library FC (Link to library) Clone ID FC-AR14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR14Q.Seq.d/ Representative seq. ID FC-AR...14Z (Link to Original site) Representative DNA sequence >FC-AR14 (FC-AR14Q) /CSM/FC/FC-AR/FC-AR14Q.Seq....epsin, complete cds. 72 8e-09 1 BP130435 |BP130435.1 Nicotiana tabacum cDNA, clone: BY2401, primer: M13 forwar

  20. Dicty_cDB: FC-AR09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR09 (Link to dictyBase) - - - Contig-U15312-1 FC-AR09E (Li...nk to Original site) - - - - - - FC-AR09E 702 Show FC-AR09 Library FC (Link to library) Clone ID FC-AR09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR09Q.Seq.d/ Representative seq. ID FC-AR...09E (Link to Original site) Representative DNA sequence >FC-AR09 (FC-AR09Q) /CSM/FC/FC-AR/FC-AR09Q.Seq....elfikr*kerqvc*nrldsleg*r*srrk *rcw*ir*l*ygwhgyatndarygwygrygwygrygwygrygrhgryarwy

  1. Arsénico en el agua de bebida: un problema de salud pública Arsênio na água de beber: um problema de saúde pública

    Directory of Open Access Journals (Sweden)

    Alexandra Galetovic Carabantes

    2003-12-01

    Full Text Available La presencia de arsénico en el ambiente es un problema de salud pública debido a que se trata de un evento de alta frecuencia que ha sido detectado en países como Argentina, Brasil, Chile, China, India, México y Taiwán, entre otros. El arsénico fue clasificado por la International Agency for Research on Cancer (IARC, como un agente carcinogénico para humanos con base en estudios epidemiológicos que relacionan la ingestión de arsénico en el agua de bebida y cáncer en la piel y estudios ocupacionales que relacionan la exposición al arsénico y cáncer de pulmón. La Organización Mundial de la Salud (OMS recomienda um valor orientador para agua de bebida de 10 mg As/L. Por su parte la Environmental Protection Agency (EPA, considerando estimativas de riesgo realizadas utilizando modelos estadísticos basados en observaciones en humanos y extrapolando los datos para concentraciones inferiores a 50 µg/L, reducirá el valor guía para arsénico en el agua de bebida de 50 µg/L para 10 µg/L. La utilización de biomarcadores permite el desarrollo de la epidemiología molecular que promete ser una herramienta que ayudará a detectar efectos tempranos en poblaciones expuestas, permitiendo la prevención de efectos nocivos considerando las características genéticas de las poblaciones.A presença de arsênio no ambiente é um problema de saúde pública por ser um evento de alta freqüência detectado em países como Argentina, Brasil, Chile, China, Índia, México e Taiwan, entre outros. O arsênio foi classificado pela Agência Internacional de Pesquisa sobre Câncer (IARC, como um agente carcinogênico para humanos com base em estudos epidemiológicos que relacionam a ingestão de arsênico na água para consumo humano e câncer na pele e estudos ocupacionais que relacionam a exposição ao arsênico e câncer no pulmão.A Organização Mundial da Saúde (OMS recomenda um valor orientador para água de beber de 10 mg As/L, enquanto que a

  2. High-precision 40Ar/39Ar Age of the Janisjärvi Impact Structure (Russia)

    Science.gov (United States)

    Jourdan, F.; Renne, P. R.; Reimold, U. W.

    2007-12-01

    The ~14 km Jänisjärvi impact structure occurs within the Svecofennian Proterozoic terrains, in the southeastern part of the Baltic shield, Karelia, Russia. Previous K/Ar and 40Ar/39Ar studies were interpreted to give ages of 700 ± 5 Ma and 698 ± 22 Ma respectively, both results being difficult to interpret. Recent paleomagnetic results challenged those ages and propose instead ages of either 500 Ma or 850-900 Ma. In order to better constrain the age of the Jänisjärvi impact structure, we present new 40Ar/39Ar data for melt rocks from the crater. We obtained five concordant isochron ages (based on a total decay constant of 5.543 x 10-10/y and an age of 28.03 Ma for the FCs standard) that yield a combined isochron age of 682 ± 4 Ma (2 sigma) with a MSWD of 1.2, P = 0.14 and 40Ar/36Ar intercept of 475 ± 3. We suggest that this date indicates the age of the impact and therefore can be used in conjunction with existing paleomagnetic results to refine the position of the Baltica paleocontinent at this time. Argon isotopic results imply that melt homogenization has been achieved at the hundred-micron scale certainly because of the low-silica content of the molten target rock that allows fast 40Ar* diffusion in the melt. However, the large range of F(40Ar*inherited) (3 to 8 percents) observed for seven grains show that complete isotopic homogenization was not reached at the centimeter and perhaps millimeter scale. This result is in good agreement with previous Rb and Sr isotopic data.

  3. Single-crystal 40Ar/39Ar incremental heating reveals bimodal sanidine ages in the Bishop Tuff

    Science.gov (United States)

    Andersen, N. L.; Jicha, B. R.; Singer, B. S.

    2015-12-01

    The 650 km3 Bishop Tuff (BT) is among the most studied volcanic deposits because it is an extensive marker bed deposited just after the Matuyama-Brunhes boundary. Reconstructions of the vast BT magma reservoir from which high-silica rhyolite erupted have long influenced thinking about how large silicic magma systems are assembled, crystallized, and mixed. Yet, the longevity of the high silica rhyolitic melt and exact timing of the eruption remain controversial due to recent conflicting 40Ar/39Ar sanidine vs. SIMS and ID-TIMS U-Pb zircon dates. We have undertaken 21 40Ar/39Ar incremental heating ages on 2 mm BT sanidine crystals from pumice in 3 widely separated outcrops of early-erupted fall and flow units. Plateau ages yield a bimodal distribution: a younger group has a mean of 766 ka and an older group gives a range between 772 and 782 ka. The younger population is concordant with the youngest ID-TIMS and SIMS U-Pb zircon ages recently published, as well as the astronomical age of BT in marine sediment. Of 21 crystals, 17 yield older, non-plateau, steps likely affected by excess Ar that would bias traditional 40Ar/39Ar total crystal fusion ages. The small spread in older sanidine ages, together with 25+ kyr of pre-eruptive zircon growth, suggest that the older sanidines are not partially outgassed xenocrysts. A bimodal 40Ar/39Ar age distribution implies that some fraction of rhyolitic melt cooled below the Ar closure temperature at least 10 ky prior to eruption. We propose that rapid "thawing" of a crystalline mush layer released older crystals into rhyolitic melt from which sanidine also nucleated and grew immediately prior to the eruption. High precision 40Ar/39Ar dating can thus provide essential information on thermo-physical processes at the millenial time scale that are critical to interpreting U-Pb zircon age distributions that are complicated by large uncertainties associated with zircon-melt U-Th systematics.

  4. Hydrothermal fluids, argon isotopes and mineralization ages of the Fankou Pb-Zn deposit in south China: Insights from sphalerite 40Ar/39Ar progressive crushing

    Science.gov (United States)

    Jiang, Ying-De; Qiu, Hua-Ning; Xu, Yi-Gang

    2012-05-01

    Hydrothermal fluid geochemistry and mineralization timing are two important factors in the genesis of a hydrothermal deposit. 40Ar/39Ar analyses of fluid inclusions not only provide time constraints for the mineralization but also help to clarify the K-Ca-Cl-Ar characteristics for the ore-forming fluids. In this study, six sphalerite samples collected from the Fankou lead-zinc sulfide deposit are investigated by 40Ar/39Ar in vacuo crushing. Gases liberated from the early and late crushing steps exhibit distinct Ar isotopic compositions and 40Ar/39Ar apparent ages. Argon released in the early steps has much higher 40Ar and 38ArCl and lower 37ArCa contents than those in the late steps. The significant excess Ar (40ArE) extracted in the early crushing steps shows a strong correlation with 38ArCl with very high 40ArE/38ArCl ratios. In contrast, those of the late steps mainly consist of atmospheric Ar and K-correlated radiogenic Ar with a constant 40ArR/39ArK ratio and the atmospheric initial 40Ar/36Ar ratio. As a result, all samples yield similar declining age spectra: the fore segments with anomalously old apparent ages decline quickly in the early crushing steps and the rear ones are flat with concordant apparent ages in the late crushing steps. The data points of the early steps define linear correlations in plots of 40ArNA/39ArK vs. 38ArCl/39ArK and 38ArCl/40ArNA vs. 39ArK/40ArNA (NA for non-atmospheric) and most yield ages of 240-230 Ma. On the other hand, the data of the late steps always construct well-defined isochrons in the plots of 36ArA/40ArNA vs. 39ArK/40ArNA with consistent ages of ˜300 Ma. We interpret that gases released in the early steps were from the secondary fluid inclusions (SFIs) due to their distribution characteristics along cracks leading to be easily extracted, and those released in the later steps represented the contribution of the primary fluid inclusions (PFIs). The initial 40Ar/36Ar ratios of SFIs, much higher than the modern

  5. Gestão ambiental nas empresas de capital aberto do segmento ‘Novo Mercado’: discutindo a homogeneidade e heterogeneidade de práticas à luz da teoria institucional [doi: 10.5329/RECADM.20121102003

    Directory of Open Access Journals (Sweden)

    Vivianne Pereira Salas Roldan

    2012-11-01

    Full Text Available O objetivo geral deste estudo foi analisar o comportamento das empresas de capital aberto, do segmento ‘Novo Mercado’ da BM&FBovespa, quanto à adoção de práticas de gestão ambiental, à luz da teoria institucional. Em síntese, os objetivos específicos da pesquisa analisam a tendência para a homogeneidade e heterogeneidade de práticas ambientais das empresas, sua relação com a abordagem de gestão ambiental e com as pressões ambientais evidenciadas, dando destaque especial para o setor de Construção. É uma pesquisa descritiva, bibliográfica e documental, de abordagem quantitativa. Os dados foram obtidos a partir dos websites e relatórios anuais das empresas, de 2009 e 2010. Constatou-se que 66,7% das 123 empresas do Novo Mercado adotam práticas ambientais. Quanto à abordagem de gestão ambiental, 58,5% dessas empresas são proativas, 28% reativas, e 13,4% preventivas. Verificou-se que quanto mais proativa a abordagem de gestão ambiental, mais diversificadas são as pressões ambientais, e maior é a possibilidade de existir isomorfismo entre as empresas quanto à adoção de práticas sustentáveis, assim como heterogeneidade. Na análise do setor de construção, constatou-se essas possibilidades destacadas, sendo as práticas homogêneas e heterogêneas desse campo detalhadas e discutidas no estudo.   Palavras-chave Teoria institucional, Pressões ambientais, Gestão Ambiental.     ENVIRONMENTAL MANAGEMENT OF COMPANIES OF THE SEGMENT 'NEW MARKET': DISCUSSING THE HOMOGENEITY AND HETEROGENEITY OF PRACTICES IN LIGHT OF INSTITUTIONAL THEORY   ABSTRACT The aim of this study was to analyze the behavior of companies of the segment 'New Market' BM&FBovespa, on the adoption of environmental management practices in light of institutional theory. In summary, the specific objectives of the research analyzing the trend toward homogeneity and heterogeneity of environmental practices of firms, their relationship with the approach

  6. Eestlased ARS BALTICA 08-l Austrias / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2008-01-01

    Rahvusvaheline kunstinäitus "ARS BALTICA 08" Salzburgi näitusehoones Berchtoldvilla, kuraator Peter Rieder. Osalesid kunstnikud Eestist (Mare Vint, Marje Üksine, Andres Tolts, Tiiu Kirsipuu, Jüri Hain), Lätist, Leedust ja Soomest

  7. H- Beam Stripping Loss at Background Partial Pressure of Ar

    Institute of Scientific and Technical Information of China (English)

    Hu Chundong; Wang Shaohu; Hu Liqun

    2005-01-01

    It has been observed that H- current could be improved by adding Ar to H2 plasma.But due to a slower pumping speed for Ar with the existing pumping scheme, the tank pressure will increase quickly during the length of a beam pulse. Since H- stripping loss depends on the tank pressure and gas species, part of the H- beam can be converted to H0 and then H0 can be converted into H+ with background H2 and Ar gas thickness. Therefore, the H- beam current,measured by a Faraday cup, situated at a distance L from GG (ground grid), will decrease because it will be converted into a H+ current. This gives a ratio of the Faraday cup net current to the H- beam current before stripping at background partial pressure of Ar.

  8. The emission spectra of Ar, Kr and Xe + TEA

    Science.gov (United States)

    Suzuki, Masayo; Strock, Pierre; Sauli, Fabio; Charpak, Georges

    1987-03-01

    The emission spectra of Ar, Kr and Xe + 6% TEA gas mixtures are measured by using a single wire proportional counter as the emission source. Asymmetric emission bands are observed in the range of 270 to 350 nm, which can be attributed to the radiative deexcitation of excited TEA molecules. For the practical application of optical readout of avalanche chambers, the Ar + 2.0% TEA + 20% isobutane gas mixture is also examined, and nearly the same emission band is observed.

  9. Augmented Reality Computer-Aided Drawing (AR-CAD)

    OpenAIRE

    ECT Team, Purdue

    2007-01-01

    While Virtual Reality (VR) replaces the entire real world with virtual images, Augmented Reality (AR) superimposes virtual images on the real world. Augmented Reality (a most useful form of Mixed Reality (MR)) is a popular concept for using computers to overlay virtual information onto a view of the real world. In 2000, Phillip Dunston then at the University of Washington in Seattle and his research team presented the initial concept of AR CAD developed for supporting design and construction....

  10. Amando de olhos abertos: Emma Goldman e o dissenso político nos EUA Loving with open eyes: Emma Goldman and the political dissent in the Unites States

    Directory of Open Access Journals (Sweden)

    Cecilia Azevedo

    2007-12-01

    Full Text Available Este artigo apresenta a trajetória de Emma Goldman, grande nome do anarquismo, pacifismo e feminismo nos EUA, procurando apresentá- la como uma representante da chamada tradição de dissenso neste país que, ao longo de toda sua história, tem disputado os sentidos a serem atribuídos aos ideais nacionais. Em meio à atual guerra no Iraque, a memória e o legado de Emma Goldman vêm sendo recuperados no embate político em torno do sentido do americanismo.This article presents the life of Emma Goldman, who played a central role in the history of anarchism, pacifism and feminism in the United States. In the present days, when a new war is taking place in Iraq, the memory and legacy of Emma Goldman are being reassessed amidst the debate over the political meaning of Americanism.

  11. Effect and mechanism of AR-6 in experimental rheumatoid arthritis.

    Science.gov (United States)

    Sun, Shi-xue; Li, Yun-man; Fang, Wei-rong; Cheng, Peng; Liu, Lifang; Li, Fengwen

    2010-06-01

    The root of Clematis chinensis Osbeck has been used widely in rheumatoid arthritis in Chinese traditional medicine and AR-6 is a triterpene saponin isolated from it. In this present study, we investigated in vivo effects of oral AR-6 in chronic rat adjuvant-induced arthritis (AA) and in vitro effect in macrophage and synoviocytes cells. Arthritic scores and serum inflammatory mediators were evaluated 19 days after AA induction by endermic injection of Freund's complete adjuvant in Sprague-Dawley(S-D) rats. Oral administration of AR-6 to arthritic rats resulted in a clear decrease of clinical signs compared to untreated controls. The synoviocyte and macrophage response ex vivo were then analyzed. Anti-arthritic effects of AR-6 correlated with significant decrease of NO and TNF-alpha produced by peritoneal macrophages, ex vivo and in vitro. AR-6 also significant decreased the proliferation of synoviocyte. These data indicate that AR-6 is a potential anti-inflammatory therapeutic and preventive agent. PMID:19842015

  12. 40Ar/39Ar Dating of the Brunhes-Matuyama Geomagnetic Field Reversal.

    Science.gov (United States)

    Baksi, A K; Hsu, V; McWilliams, M O; Farrar, E

    1992-04-17

    Magnetostratigraphic studies are widely used in conjunction with the geomagnetic polarity time scale (GPTS) to date events in the range 0 to 5 million years ago. A critical tie point on the GPTS is the potassium-argon age of the most recent (Brunhes-Matuyama) geomagnetic field reversal. Astronomical values for the forcing frequencies observed in the oxygen isotope record in Ocean Drilling Project site 677 suggest that the age of this last reversal is 780 ka (thousand years ago), whereas the potassium-argon-based estimate is 730 ka. Results from 4039; Ar incremental heating studies on a series of lavas from Maui that straddle the Brunhes-Matuyama reversal give an age of 783 + 11 ka, in agreement with the astronomically derived value. The astronomically based technique appears to be a viable tool for dating young sedimentary sequences. PMID:17743111

  13. Volcanic history and 40Ar/39Ar and 14C geochronology of Terceira Island, Azores, Portugal

    Science.gov (United States)

    Calvert, A.T.; Moore, R.B.; McGeehin, J.P.; Rodrigues da Silva, A.M.

    2006-01-01

    Seven new 40Ar/39Ar and 23 new radiocarbon ages of eruptive units, in support of new geologic mapping, improve the known chronology of Middle to Late Pleistocene and Holocene volcanic activity on the island of Terceira, Azores and define an east-to-west progression in stratovolcano growth. The argon ages indicate that Cinco Picos Volcano, the oldest on Terceira, completed its main subaerial cone building activity by about 370-380??ka. Collapse of the upper part of the stratovolcanic edifice to form a 7 ?? 9??km caldera occurred some time after 370??ka. Postcaldera eruptions of basalt from cinder cones on and near the caldera floor and trachytic pyroclastic flow and pumice fall deposits from younger volcanoes west of Cinco Picos have refilled much of the caldera. The southern portion of Guilherme Moniz Volcano, in the central part of the island, began erupting prior to 270??ka and produced trachyte domes, flows, and minor pyroclastic deposits until at least 111??ka. The northern part of Guilherme Moniz Caldera is less well exposed than the southern part, but reflects a similar age range. The northwest portion of the caldera was formed sometime after 44??ka. Several well-studied ignimbrites that blanket much of the island likely erupted from Guilherme Moniz Volcano. The Pico Alto Volcanic Center, a tightly spaced cluster of trachyte domes and short flows, is a younger part of Guilherme Moniz Volcano. Stratigraphic studies and our new radiocarbon ages suggest that most of the Pico Alto eruptions occurred during the period from about 9000 to 1000??years BP. Santa Barbara Volcano is the youngest stratovolcano on Terceira, began erupting prior to 29??ka, and has been active historically. ?? 2006.

  14. Chronostratigraphy of Monte Vulture volcano (southern Italy): secondary mineral microtextures and 39Ar-40Ar systematics

    Science.gov (United States)

    Villa, Igor M.; Buettner, Annett

    2009-12-01

    The eruptive history of Monte Vulture has been the subject of several geochronological investigations during the past decades, which reliably dated only a small number of eruptions. Understanding the causes of sub-optimum data yield in the past requires an interdisciplinary approach. We re-analyzed samples from previous works and present new data on samples from the main volcano-stratigraphic units of Monte Vulture, so as to provide an improved, consistent chronostratigraphic database. Imaging of minerals by cathodoluminescence and backscattered electrons reveals that heterochemical, high-temperature deuteric reaction textures are ubiquitous. Such observations are common in metamorphic rocks but had not frequently been reported from volcanic rocks. In view of the mineralogical complexity, we base our chronological interpretation on isochemical steps, defined as steps for which the Cl/K and/or the Ca/K ratios are constant. Isochemical steps carry the isotopic signature of chemically homogeneous mineral phases and therefore allow a well-constrained age interpretation. Comparison of old and new 39Ar-40Ar data proves the reproducibility of age spectra and their shapes. This quantifies the analytical reliability of the irradiation and mass-spectrometric analyses. Anomalous age spectra are a reproducible property of some specific samples and correlate with mineralogical anomalies. The present data allow us to fine-tune the age of the volcanostratigraphic units of Monte Vulture during the known interval of main volcanic activity from ca. 740 to 610 ka. After a very long stasis, the volcanic activity in the Monte Vulture area resumed with diatremic eruptions, one of which (Lago Piccolo di Monticchio, the site of a palynological-paleoclimatological drilling) was dated at ca. 140 ka.

  15. 40Ar/39Ar age evidence for Altyn fault tectonic activities in western China

    Institute of Scientific and Technical Information of China (English)

    LIU Yongjiang; J. Genser; GE Xiaohong; F. Neubauer; G. Friedl; CHANG Lihua; REN Shoumai; R. Handler

    2003-01-01

    Four 40Ar/39Ar age groups of mica, hornblende and K-feldspar were obtained from Proterozoic and early Paleozoic metamorphic rocks in the Aksay-Dangjin Pass area, western China. The samples away from the middle shear zone of the Altyn fault belt yield two plateau age groups in the range of 461-445.2 Ma and 414.9-342.8 Ma, respectively. They represent the tectono-thermal events that had been recorded in the rocks that were displaced by the Altyn strike-slip fault in late Ordovician-early Silurian and Devonian, respectively. These two age groups should be related to the closures of Northern and Southern Qilian Oceans. The deformed granitic gneiss from the northern belt gives a plateau age group of 178.4-137.5 Ma, which is interpreted as the active age of the Altyn fault in the middle-late Jurassic- early Cretaceous and should be related to the accretion of Lhasa block to the north. The sample from the middle shear zone of the Altyn fault belt yields two plateau ages of 36.4 and 26.3 Ma, respectively, suggesting the strike-slip movement with strong metamorphism at greenschist facies along the Altyn fault in the late Eocene. This event occurred in the most areas of the northern Tibet Plateau and should be in response in the north to the collision between Indian and Eurasian continents. The present study demonstrates that the Altyn fault is characterized by multiple pulse-style activities under the tectonic setting of convergence between the Indian and Eurasian continents.

  16. Combined U-Th/He and 40Ar/39Ar geochronology of post-shield lavas from the Mauna Kea and Kohala volcanoes, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Aciego, S.M.; Jourdan, F.; DePaolo, D.J.; Kennedy, B.M.; Renne, P.R.; Sims, K.W.W.

    2009-10-01

    Late Quaternary, post-shield lavas from the Mauna Kea and Kohala volcanoes on the Big Island of Hawaii have been dated using the {sup 40}Ar/{sup 39}Ar and U-Th/He methods. The objective of the study is to compare the recently demonstrated U-Th/He age method, which uses basaltic olivine phenocrysts, with {sup 40}Ar/{sup 39}Ar ages measured on groundmass from the same samples. As a corollary, the age data also increase the precision of the chronology of volcanism on the Big Island. For the U-Th/He ages, U, Th and He concentrations and isotopes were measured to account for U-series disequilibrium and initial He. Single analyses U-Th/He ages for Hamakua lavas from Mauna Kea are 87 {+-} 40 ka to 119 {+-} 23 ka (2{sigma} uncertainties), which are in general equal to or younger than {sup 40}Ar/{sup 39}Ar ages. Basalt from the Polulu sequence on Kohala gives a U-Th/He age of 354 {+-} 54 ka and a {sup 40}Ar/{sup 39}Ar age of 450 {+-} 40 ka. All of the U-Th/He ages, and all but one spurious {sup 40}Ar/{sup 39}Ar ages conform to the previously proposed stratigraphy and published {sup 14}C and K-Ar ages. The ages also compare favorably to U-Th whole rock-olivine ages calculated from {sup 238}U - {sup 230}Th disequilibria. The U-Th/He and {sup 40}Ar/{sup 39}Ar results agree best where there is a relatively large amount of radiogenic {sup 40}Ar (>10%), and where the {sup 40}Ar/{sup 36}Ar intercept calculated from the Ar isochron diagram is close to the atmospheric value. In two cases, it is not clear why U-Th/He and {sup 40}Ar/{sup 39}Ar ages do not agree within uncertainty. U-Th/He and {sup 40}Ar/{sup 39}Ar results diverge the most on a low-K transitional tholeiitic basalt with abundant olivine. For the most alkalic basalts with negligible olivine phenocrysts, U-Th/He ages were unattainable while {sup 40}Ar/{sup 39}Ar results provide good precision even on ages as low as 19 {+-} 4 ka. Hence, the strengths and weaknesses of the U-Th/He and {sup 40}Ar/{sup 39}Ar methods are

  17. Transpressional tectonics and Carboniferous magmatism in the Limousin, Massif Central, France:structural and 40Ar/39Ar investigations.

    OpenAIRE

    Gébelin, Aude; Brunel, Maurice; Monié, Patrick; Faure, Michel; Arnaud, Nicolas

    2007-01-01

    New structural, microstructural, and 40Ar/39Ar data from the NW Massif Central (France) provide additional constraints on the timing and tectonic setting of late Variscan granite magmatism. Previous studies had emphasized the role of late orogenic extension in the emplacement of granite plutons in the Limousin region. In contrast, the new data set is consistent with syntectonic emplacement of magma in a dextral simple shear active from 350 to 300 Ma in a transpressional regime. As an alternat...

  18. Detailed Ar-40/Ar-39 dating of geologic events associated with the Mantos Blancos copper deposit, northern Chile

    OpenAIRE

    Oliveros, V.; Feraud, G.; L. Aguirre; Ramirez, L.; Fornari, Michel; Palacios, C.; Parada, M.

    2008-01-01

    The Ar-40/Ar-39 geochronological method was applied to date magmatic and hydrothermal alteration events in the Mantos Blancos mining district in the Coastal Cordillera of northern Chile, allowing the distinction of two separate mineralization events. The Late Jurassic Mantos Blancos orebody, hosted in Jurassic volcanic rocks, is a magmatic-hydrothermal breccia-style Cu deposit. Two superimposed mineralization events have been recently proposed. The first event is accompanied by a phyllic hydr...

  19. A Late Mesoproterozoic 40Ar/39Ar age for a melt breccia from the Keurusselkä impact structure, Finland

    Science.gov (United States)

    Schmieder, Martin; Jourdan, Fred; Moilanen, Jarmo; Buchner, Elmar; Öhman, Teemu

    2016-02-01

    Field investigations in the eroded central uplift of the ≤30 km Keurusselkä impact structure, Finland, revealed a thin, dark melt vein that intersects the autochthonous shatter cone-bearing target rocks near the homestead of Kirkkoranta, close to the center of the impact structure. The petrographic analysis of quartz in this melt breccia and the wall rock granite indicate weak shock metamorphic overprint not exceeding ~8-10 GPa. The mode of occurrence and composition of the melt breccia suggest its formation as some kind of pseudotachylitic breccia. 40Ar/39Ar dating of dark and clast-poor whole-rock chips yielded five concordant Late Mesoproterozoic miniplateau ages and one plateau age of 1151 ± 10 Ma [± 11 Ma] (2σ; MSWD = 0.11; P = 0.98), considered here as the statistically most robust age for the rock. The new 40Ar/39Ar age is incompatible with ~1.88 Ga Svecofennian tectonism and magmatism in south-central Finland and probably reflects the Keurusselkä impact, followed by impact-induced hydrothermal chloritization of the crater basement. In keeping with the crosscutting relationships in the outcrop and the possible influence of postimpact alteration, the Late Mesoproterozoic 40Ar/39Ar age of ~1150 Ma should be treated as a minimum age for the impact. The new 40Ar/39Ar results are consistent with paleomagnetic results that suggested a similar age for Keurusselkä, which is shown to be one of the oldest impact structures currently known in Europe and worldwide.

  20. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation, Giravali Ghat, Deccan Traps

    Indian Academy of Sciences (India)

    Kanchan Pande; S K Pattanayak; K V Subbarao; P Navaneethakrishnan; T R Venkatesan

    2004-12-01

    We report here a 40Ar-39Ar age of 66.0 ± 0.9Ma (2 ) for a reversely magnetised tholeiitic lava flow from the Bhimashankar Formation (Fm.), Giravali Ghat, western Deccan province, India. This age is consistent with the view that the 1.8–2km thick bottom part of the exposed basalt flow sequence in the Western Ghats was extruded very close to 67.4 Ma.

  1. Exhumation history of the NW Indian Himalaya revealed by fission track and 40Ar/39Ar ages

    Science.gov (United States)

    Schlup, Micha; Steck, Albrecht; Carter, Andrew; Cosca, Michael; Epard, Jean-Luc; Hunziker, Johannes

    2011-01-01

    New fission track and Ar/Ar geochronological data provide time constraints on the exhumation history of the Himalayan nappes in the Mandi (Beas valley) — Tso Morari transect of the NW Indian Himalaya. Results from this and previous studies suggest that the SW-directed North Himalayan nappes were emplaced by detachment from the underthrusted upper Indian crust by 55 Ma and metamorphosed by ca. 48–40 Ma. The nappe stack was subsequently exhumed to shallow upper crustal depths (

  2. Acesso ao cuidado à saúde da criança em serviços de atenção primária

    Directory of Open Access Journals (Sweden)

    Rosane Meire Munhak da Silva

    2014-10-01

    Full Text Available Realizou-se uma pesquisa de abordagem qualitativa com base no referencial metodológico da hermenêutica dialética, com o objetivo de identificar o atributo acesso da atenção primária para a resolução dos problemas de saúde de crianças menores de um ano a partir dos relatos de pais e cuidadores. Envolveram-se 16 cuidadores de crianças atendidas em unidades de pronto atendimento de Cascavel-PR, em 2010. Foram reconhecidas quatro categorias temáticas: Aconselhamento familiar ao buscar atenção à saúde da criança; Ausência de acolhimento ao primeiro contato; Presença de classificação de risco para atenção à saúde da criança; Barreiras que impedem o acesso à atenção à saúde. Concluiu-se que as famílias exibiram dificuldades para alcançar resolutividade aos problemas de saúde dos filhos, mediante a falta de acesso aos serviços de atenção primária.

  3. Dicty_cDB: FC-AR20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR20 (Link to dictyBase) - G03232 DDB0186972 Contig-U15983-1 FC-AR...20P (Link to Original site) FC-AR20F 321 FC-AR20Z 550 FC-AR20P 871 - - Show FC-AR20 Library FC (Link to librar....0 %: cytoplasmic 24.0 %: nuclear 8.0 %: vesicles of secretory system 4.0 %: cytoskeletal 4.0 %: mitochondri...ontig Contig-U15983-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...20Q.Seq.d/ Representative seq. ID FC-AR20P (Link to Original site) Representative DNA sequence >FC-AR20 (FC-AR

  4. The mass of sup 3 sup 2 Ar and sup 3 sup 3 Ar for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides sup 3 sup 2 Ar (T sub 1 sub / sub 2 = 98 ms) sup 3 sup 3 Ar (T sub 1 sub / sub 2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10 sup - sup 8 (delta m = 1.8 keV) and 1.4 x 10 sup - sup 8 (delta m = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of sup 3 sup 2 Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for sup 4 sup 4 Ar and sup 4 sup 5 Ar, and a 20 sigma deviation for sup 4 sup 4 Ar from the literature value was found and interpreted.

  5. 40Ar/39Ar dating of alkaline and tholeiitic magmatism of Saudi Arabia related to the early Red Sea Rifting

    International Nuclear Information System (INIS)

    40Ar/39Ar plateau-ages at 27-28 Ma obtained on feeder dykes and one lava flow of the alkaline massif of Harrat Hadan are in agreement with the assumed age partly deduced from the conventional K/Ar data of the early activity of other alkaline volcanic massifs from Saudi Arabia. This magmatic activity is spatially distributed over a large area, along the western edge of the Arabian plate, and their N-S to NW-SE volcano-tectonic directions are similar to those of the future Red Sea Rift. Preliminary results obtained on tholeiitic lava flows, dykes and plutons gave 17 plateau-ages which, combined with 6 ages deduced from more disturbed age-spectra, display a main histogram peak from 24 to 21 Ma, much narrower than that obtained with conventional K/Ar ages on the same formations. Therefore, a strong tholeiitic activity affected a narrow linear area following the actual eastern Red Sea coast, over nearly 1700 km, during a brief period of time, and without showing any apparent migration. The main volcano-tectonic features of the future Red Sea are strongly outlined during this event. Such brief magmatic episodes related to continental rifts have also been documented by precise 40Ar/39Ar analyses on the British Tertiary Igneous Province, the Deccan traps and the eastern Central Atlantic. (orig.)

  6. Evaluation of the Immunity Activity of Glycyrrhizin in AR Mice

    Directory of Open Access Journals (Sweden)

    Ai-Guo Zhou

    2012-01-01

    Full Text Available In this study, we evaluated effect of glycyrrhizin on immunity function in allergic rhinitis (AR mice. The AR mice model were induced by dripping ovalbumin in physiological saline (2 mg mL−1, 10 μL into the bilateral nasal cavities using a micropipette. After the AR model was induced, mice were randomly divided into six groups: the normal control, model, lycopene 20 mg kg−1 (as positive control drug group, and glycyrrhizin 10, 20, 30 mg kg−1 groups. After the sensitization day 14, lycopene (20 mg/kg BW and glycyrrhizin (10, 20 and 30 mg/kg BW were given orally for 20 days once a day. Mice in the normal control and model groups were given saline orally once a day for 20 days. Results showed that glycyrrhizin treatment could dose-dependently significantly reduce blood immunoglobulin E (IgE, interleukin-4 (IL-4, interleukin-5 (IL-5, interleukin-6 (IL-6, nitrous oxide (NO, tumor necrosis factor-alpha (TNF-α levels and nitrous oxide synthase (NOS activity and enhance blood immunoglobulin A (IgA, immunoglobulin G (IgG, immunoglobulin M (IgM, interleukin-2 (IL-2 and interleukin-12 (IL-12 levels in AR mice. Furthermore, glycyrrhizin treatment could dose-dependently significantly enhance acetylcholinesterase (AchE activity and reduce substance P (SP level in peripheral blood and nasal mucosa of AR mice. We conclude that glycyrrhizin can improve immunity function in AR mice, suggesting a potential drug for the prevention and therapy of AR.

  7. Optical Emission Spectroscopic Studies of ICP Ar Plasma

    Institute of Scientific and Technical Information of China (English)

    QI Xuelian; REN Chunsheng; ZHANG Jian; MA Tengcai

    2007-01-01

    The ion line of 434.8 nm and atom line of 419.8 nm of Ar plasma produced by an inductively coupled plasma (ICP) were measured by optical emission spectroscopy and the influences from the working gas pressure, radio-frequency (RF) power and different positions in the discharge chamber on the line intensities were investigated in this study. It was found that the intensity of Ar atom line increased firstly and then saturated with the increase of the pressure. The line intensity of Ar+, on the other hand, reached a maximum value and then decreased along with the pressure. The intensity of the line in an RF discharge also demonstrated a jumping mode and a hysteresis phenomenon with the RF power. When the RF power increased to 400 W, the discharge jumped from the E-mode to the H-mode where the line intensity of Ar atom demonstrated a sudden increase, while the intensity of Ar+ ion only changed slightly. If the RF power decreased from a high value, e.g., 1000 W, the discharge would jump from the H-mode back to the E-mode at a power of 300 W. At this time the intensities of Ar and Ar+ lines would also decrease sharply. It was also noticed in this paper that the intensity of the ion line depended on the detective location in the chamber, namely at the bottom of the chamber the line was more intense than that in the middle of the chamber, but less intense than at the top, which is considered to be related to the capacitance coupling ability of the ICP plasma in different discharge areas.

  8. Acoustic Resonance Spectroscopy (ARS) Munition Classification System enhancements. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Vela, O.A.; Huggard, J.C.

    1997-09-18

    Acoustic Resonance Spectroscopy (ARS) is a non-destructive evaluation technology developed at the Los Alamos National Laboratory (LANL). This technology has resulted in three generations of instrumentation, funded by the Defense Special Weapons Agency (DSWA), specifically designed for field identification of chemical weapon (CW) munitions. Each generation of ARS instrumentation was developed with a specific user in mind. The ARS1OO was built for use by the U.N. Inspection Teams going into Iraq immediately after the Persian Gulf War. The ARS200 was built for use in the US-Russia Bilateral Chemical Weapons Treaty (the primary users for this system are the US Onsite Inspection Agency (OSIA) and their Russian counterparts). The ARS300 was built with the requirements of the Organization for the Prohibition of Chemical Weapons (OPCW) in mind. Each successive system is an improved version of the previous system based on learning the weaknesses of each and, coincidentally, on the fact that more time was available to do a requirements analysis and the necessary engineering development. The ARS300 is at a level of development that warrants transferring the technology to a commercial vendor. Since LANL will supply the computer software to the selected vendor, it is possible for LANL to continue to improve the decision algorithms, add features where necessary, and adjust the user interface before the final transfer occurs. This paper describes the current system, ARS system enhancements, and software enhancements. Appendices contain the Operations Manual (software Version 3.01), and two earlier reports on enhancements.

  9. Características produtivas, agronômicas e nutricionais do capim-tanzânia em cinco diferentes idades ao corte Productivity, agronomical and nutritional traits of Tanzânia grass cut on five different ages

    OpenAIRE

    G.H.F. Castro; N.M. Rodriguez; L.C. Gonçalves; R.M. Maurício

    2010-01-01

    Avaliou-se o capim-tanzânia (Panicum maximum cv Tanzânia) cortado aos 42, 63, 84, 107 e 126 dias quanto à produtividade, às características agronômicas, à composição bromatológica e à digestibilidade in vitro. Observou-se aumento na altura da planta do capim-tanzânia até os 84 dias, com aumento da produção de massa verde de forragem e aumento na produção de matéria seca com o avançar da idade ao corte. O aumento da idade ao corte resultou em diminuição do percentual de folhas e em aumento no ...

  10. Second generation Robo-AO instruments and systems

    CERN Document Server

    Baranec, Christoph; Law, Nicholas M; Chun, Mark R; Lu, Jessica R; Connelley, Michael S; Hall, Donald; Atkinson, Dani; Jacobson, Shane

    2014-01-01

    The prototype Robo-AO system at the Palomar Observatory 1.5-m telescope is the world's first fully automated laser adaptive optics instrument. Scientific operations commenced in June 2012 and more than 12,000 observations have since been performed at the ~0.12" visible-light diffraction limit. Two new infrared cameras providing high-speed tip-tilt sensing and a 2' field-of-view will be integrated in 2014. In addition to a Robo-AO clone for the 2-m IGO and the natural guide star variant KAPAO at the 1-m Table Mountain telescope, a second generation of facility-class Robo-AO systems are in development for the 2.2-m University of Hawai'i and 3-m IRTF telescopes which will provide higher Strehl ratios, sharper imaging, ~0.07", and correction to {\\lambda} = 400 nm.

  11. LGS AO Science Impact: Present and Future Perspectives

    OpenAIRE

    Liu, Michael C.

    2008-01-01

    The recent advent of laser guide star adaptive optics (LGS AO) on the largest ground-based telescopes has enabled a wide range of high angular resolution science, previously infeasible from ground-based and/or space-based observatories. As a result, scientific productivity with LGS has seen enormous growth in the last few years, with a factor of ~10 leap in publication rate compared to the first decade of operation. Of the 54 refereed science papers to date from LGS AO, half have been publish...

  12. All About Portugal - Website dedicado ao turismo externo em Portugal

    OpenAIRE

    Martins, Rui Manuel da Silva

    2015-01-01

    Grande parte do tráfego online tem origem em páginas de resultados de motores de de pesquisa. Estes constituem hoje uma ferramenta fundamental de que os turistas se socorrem para pesquisar e filtrar a informação necessária ao planeamento das suas viagens, sendo, por isso, bastante tidos em conta pelas entidades ligadas ao turismo no momento da definição das suas estratégias de marketing. No presente documento é descrita a investigação feita em torno do modo de funcionamento ...

  13. Modelling Ar II spectral emission from the ASTRAL helicon plasma

    Science.gov (United States)

    Munoz Burgos, Jorge; Boivin, Robert; Loch, Stuart; Kamar, Ola; Ballance, Connor; Pindzola, Mitch

    2008-11-01

    We describe our spectral modeling of ArII emission from the ASTRAL helicon plasma at Auburn University. Collisional-radiative theory is used to model the emitted spectrum, with account being taken for the density and temperature variation along the line of sight. This study has two main aims. Firstly to test the atomic data used in the model and secondly to identify spectral line ratios in the 200 nm - 1000 nm range that could be used as temperature diagnostics. Using the temperature at which Ar II emission starts to be seen we have been able to test recent ionization and recombination data. Using selected spectral lines we were then able to test the importance of the continuum-coupling effects included in the most recent Ar+ electron impact excitation data. Selected spectral line ratios have been identified that show a strong temperature variation and have potential as a temperature diagnostic.

  14. Factor Structure of CIWA-Ar in Alcohol Withdrawal.

    Science.gov (United States)

    Bakhla, Ajay Kumar; Khess, Christoday R J; Verma, Vijay; Hembram, Mahesh; Praharaj, Samir Kumar; Soren, Subhas

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance), and the third had two items (10.04% variance). Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors. PMID:24826372

  15. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    Directory of Open Access Journals (Sweden)

    Ajay Kumar Bakhla

    2014-01-01

    Full Text Available Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance, second factor also had four items (24.25% variance, and the third had two items (10.04% variance. Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors.

  16. 40Ar-39Ar age of the Shergotty achondrite and implications for its post-shock thermal history

    International Nuclear Information System (INIS)

    Analyses of 40Ar-39Ar have been made on a whole rock sample and a maskelynite (feldspar) separate of the shocked Shergotty achondrite. The maskelynite gave a plateau age of 254 +- 10 Myr. The whole rock sample gave a complex release with apparent ages between 240 and 640 Myr. The slightly younger Rb-Sr isochron age of 165 Myr for Shergotty suggests that the maskelynite as well as the whole rock was incompletely degassed. Reasonable Ar diffusion characteristics for Shergotty for shock heating temperatures of 0C indicate D/a2 of 10-11 to 10-13sec-1. The time required to lose 95% of the 40Ar from the plagioclase would be approximately 103 to 104 yr. When this gas diffusion time is introduced into a thermal model of a cooling ejecta blanket of variable thickness, a post-shock cooling time of >= 103 yr and a burial depth of >= 300 m are indicated for Shergotty. These conclusions are not seriously affected by uncertainties in the thermal model. Most likely the shock event occurred approximately 165 Myr ago, but no earlier than 250 Myr ago, when the Shergotty parent object experienced a collision in the asteroid belt. As a result of that collision, feldspar was converted to maskelynite, the K-Ar and Rb-Sr ages were completely or nearly completely reset, and the Shergotty meteorite was heated to 0C and left to cool slowly inside the parent body. (author)

  17. 40Ar/39Ar laser probe evidence concerning the age and associated hazards of the Lake Nyos Maar, Cameroon

    Science.gov (United States)

    Dalrymple, G.B.; Lockwood, J.P.

    1990-01-01

    The waters of Lake Nyos are impounded by a fragile natural dam composed of pyroclastic rocks ejected during the formation of the lake crater (maar). Lateral erosion of this dam has reduced its width from over 500 m to only 45 m. Published whole-rock K-Ar ages of about 100 ka on juvenile basalt from the dam suggests that erosion has been slow and that the dam poses no imminent threat. New apparent 40Ar/39Ar ages of 1.4 to 232 Ma on xenocrystic K-feldspar contained in the basalt show that the xenocrysts, whose source is the 528-Ma crystalline basement, are carriers of inherited radiogenic 40Ar and would cause the whole-rock K-Ar ages to be too old. The best estimate for the age of the maar is provided by a 14C age of 400 ?? 100 yr BP on charcoal from the base of the dam. This young age indicates that the dam is eroding at a relatively rapid rate; its failure, perhaps within a few decades, would result in a major flood and imperil thousands of people living downstream in Cameroon and eastern Nigeria. ?? 1990 Kluwer Academic Publishers.

  18. Etching characteristics and mechanisms of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas

    Science.gov (United States)

    Lim, Nomin; Efremov, Alexander; Yeom, Geun Young; Choi, Bok-Gil; Kwon, Kwang-Ho

    2014-11-01

    The etching characteristics and mechanism of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas under the same operating conditions (pressure, 6 mTorr; input power, 700 W; bias power, 200 W) were investigated. For both gas mixtures, an increase in the Ar fraction or gas pressure at a fixed gas mixing ratio was found to cause a non-monotonic change in the Mo etching rates. The X-ray photoelectron spectroscopy (XPS) diagnostics indicated contamination of the etched surfaces by reaction products. The Cl2/Ar and CF4/Ar plasma parameters were also investigated using a combination of a zero-dimensional plasma model and plasma diagnostics using Langmuir probes. An analysis of the etching kinetics with the model-predicted fluxes of the plasma active species suggests that: 1) the Mo etching process occurs in the transitional regime of the ion-assisted chemical reaction, and 2) the non-monotonic Mo etching rate is probably associated with opposing changes in the fluxes of the reactive neutral species and ion energy.

  19. Earth-atmosphere evolution based on new determination of Devonian atmosphere Ar isotopic composition

    Science.gov (United States)

    Stuart, Finlay M.; Mark, Darren F.; Gandanger, Pierre; McConville, Paul

    2016-07-01

    The isotopic composition of the noble gases, in particular Ar, in samples of ancient atmosphere trapped in rocks and minerals provides the strongest constraints on the timing and rate of Earth atmosphere formation by degassing of the Earth's interior. We have re-measured the isotopic composition of argon in the Rhynie chert from northeast Scotland using a high precision mass spectrometer in an effort to provide constraints on the composition of Devonian atmosphere. Irradiated chert samples yield 40Ar/36Ar ratios that are often below the modern atmosphere value. The data define a 40Ar/36Ar value of 289.5 ± 0.4 at K/36Ar = 0. Similarly low 40Ar/36Ar are measured in un-irradiated chert samples. The simplest explanation for the low 40Ar/36Ar is the preservation of Devonian atmosphere-derived Ar in the chert, with the intercept value in 40Ar-39Ar-36Ar space representing an upper limit. In this case the Earth's atmosphere has accumulated only 3% (5.1 ± 0.4 ×1016 mol) of the total 40Ar inventory since the Devonian. The average accumulation rate of 1.27 ± 0.09 ×108 mol40Ar/yr overlaps the rate over the last 800 kyr. This implies that there has been no resolvable temporal change in the outgassing rate of the Earth since the mid-Palaeozoic despite the likely episodicity of Ar degassing from the continental crust. Incorporating the new Devonian atmosphere 40Ar/36Ar into the Earth degassing model of Pujol et al. (2013) provides the most precise constraints on atmosphere formation so far. The atmosphere formed in the first ∼100 Ma after initial accretion during a catastrophic degassing episode. A significant volume of 40Ar did not start to accumulate in the atmosphere until after 4 Ga which implies that stable K-rich continental crust did not develop until this time.

  20. A DNA polymerase mutation that suppresses the segregation bias of an ARS plasmid in Saccharomyces cerevisiae.

    OpenAIRE

    Houtteman, S W; Elder, R T

    1993-01-01

    Yeast autonomously replicating sequence (ARS) plasmids exhibit an unusual segregation pattern during mitosis. While the nucleus divides equally into mother and daughter cells, all copies of the ARS plasmid will often remain in the mother cell. A screen was designed to isolate mutations that suppress this segregation bias. A plasmid with a weak ARS (wARS) that displayed an extremely high segregation bias was constructed. When cells were grown under selection for the wARS plasmid, the resulting...

  1. Efeito dos incêndios florestais na qualidade do ar

    OpenAIRE

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  2. Interatomic scattering in energy dependent photoelectron spectra of Ar clusters

    Energy Technology Data Exchange (ETDEWEB)

    Patanen, M.; Benkoula, S.; Nicolas, C.; Goel, A. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Antonsson, E. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Physikalische und Theoretische Chemie Institut für Chemie und Biochemie, Fachbereich Biologie, Chemie, Pharmazie, Freie Universität Berlin, Takustrasse 3, 14195 Berlin (Germany); Neville, J. J. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Department of Chemistry, University of New Brunswick, Fredericton, New Brunswick E3B 6E2 (Canada); Miron, C., E-mail: Catalin.Miron@synchrotron-soleil.fr [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Extreme Light Infrastructure - Nuclear Physics (ELI-NP), ‘Horia Hulubei’ National Institute for Physics and Nuclear Engineering, 30 Reactorului Street, RO-077125 Măgurele, Jud. Ilfov (Romania)

    2015-09-28

    Soft X-ray photoelectron spectra of Ar 2p levels of atomic argon and argon clusters are recorded over an extended range of photon energies. The Ar 2p intensity ratios between atomic argon and clusters’ surface and bulk components reveal oscillations similar to photoelectron extended X-ray absorption fine structure signal (PEXAFS). We demonstrate here that this technique allows us to analyze separately the PEXAFS signals from surface and bulk sites of free-standing, neutral clusters, revealing a bond contraction at the surface.

  3. Web authentic and similar texts detection using AR digital signature

    OpenAIRE

    Πούλος, Μάριος; Σκιαδόπουλος, Σπύρος; Μπώκος, Γιώργος Δ.

    2010-01-01

    In this paper, we propose a new identification technique based on an AR model with a complexity of size O(n) times in web form, with the aim of creating a unique serial number for texts and to detect authentic or similar texts. For the implementation of this purpose, we used an Autoregressive Model (AR) 15 th order, and for the identification procedure, we employed the cross-correlation algorithm. Empirical investigation showed that the proposed method may be used as an accurate method for id...

  4. Development of a low-level Ar-37 calibration standard

    CERN Document Server

    Williams, R M; Bowyer, T W; Day, A R; Fuller, E S; Haas, D A; Hayes, J C; Hoppe, E W; Humble, P H; Keillor, M E; LaFerriere, B D; Mace, E K; McIntyre, J I; Miley, H S; Myers, A W; Orrell, J L; Overman, C T; Panisko, M E; Seifert, A

    2016-01-01

    Argon-37 is an environmental signature of an underground nuclear explosion. Producing and quantifying low-level Ar-37 standards is an important step in the development of sensitive field measurement instruments. This paper describes progress at Pacific Northwest National Laboratory in developing a process to generate and quantify low-level Ar-37 standards, which can be used to calibrate sensitive field systems at activities consistent with soil background levels. This paper presents a discussion of the measurement analysis, along with assumptions and uncertainty estimates.

  5. Multiphoton Double Ionization of Ar and Ne Close to Threshold

    International Nuclear Information System (INIS)

    In kinematically complete studies we explore double ionization (DI) of Ne and Ar in the threshold regime (I>3x1013 W/cm2) for 800 nm, 45 fs pulses. The basic differences are found in the two-electron momentum distributions - 'correlation' (CO) for Ne and 'anticorrelation' (ACO) for Ar - that can be partially explained theoretically within a 3D classical model including tunneling. Transverse electron momentum spectra provide insight into 'Coulomb focusing' and point to correlated nonclassical dynamics. Finally, DI threshold intensities, CO as well as ACO regimes are predicted for both targets.

  6. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    OpenAIRE

    Ajay Kumar Bakhla; Khess, Christoday R.J.; Vijay Verma; Mahesh Hembram; Samir Kumar Praharaj; Subhas Soren

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance...

  7. Medidas da umidade relativa do ar em um ambiente fechado

    OpenAIRE

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  8. Axenfeld-Rieger syndrome (ARS): A review and case report.

    LENUS (Irish Health Repository)

    Waldron, Jennie M

    2011-08-29

    Axenfeld-Rieger syndrome (ARS) is a rare, autosomal dominant condition characterized by ocular, craniofacial, dental, and periumbilical abnormalities. Relatively little information exists on this syndrome within the dental literature despite the fact that midface hypoplasia and maxillary hypodontia are classical presenting features of this syndrome. This is a case report of a 7-year-old Caucasian female with ARS who presented with significant ocular and dental anomalies. She was also found to have osteopenia. Her dental condition is described, her immediate treatment is shown, and her long-term treatment needs are discussed.

  9. Tolerância de porta-enxertos de videira ao alumínio do solo

    Directory of Open Access Journals (Sweden)

    José Carlos Fráguas

    1999-07-01

    Full Text Available Onze porta-enxertos e duas cultivares americanas de videira (Vitis spp foram avaliadas mediante níveis de saturação por Al no solo (Cambissolo Húmico álico, objetivando alcançar a tolerância diferenciada ao Al. O trabalho foi conduzido em casa de vegetação, com seis tratamentos completamente casualizados e quatro repetições, na Embrapa-Centro Nacional de Pesquisa de Uva e Vinho, em Bento Gonçalves, RS, no período de 1987 a 1990. As características avaliadas foram: altura das plantas, comprimento das raízes, peso da matéria seca da parte aérea e das raízes e teores de P, K, Ca e Mg em folhas e raízes. Diante dos acréscimos ou aumentos verificados em cada característica (variação % e por cultivar, foi possível estabelecer a tolerância diferenciada das cultivares. O teor de K na parte aérea não foi afetado pelos níveis de saturação por Al, enquanto os teores de Ca e Mg foram os mais afetados. O teor de P teve um comportamento estável entre os níveis de saturação por Al. As cultivares Isabel e Cunningham apresentaram diferença na tolerância ao Al do solo; a Cunningham teve melhor comportamento. Os porta-enxertos R99, Rupestris du Lot e Kober 5BB, juntamente com Isabel, foram os mais sensíveis ao Al, e P1103, 101-14 e 196-17Cl foram os mais tolerantes.

  10. Resposta ao estresse: II. Resiliência e vulnerabilidade

    Directory of Open Access Journals (Sweden)

    Nicole Leite Galvão-Coelho

    2015-06-01

    Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.

  11. Adesão ao tratamento da ambliopia

    Directory of Open Access Journals (Sweden)

    Arakaki Mara Regina

    2004-01-01

    Full Text Available OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de 4 a 7 anos e que aderiram ao tratamento; as crianças que aderiram ao tratamento necessitaram de tempo menor de permanência em tratamento. Mesmo crianças com idade superior a 7 anos tiveram resultados positivos com a oclusão. CONCLUSÃO:O tratamento oclusivo é um meio terapêutico eficiente desde que haja a cooperação do paciente.

  12. On some Polychaetous Annelids from Curaçao

    NARCIS (Netherlands)

    Horst, R.

    1922-01-01

    Though we know already a rather large number of Polychaetous Annelids from the Caribbean Sea, hitherto, as far as I know, no Annelids have been described from the coast of the island Curaçao and I therefore was very glad, that my colleague Dr. VAN DER HORST kindly placed in my hands for identificati

  13. Thermal plasma properties for Ar-Al, Ar-Fe and Ar-Cu mixtures used in welding plasmas processes: I. Net emission coefficients at atmospheric pressure

    Science.gov (United States)

    Cressault, Y.; Gleizes, A.

    2013-10-01

    This article is devoted to the calculation of the net emission coefficient (NEC) of Ar-Al, Ar-Fe and Ar-Cu mixtures at atmospheric pressure for arc welding processes. The results are given in data tables for temperatures between 3 kK and 30 kK, for five plasma thicknesses (0, 0.5, 1, 2, 5 mm) and ten concentrations of metallic vapours (pure gas, 0.01%, 0.1%, 1%, 5%, 10%, 25%, 50%, 75% and pure metal vapours in mass proportions). The results are in good agreement with most of the works published on the subject for such mixtures. They highlight the influence of three parameters on the radiation of the plasma: the NEC is directly related to temperature and inversely related to plasma radius and is highly sensitive to the presence of metal vapours. Finally, numerical data are supplied in tables in order to develop accurate computational modelling of welding arc and to estimate both qualitatively and quantitatively the influence of each metallic vapour on the size and on the shape of the weld pool.

  14. CARACTERIZAÇÃO SUMÁRIA DAS OPERAÇÕES DE "PESQUE-PAGUE" AO NOROESTE DO ESTADO DE SÃO PAULO

    Directory of Open Access Journals (Sweden)

    Luiz de Carvalho Landell Filho

    2001-01-01

    Full Text Available This study had as basic motivation the characterization of the sport fishing operations in the northwestern region of São Paulo State, including the municipality of Pereira Barreto, Palmeira D' Oeste, Jales, Dolcinópolis and Fernandopolis. Visits were made to nine lakes of sport fishing. An open type questionnaire was applied at each visit, of a general characterization of the establishment. Some of the questions concerned the topics: agrarian land property, environment, and clients profile, among others. The establishment characterization that hold sport fishing operations present two basicformats: a those that utilize "fee fishing" as an alternative income to the agriculture business, and b those with their main income originating from the "fee fishing" operations. The land property condition of the establishments and the fishing lakes are composed mostly by private property, with a typically familiar administration. The fishing operations studied were mostly associated with agriculture activities and, in a second extent, with recreation and tourism. The fisherman client is characterized by a constant public, that moves around very close. In general, the topics related to theenvironment in the establishment are not so internalized by the fishing operators yet. = Este estudo teve como motivação básica caracterizar as operações de pesca esportiva na região noroeste do Estado de São Paulo, abarcando os municípios de Pereira Barreto, Palmeira D’ Oeste, Jales, Dolcinópolis e Fernandópolis. Foram realizadas visitas a nove lagos de pesca esportiva. Na visita foi aplicado um inquérito do tipo aberto, de caracterização geral da propriedade. Algumas das questões versavam sobre: condição fundiária, ocupação principal do operador de pesca esportiva, preocupação com a questão ambiental, perfil do público usuário, entre outras. A caracterização das propriedades que abrigam empreendimentos de pesca esportiva apresentam dois

  15. Characterization of the ars Gene Cluster from Extremely Arsenic-Resistant Microbacterium sp. Strain A33▿ †

    Science.gov (United States)

    Achour-Rokbani, Asma; Cordi, Audrey; Poupin, Pascal; Bauda, Pascale; Billard, Patrick

    2010-01-01

    The arsenic resistance gene cluster of Microbacterium sp. A33 contains a novel pair of genes (arsTX) encoding a thioredoxin system that are cotranscribed with an unusual arsRC2 fusion gene, ACR3, and arsC1 in an operon divergent from arsC3. The whole ars gene cluster is required to complement an Escherichia coli ars mutant. ArsRC2 negatively regulates the expression of the pentacistronic operon. ArsC1 and ArsC3 are related to thioredoxin-dependent arsenate reductases; however, ArsC3 lacks the two distal catalytic cysteine residues of this class of enzymes. PMID:19966021

  16. AR-40 AR-39 Age of an Impact-Melt Lithology in DHOFAR 961

    Science.gov (United States)

    Frasl, B.; Cohen, B. A.; Li, Z.-H.; Jolliff, B.; Korotev, R.; Zeigler, R.

    2016-01-01

    , although they note that further age dating of all the stones is required to test this hypothesis. We received a split of Dhofar 961 from R. Zeigler consisting of a large clast of IM Lithology B, with some light-colored, friable matrix clinging to the external margins of the impact-melt clast. This lithology was not present in the samples investigated by Joy et al. and thus does not have corresponding U-Pb ages on it. We created multiple subsplits of both the IM and matrix lithologies, each weighing several tens of micrograms. We conducted Ar-40 Ar-39 dating of this candidate SPA material by high-resolution step heating and comparing it with the regolith that surrounds it.

  17. Thermal History of the Felsite Unit, Geysers Geothermal Field, From Thermal Modeling of 40Ar/39Ar Incremental Heating Data

    Energy Technology Data Exchange (ETDEWEB)

    T. M. Harrison (U of California); G. B. Dalrymple (Oregon State U); J. B. Hulen (U of Utah); M. A. Lanphere; M. Grove; O. M. Lovera

    1999-08-19

    An Ar-40/Ar-39 and U-Pb study was performed of the Geysers plutonic complex of the Geysers Geothermal Field in California. Sixty-nine ion microprobe spot analyses of zircons from four granite samples from the plutonic complex that underlies the Geysers geothermal field yielded Pb-207/Pb-206 vs. U-238/Pb-206 concordia ages ranging from 1.13 {+-} 0.04 Ma to 1.25 {+-} 0.04 Ma. The U-Pb ages coincide closely with Ar-40/Ar-39 age spectrum plateau and ''terminal'' ages from coexisting K-feldspars and with the eruption ages of overlying volcanic rocks. The data indicate that the granite crystallized at 1.18 Ma and had cooled below 350 C by {approximately}0.9-1.0 Ma. Interpretation of the feldspar Ar-40/Ar-39 age data using multi-diffusion domain theory indicates that post-emplacement rapid cooling was succeeded either by slower cooling from 350-300 C between 1.0 and 0.4 Ma or transitory reheating to 300-350 C at about 0.4-0.6 Ma. Heat flow calculations constrained with K-feldspar thermal histories and the pre sent elevated regional heal flow anomaly demonstrate that appreciable heat input from sources external to the known Geysers plutonic complex is required to maintain the geothermal system. This requirement is satisfied by either a large, underlying, convecting magma chamber (now solidified) emplaced at 1.2 Ma or episodic intrusion of smaller bodies from 1.2-0.6 Ma.

  18. Whole-rock Ar-Ar dating for low-grade metavolcanics within the Dabie orogen and its geological significance

    Institute of Scientific and Technical Information of China (English)

    GAO Tianshan; TANG Jiafu; SANG Haiqing; HU Shiling; QIAN Cunchao

    2006-01-01

    The genetic relationship between low- grade and ultrahigh-pressure (UHP) metamorphic units in the interior of the Dabie orogen has been controversial with respect to preservation of volcanic texture during continental subduction to mantle depths. In order to resolve this issue, whole-rock Ar-Ar dating was carried out for greenschist-facies metatuff that is in contact with UHP eclogite in Yuexi County, Anhui Province. One sample gave a plateau age of 784.4±2.0 Ma and an isochron age of 785.0± 4.7 Ma, and the other sample a plateau age of 770.9± 2.0 Ma and an isochron age of 769.5±3.1 Ma. It appears that the Ar isotopic system was not disturbed since the volcanic eruption at the middle Neoproterozoic. Because of the low closure temperature of Ar diffusion in volcanic rocks, retention of the Neoproterozoic ages indicates that the low-grade metavolcanics did not experience high-grade metamorphism up to eclogite-facies conditions during the Triassic subduction of continental crust. Furthermore, the Neoproterozoic Ar-Ar ages are also in agreement with protolith ages of UHP metaigneous rocks in the Dabie orogen. Therefore, the metatuff is interpreted as a tectonic relict that was scraped off during the Triassic subduction and thus was not subducted to mantle depths like the adjacent eclogite. This lends support to the model for crustal detachment between cover and basement during continental collision. A tectonic mélange model is proposed to explain the occurrence of contrasting grades of metamorphic rock within the UHP metamorphic zone.

  19. Inorganic arsenic and human prostate cancer Arsênico inorgânico e câncer de próstata humano

    Directory of Open Access Journals (Sweden)

    Lamia Benbrahim-Tallaa

    2009-02-01

    Full Text Available We critically evaluated the etiologic role of inorganic arsenic in human prostate cancer. We assessed data from relevant epidemiologic studies concerning environmental inorganic arsenic exposure. Whole animal studies were evaluated as were in vitro model systems of inorganic arsenic carcinogenesis in the prostate. Multiple studies in humans reveal an association between environmental inorganic arsenic exposure and prostate cancer mortality or incidence. Many of these human studies provide clear evidence of a dose-response relationship. Relevant whole animal models showing a relationship between inorganic arsenic and prostate cancer are not available. However, cellular model systems indicate arsenic can induce malignant transformation of human prostate epithelial cells in vitro. Arsenic also appears to impact prostate cancer cell progression by precipitating events leading to androgen independence in vitro. Available evidence in human populations and human cells in vitro indicates that the prostate is a target for inorganic arsenic carcinogenesis. A role for this common environmental contaminant in human prostate cancer initiation and/or progression would be very important.Realizamos uma avaliação crítica do papel etiológico do arsênico inorgânico no câncer de próstata humano. Avaliamos dados de estudos epidemiológicos relevantes referentes à exposição ao arsênico inorgânico ambiental. Foram avaliados estudos com animais completos, bem como sistemas de modelo in vitro de carcinogênese decorrente de arsênico inorgânico na próstata. Estudos múltiplos em seres humanos revelaram uma associação entre exposição ao arsênico inorgânico ambiental e mortalidade por ou incidência de câncer de próstata. Muitos desses estudos em seres humanos oferecem indícios claros de uma relação dose-resposta. Não se encontram disponíveis modelos animais completos relevantes que mostrem uma relação entre arsênico inorgânico e câncer de

  20. ^(40)Ar/^(39)Ar constraints on the age and thermal history of the Urucum Neoproterozoic banded iron-formation, Brazil

    OpenAIRE

    Piacentini, Thiago; Vasconcelos, Paulo M.; Farley, Kenneth A.

    2013-01-01

    Urucum is one of the youngest banded iron-formations (BIFs) yet its exact age remains uncertain. ^(40)Ar/^(39)Ar geochronology on late-diagenetic to early metamorphic cryptomelane from the Urucum sequence reveals a minimum depositional age of 587 ± 7 Ma. Metamorphic braunite age spectra yield flat segments defining apparent ages of 547 ± 3 Ma to 513 ± 4 Ma, interpreted as recrystallization or cooling ages. Metamorphic muscovite grains from a meta-arkose interbedded with the BIF yield reproduc...

  1. Vector Magnetic Field Measurement of NOAA AR 10197

    Institute of Scientific and Technical Information of China (English)

    Hong-Fei Liang; Hai-Juan Zhao; Fu-Yuan Xiang

    2006-01-01

    A set of two-dimensional Stokes spectral data of NOAA AR 10197 obtained by the Solar Stokes Spectral Telescope (S3T) at the Yunnan Observatory are qualitatively analyzed.The three components of the vector magnetic field, the strength H, inclination γ and azimuth x, are derived. Based on the three components, we contour the distributions of the longitudinal magnetic field and transverse magnetic field. The active region (AR) has two different magnetic polarities apparent in the longitudinal magnetic map due to projection effect. There is a basic agreement on the longitudinal magnetic fields between the S3T and SOHO/MDI magnetograms, with a correlation coefficient ρBl = 0.911. The transverse magnetic field of the AR has a radial distribution from a center located in the southwest of the AR. It is also found that the transverse magnetic fields obtained by Huairou Solar Observing Station (HRSOS) have a similar radial distribution. The distributions of transverse magnetic field obtained by S3T and HRSOS have correlation coefficients, ρAzimu = 0.86 and ρBt = 0.883,in regard to the azimuthal angle and intensity.

  2. He-, Ne-, and Ar-phosgene intermolecular potential energy surfaces

    DEFF Research Database (Denmark)

    Munteanu, Cristian R.; Henriksen, Christian; Felker, Peter M.;

    2013-01-01

    Using the CCSD(T) model, we evaluated the intermolecular potential energy surfaces of the He-, Ne-, and Ar-phosgene complexes. We considered a representative number of intermolecular geometries for which we calculated the corresponding interaction energies with the augmented (He complex) and doub...

  3. Tensor Effect on Proton Bubble Structure of ~(46)Ar

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    We have calculated the proton density distribution of 46Ar for different pairing interactions with the Skyrme interactions SLy5 and SLy5+Tw (Tw is the tensor force, which was obtained by the G-matrix calculations and added perturbatively into the SLy5 interaction

  4. Big data computing: Building a vision for ARS information management

    Science.gov (United States)

    Improvements are needed within the ARS to increase scientific capacity and keep pace with new developments in computer technologies that support data acquisition and analysis. Enhancements in computing power and IT infrastructure are needed to provide scientists better access to high performance com...

  5. Expansion of the USDA ARS Aerial Application spray atomization models

    Science.gov (United States)

    An effort is underway to update the USDA ARS aerial spray nozzle models using new droplet sizing instrumen-tation and measurement techniques. As part of this effort, the applicable maximum airspeed is being increased from 72 to 80 m/s to provide guidance to applicators when using new high speed air...

  6. Interacting with Visual Poems through AR-Based Digital Artwork

    Science.gov (United States)

    Lin, Hao-Chiang Koong; Hsieh, Min-Chai; Liu, Eric Zhi-Feng; Chuang, Tsung-Yen

    2012-01-01

    In this study, an AR-based digital artwork called "Mind Log" was designed and evaluated. The augmented reality technique was employed to create digital artwork that would present interactive poems. A digital poem was generated via the interplay between a video film and a text-based poem. This artwork was created following a rigorous design flow,…

  7. Spectroscopy Study of Ar + CO2 Plasmas in ASTRAL.

    Science.gov (United States)

    Munoz, Jorge; Boivin, Robert; Kamar, Ola; Loch, Stuart; Ballance, Connor

    2006-10-01

    A spectroscopy study of the ASTRAL (Auburn Steady sTate Research fAciLity) helicon plasma source running Ar + CO2 gas mix is presented. ASTRAL produces Ar plasmas: ne = 10^10 to 10^13 cm-3, Te = 2 to 10 eV and Ti = 0.03 to 0.5 eV. A series of 7 large coils produce an axial magnetic field up to 1.3 kGauss. A fractional helix antenna is used to introduce rf power up to 2 kWatt. A spectrometer which features a 0.33 m Criss-Cross monochromator and a CCD camera is used for this study. Very different plasmas are produced following the relative importance of CO2 in the gas mixture. At low CO2 concentration, the plasmas are similar to those obtained with pure Ar with weak CO2, CO2^+, CO and CO^+ bands. The usual blue plasma core associated with intense Ar II transitions is observed with however a significant white glow coming from the outer plasma regions. At higher CO2 concentration, the plasma becomes essentially molecular and can be described as an intense white plasma column. Molecular dissociative processes associated with the production of strong C and O atomic lines are observed under specific plasma conditions. The atomic spectral lines are compared with ADAS modeling results. This study indicates the possible advantages of using a helicon source to control the CO2 plasma chemistry for industrial applications.

  8. 75 FR 12163 - Class E Airspace; Mountain View, AR

    Science.gov (United States)

    2010-03-15

    ...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p. 389... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Mountain View, AR AGENCY:...

  9. CANONICAL COMPUTATIONAL FORMS FOR AR 2-D SYSTEMS

    NARCIS (Netherlands)

    ROCHA, P; WILLEMS, JC

    1990-01-01

    A canonical form for AR 2-D systems representations is introduced. This yields a method for computing the system trajectories by means of a line-by-line recursion, and displays some relevant information about the system structure such as the choice of inputs and initial conditions.

  10. Atom trap trace analysis of {sup 39}Ar

    Energy Technology Data Exchange (ETDEWEB)

    Welte, Joachim

    2011-12-14

    Detection of {sup 39}Ar in natural water samples can be employed for radiometric dating on a timescale of 50 to 1000 years before present. This experimental work comprises the setup of an atomic beam and trap apparatus that captures and detects {sup 39}Ar atoms by the laser-cooling technique ''Atom Trap Trace Analysis''. With this approach, the limitations of low-level counting, regarding sample size and measurement time, could be overcome. In the course of this work, the hyperfine structure spectrum of the cooling transition 1s{sub 5}-2p{sub 9} has been experimentally determined. A high intensity, optically collimated beam of slow metastable argon atoms has been set up and fluorescence detection of individual {sup 39}Ar atoms in a magneto-optical trap is realized. {sup 39}Ar count rates of 1 atom in about 4 hours have been achieved for atmospheric argon. Recent improvements further suggest that even higher count rates of 1 atom/hour are within reach.

  11. Important authorship clarification for arXiv:1010.2709

    OpenAIRE

    Yaffe, Yoav

    2010-01-01

    Version 1 of this paper (arXiv:1010.2709v1) was submitted exclusively by Noa Lavi, without prior knowledge, let alone consent, by Yoav Yaffe. Yoav Yaffe is {\\em not} an author of any version of this paper, with the exception of the present clarification.

  12. Global properties of the white dwarf pulsar AR Scorpii

    CERN Document Server

    Franzon, B

    2016-01-01

    In view of the new recent observation and measurement of the fast-rotating and highly-magnetized white dwarf AR Sco \\cite{Marsh:2016uhc}, we determine bounds for its radius, magnetic fields, moment of inertia and gravitational wave (GW) emission by using observations of the luminosity, as well the rotation frequency $\

  13. Immune epitope database analysis resource (IEDB-AR)

    DEFF Research Database (Denmark)

    Zhang, Qing; Wang, Peng; Kim, Yohan;

    2008-01-01

    We present a new release of the immune epitope database analysis resource (IEDB-AR, http://tools.immuneepitope.org), a repository of web-based tools for the prediction and analysis of immune epitopes. New functionalities have been added to most of the previously implemented tools, and a total...

  14. USDA-ARS and EMBRAPA Scientists Build Bridges With Strawberries

    Science.gov (United States)

    At the '3rd Simposio Nacional do Morango'and '2nd Encontro de Pequenas Frutas e Frutas Nativas do Mercosul' at Pelotas, Rio Grande Do Sul, Brazil, held 7 - 10 November 2006, I was invited to describe strawberry breeding in the United States and also my own USDA-ARS strawberry breeding program at Bel...

  15. Ars Fennica - isikliku ja poliitilise vahel / Janar Ala

    Index Scriptorium Estoniae

    Ala, Janar, 1979-

    2009-01-01

    2008. aasta Ars Fennica kunstiauhinna kandidaatide tööde näitus Kumu Kunstimuuseumis kuni 26. aprillini. Läti kunstniku Katrina Neiburga, soomlaste Seppo Renvalli, Maria Dunckeri ja Tea Mäkipää ning Mark Raidpere näitusel eksponeeritud töödest

  16. Mälestusi "Ars Fennica'st" / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-

    2009-01-01

    Ars Fennica 2008. aasta nominentide Tea Mäkipää, Seppo Renvalli, Maria Dunckeri, Katrīna Neiburga (Läti) ja Mark Raidpere näitus Kumu Kunstimuuseumis 26. aprillini. Preemiaga pärjati Mark Raidpere ekspositsioon

  17. Strong-field nonsequential double ionization of Ar and Ne

    International Nuclear Information System (INIS)

    We investigate the nonsequential double ionization (NSDI) of Ar and Ne based on quantitative rescattering theory (QRS). According to QRS theory, each elementary NSDI process can be calculated by multiplying the returning electron wave packet with appropriate differential electron-ion scattering cross sections. We include (e, 2e) and electron-impact excitation cross sections of Ar+ to obtain the correlated electron momentum spectra for the NSDI of Ar by few-cycle pulses to check the dependence of NSDI on the carrier-envelope phase. The results are compared to the ion momentum spectra from the recent experiment of Johnson et al. [Phys. Rev. A 83, 013412 (2011)]. Calculations have also been performed for Ar at another intensity to illustrate the intensity dependence of NSDI and to compare with the earlier data of Feuerstein et al. [Phys. Rev. Lett. 87, 043003 (2001)] and for Ne to illustrate the target dependence. We also address the presence of resonant capture processes in electron-ion collisions in the NSDI spectra.

  18. Behaviour of AR glass fibre for building structural applications

    Directory of Open Access Journals (Sweden)

    Miravete, A.

    2005-12-01

    Full Text Available The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be used as reinforcement of organic matrix composite materials, broadening the range of structural applications. The mechanical properties of AR glass fibre and organic matrix composite materials will be studied in this paper. First, the behaviour of this material under stress corrosion will be analysed. Their mass loss will be compared to E, C, and boron free glass fibres. Second, an experimental study dealing with 3P test bending and short beam ofAR glass fibre/polyester will de described with the goal of obtaining their Young modulus and tensile and interlaminar shear strengths. Finally, these experimental results will be compared to E glass fibre/polyester and several conclusions about their structural applications will be drawn.

    El vidrio AR y su presentación en forma de fibras de refuerzo, fue diseñado para ser inerte a los álcalis de los cementos. Por este motivo se viene utilizando desde hace varias décadas como refuerzo de morteros y hormigones en forma de fibra corta. El ensimaje que estas fibras de vidrio de refuerzo A R presentaba en su origen no era compatible con resinas de tipo sintéticas, por lo que el refuerzo era exclusivo para cementos y hormigones fuera cual fuera la aplicación, formato o proceso productivo. Recientemente, gracias al desarrollo específico de ensimajes especiales acordes a las fibras de vidrio AR ha aparecido la misma tipología de vidrio AR como refuerzo en forma de fibra continua compatible con resinas sint

  19. Precision angle-resolved autoionization resonances in Ar and Ne

    Energy Technology Data Exchange (ETDEWEB)

    Berrah, N.; Langer, B.; Gorczyca, T.W. [Western Michigan Univ., Kalamazoo, MI (United States)] [and others

    1997-04-01

    Theoretical work has shown that the electron angular distribution and the shape of the autoionization resonances are crucial to the understanding of certain types of electron-electron correlation. Autoionization resonances in Ne (Ar) result from the decay of the excited discrete state Ne{sup *} 2s2p{sup 6} np (Ar{sup *} 3s3p{sup 6} np) into the continuum state Ne{sup +} 2s{sup 2}2p{sup 5} + e{sup {minus}} (ks,kd) (Ar{sup +} 3s{sup 2}3p{sup 5} + e{sup {minus}} (ks,kd)). Since the continuum can also be reached by direct photoionization, both paths add coherently, giving rise to interferences that produce the characteristic Beutler-Fano line shape. In this work, the authors report on quantitative angle-resolved electron spectrometry studies of (a) the Ne 2s{sup 2}2p{sup 6} {r_arrow} 2s2p{sup 6} np (n=3-5) autoionizing resonances and the 2s{sup 2}2p{sup 6} {r_arrow} 2p{sup 4}3s3p doubly excited resonance, (b) the Ar 3s{sup 2}3p{sup 6} {r_arrow} 3s3p{sup 6} np (n=4-9) autoionization resonances and extended R-matrix calculations of the angular-distribution parameters for both Ne and Ar measurements. Their results are compared with previous theoretical work by Taylor.

  20. Geochemistry and 40Ar/39Ar age of Early Carboniferous dolerite sills in the southern Baltic Sea

    Directory of Open Access Journals (Sweden)

    Gediminas Motuza

    2015-08-01

    Full Text Available The Early Carboniferous magmatic event in the southern Baltic Sea is manifested by dolerite intrusions. The presumable area in which the dolerite intrusions occur ranges from 30 to 60 km in east–west direction, and is about 100 km in north–south direction. The dolerites were sampled in well D1-1 and investigated by applying chemical analysis and 40Ar/39Ar step-heating dating. Dolerites are classified as alkali and sodic, characterized by high TiO2 (3.92, 3.99 wt% and P2O5 (1.67, 1.77 wt% and low MgO (4.89, 4.91 wt% concentrations, enriched in light rare earth elements, originated from an enriched mantle magma source and emplaced in a continental rift tectonic setting. The 351 ± 11 Ma 40Ar/39Ar plateau age for groundmass plagioclase indicates a considerable age gap with the 310–250 Ma magmatism in southern Scandinavia and northern Germany. The magmatic rocks in the Baltic Sedimentary Basin are coeval with alkaline intrusions of NE Poland. Both magmatic provinces lie in the northwestward prolongation of the Pripyat–Dnieper–Donetsk Rift (370–359 Ma and may constitute a later phase of magmatic activity of this propagating rift system.

  1. ISEA reversed event in the Cretaceous Normal Superchron (CNS):40Ar/39Ar dating and paleomagnetic results

    Institute of Scientific and Technical Information of China (English)

    SHI Ruiping; HE Huaiyu; ZHU Rixiang; PAN Yongxin

    2004-01-01

    In order to provide the age for the ISEA (one reversed event in the CNS) a combined rock magnetic, paleomagnetic and geochronologic study has been conducted on two Cretaceous andesitic basalt lava flows from Sanbaoying, Liaoning Province of northeastern China. Rock magnetic investigations show that pseudo-single domain (PSD) titanomagnetite with poor-Ti content is the dominant magnetic mineral in Sanbaoying lava flows. Detailed systematic thermal demagnetization allowed us to isolate two remanence components after removing a low temperature component at 100℃/150℃; an intermediate temperature component with normal polarity at 150℃/200℃-380℃/400℃ and the characteristic remanence component (ChRM) with reversed polarity above 400℃/450℃. 40Ar/39Ar dating results show that Sanbaoying rocks were erupted at 116.0±0.3 Ma. Combination of paleomagnetic results and 40Ar/39Ar dating indicates that the reversed event recorded in Sanbaoying lavas corresponds to the ISEA event in the CNS. Our age determination for ISEA reversed event provides chronological evidence to study the relevance between global geological events that occurred in the CNS and geodynamo processes.

  2. 40Ar/39Ar dated climatic and hydrological variability between MIS20 and MIS18 at Sulmona Basin (central Italy)

    Science.gov (United States)

    Zanchetta, Giovanni; Giaccio, Biagio; Eleonora, Reagattieri; Nomade, Sebastien; Renne, Paul R.; Sprain, Courtney J.; Drysdale, Russell N.; Tzedakis, Polychronis C.; Messina, Paolo; Scardia, Giancarlo; Sposato, Andrea

    2015-04-01

    Understanding spatial-temporal variability, magnitude and different expressions of Quaternary millennial-scale palaeoclimatic changes is one of the frontier challenges of modern palaeoclimatology. Addressing this issue requires the acquisition of regionally representative, and ideally independently-dated, records of climatic variability. Multiproxy record (stable isotopes, XRF, MS, %CaCO3) from lacustrine succession of Sulmona basin (central Italy), highlights climatic and hydrological variability at orbital to millennial scales between MIS20 and MIS18. The record highlights the presence of interesting millennial scale variability within MIS19, considered to be the best orbital analogue of the current interglacial. The presence of several tephra layers precisely dated by 40Ar/39Ar technique, allow placement of the record within a robust time frame. Assembling a high-resolution paleoclimatic record for MIS19 anchored to a high-precision 40Ar/39Ar chronology, it is possible to show that the MIS 19c interglacial started shortly before the boreal summer insolation and obliquity maximum/precession minimum at 790-788 ka, and ended 11.6 ± 2.3 kyr later, when orbital parameters assumed a configuration similar to the present one.

  3. Ar-Ar geochronology of Late Mesozoic volcanic rocks from the Yanji area,NE China and tectonic implications

    Institute of Scientific and Technical Information of China (English)

    LI ChaoWen; GUO Feng; FAN WeiMing; GAO XiaoFeng

    2007-01-01

    Ar-Ar dating results of late Mesozoic-Cenozoic volcanic rocks from the Yanji area, NE China provide a new volcano-sedimentary stratigraphic framework. The previously defined "Triassic-Jurassic" volcanic rocks(including those from Sanxianling, Tuntianying, Tianqiaoling and Jingouling Fms.)were erupted during 118-106Ma,corresponding to Early Cretaceous. The new eruption age span is slightly younger than the main stage(130-120 Ma)of the extensive magmatism in the eastern Central Asian Orogenic Belt and its adjacent regions. Subduction-related adakites occurring in the previously defined Quanshuicun Fm. Were extruded at ca.55 Ma. Based on these new Ar-Ar ages, the late Mesozoic to Palaeocene volcano-sedimentary sequences is rebuilt as:Tuopangou Fm., Sanxianling/Tuntianying Fm.(118-115 Ma),Malugou/Tianqiaoling Fm.(K1),Huoshanyan/Jingouling Fm.(108-106 Ma),Changcai Fm.(K2),Quanshuicun Fm.(~55 Ma)and Dalazi Fm. Our results suggest that subduction of the Palaeo-Pacific Ocean beneath the East Asian continental margin occurred during 106to 55 Ma. Consistent with the paleomagnetic observations and magmatic records which indicated that the Izanagi-Farallon ridge subduction beneath the southwestern Japan took place during 95-65 Ma.

  4. Ar-Ar geochronology of Late Mesozoic volcanic rocks from the Yanji area, NE China and tectonic implications

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Ar-Ar dating results of late Mesozoic-Cenozoic volcanic rocks from the Yanji area, NE China provide a new volcano-sedimentary stratigraphic framework. The previously defined “Triassic-Jurassic” volcanic rocks (including those from Sanxianling, Tuntianying, Tianqiaoling and Jingouling Fms.) were erupted during 118―106 Ma, corresponding to Early Cretaceous. The new eruption age span is slightly younger than the main stage (130―120 Ma) of the extensive magmatism in the eastern Central Asian Orogenic Belt and its adjacent regions. Subduction-related adakites occurring in the previously defined Quanshuicun Fm. were extruded at ca. 55 Ma. Based on these new Ar-Ar ages, the late Mesozoic to Palaeocene volcano-sedimentary sequences is rebuilt as: Tuopangou Fm., Sanxianling/Tuntianying Fm. (118―115 Ma), Malugou/Tianqiaoling Fm. (K1), Huoshanyan/Jingouling Fm. (108―106 Ma), Changcai Fm. (K2), Quanshuicun Fm. (~55 Ma) and Dalazi Fm. Our results suggest that subduction of the Pa- laeo-Pacific Ocean beneath the East Asian continental margin occurred during 106 to 55 Ma, consistent with the paleomagnetic observations and magmatic records which indicated that the Izanagi-Farallon ridge subduction beneath the southwestern Japan took place during 95―65 Ma.

  5. Combined oxygen, hydrogen, /sup 40/Ar//sup 39/Ar isotopic evaluation of molybdenite mineralization, east Pioneer Mountains, Montana

    Energy Technology Data Exchange (ETDEWEB)

    Chesley, J.T.; Snee, L.W.; O' Neil, J.R.

    1985-01-01

    The Pear Lake molybdenite (moly) prospect is in the Eastern Pioneer Wilderness Area, 30 km south of the Cannivan Gulch moly deposit. It lies on a NW-SE trend with other prospects that are contemporaneous. Mineralized veins outcrop sporadically over a 4 square mile area, with a major concentration in the center of the study area. Previous studies have suggested potential moly-mineralization at depth. /sup 40/Ar//sup 39/Ar age-spectra on hornblend (hb) from the granodiorite host rock indicate emplacement at 75.0 +/- 1 Ma, with biotite closure at 69.0 +/- .3 Ma, in the vicinity of Pear Lake. Hydrothermal muscovites from the moly-bearing veins have ages of 68.0 +/- .5 Ma. partial resetting of biotite cooling dates in the vicinity of mineralization are observed, but biotites on the outer portion of the mineralizing system are undisturbed. These relations suggest that mineralization occurred after the host pluton had cooled to below 280/sup 0/C. Quartz-magnetite isotopic temperatures are 380 to 420/sup 0/C for moly-veins. These data suggest that magmatic hydrothermal fluids operated in the upper portion of this molysystem. These isotopic data, combined with geologic mapping, suggest that the Pear Lake moly prospect resulted from a weak, short-lived magmatic hydrothermal event at depth, and is unlikely to contain economic levels of molybdenum. The combined /sup 40/Ar//sup 39/Ar-stable isotope approach should prove useful in evaluating other hydrothermal systems.

  6. Infrared spectroscopy of ArOH: A direct probe of the Ar+OH X2Π potential energy surface

    International Nuclear Information System (INIS)

    An infrared-ultraviolet (IR-UV) double-resonance technique has been implemented to obtain the infrared spectrum of ArOH in the vicinity of the fundamental OH stretch at 2.8 μm. A rotationally resolved spectrum of the fundamental OH stretching band of ArOH is observed at 3567.85(1) cm-1 (origin). A combination band, involving both OH stretch and intermolecular bending excitation, is identified at 3577.00(1) cm-1 (origin). The intermolecular energy of the excited bending state provides a direct measure of the anisotropy of the Ar+OH X2Π interaction potential. The rotational structure of the combination band reveals a large splitting between parity components with the same total angular momentum in the excited bending state [0.69(1) cm-1 for J=(3/2)]. The experimentally derived parity splitting is compared with previous experimental and theoretical determinations of this parameter. The parity splitting associated with the excited bending state reflects the change in the intermolecular potential when the pπ orbital containing the unpaired electron of OH lies in or out of the ArOH plane. (c) 2000 American Institute of Physics

  7. Mineralogy and Ar-39 - Ar-40 of an old pristine basalt: Thermal history of the HED parent body

    Science.gov (United States)

    Takeda, Hiroshi; Mori, Hiroshi; Bogard, Donald D.

    1994-01-01

    Previous investigations of mineral chemistry and Rb-Sr and Sm-Nd ages indicated that clast,84 from eucrite Yamato 75011 had preserved the pristine nature of its initial crystallization during an early stage of the HED parent body. Microscale mineralogy and Ar-39-Ar-40 ages of this clast, however, revealed local disturbance of microtextures and partially reset ages. This evidence suggests that, in addition to initial crystallization and rapid cooling, the Y75011,84 clast experienced shock deformation, reheating of short duration at higher temperature, and brecciation. These characteristics suggest two or more impact events. Fe-rich olivine filling fractures in pyroxene may have been introduced during the accompanying shock fracturing. The inferred Ar-39-Ar-40 degassing ages for Y75011 matrix and clast, 84 are 3.94 +/- 0.04 Ga and 3.98 +/- 0.03 Ga, respectively. The suggested degassing age for a clast from Y790020, believed to be paired with Y75011, is approximately 4.03 Ga, but could be younger. We consider it likely that all three samples experienced a common degassing event 3.95 +/- 0.05 Ga ago, but we cannot rule out two or more events spaced over a approximately 0.1 Ga interval. Higher temperature extractions of the two clast samples show significantly older apparent ages up to approximately 4.5 Ga and suggest that the time/temperature regime of this event was not sufficient to degas Ar totally. Most likely, the K-Ar ages were reset by thermal metamorphism associated with one or more impact events associated with shock fracturing, formation of Fe-rich olivine veins, and/or meteorite brecciation. The pyroxene annealing that commonly occurs in many eucrites is likely to be a much earlier process than the impact-produced textural changes and reset K-Ar ages observed in these meteorites. The existence of mineralogical and chronological evidence for metamorphism in an otherwise pristine eucrite suggests that the HED parent body experienced an extensive degree of

  8. I-Xe and 40Ar-39Ar dating of silicate from Weekeroo Station and Netschaevo IIE iron meteorites

    International Nuclear Information System (INIS)

    Silicate inclusions from two IIE iron meteorites were dated by the I-Xe and 40Ar-39Ar techniques. Weekeroo Station, a 'normal' IIE iron, shows no loss of radiogenic 40Ar at low temperature, and the well defined 40Ar-39Ar plateau yields an age of 4.54 +- 0.03 Byr. The xenon data define a good I-Xe correlation with an age of + 10.9 +- 0.5 Myr relative to Bjurbole. Despite its relatively young age, Weekeroo Station's (129Xe/132Xe)sub(trapped) ratio (= 0.84 +- 0.05) lies significantly below the solar value. Netschaevo silicate has a chondritic composition, unlike 'normal' IIE silicate which is more differentiated. Nevertheless Netschaevo gives a 40Ar-39Ar plateau-age of only 3.79 +- 0.03 Byr, with the xenon data failing to define an I-Xe isochron. Only irons from the IAB and IIE groups contain silicate inclusions, but these two groups differ in many other respects, mostly suggesting that IAB meteorites are more primitive. The I-Xe chronology supports this suggestion inasmuch as Weekeroo Station formed well after IAB silicates. The four silicate-bearing IIE irons which have now been dated can be subdivided into distinct pairs: Weekeroo Station and Colomera formed near the beginning of the solar system, while Netschaevo and Kodaikanal both formed only 3.8 Byr ago. A review of other properties of these meteorites generally supports this subdivision. This work underscores the complexity of the history of IIE meteorites; in particular, an adequate model must account for the formation of two IIE irons at 3.8 Byr without disturbing rare gases in Weekeroo Station. All formation models are quite speculative, but the one which seems best to fit the available evidence postulates two parent bodies: the 3.8 Byr old silicate formed on one parent body, all other IIE material resided in a separate body, and subsequent collision(s) mixed the young silicate with IIE metal. (author)

  9. 40Ar/39Ar impact ages and time-temperature argon diffusion history of the Bunburra Rockhole anomalous basaltic achondrite

    Science.gov (United States)

    Jourdan, Fred; Benedix, Gretchen; Eroglu, Ela.; Bland, Phil. A.; Bouvier, Audrey.

    2014-09-01

    The Bunburra Rockhole meteorite is a brecciated anomalous basaltic achondrite containing coarse-, medium- and fine-grained lithologies. Petrographic observations constrain the limited shock pressure to between ca. 10 GPa and 20 GPa. In this study, we carried out nine 40Ar/39Ar step-heating experiments on distinct single-grain fragments extracted from the coarse and fine lithologies. We obtained six plateau ages and three mini-plateau ages. These ages fall into two internally concordant populations with mean ages of 3640 ± 21 Ma (n = 7; P = 0.53) and 3544 ± 26 Ma (n = 2; P = 0.54), respectively. Based on these results, additional 40Ar/39Ar data of fusion crust fragments, argon diffusion modelling, and petrographic observations, we conclude that the principal components of the Bunburra Rockhole basaltic achondrite are from a melt rock formed at ∼3.64 Ga by a medium to large impact event. The data imply that this impact generated high enough energy to completely melt the basaltic target rock and reset the Ar systematics, but only partially reset the Pb-Pb age. We also conclude that a complete 40Ar∗ resetting of pyroxene and plagioclase at this time could not have been achieved at solid-state conditions. Comparison with a terrestrial analog (Lonar crater) shows that the time-temperature conditions required to melt basaltic target rocks upon impact are relatively easy to achieve. Ar data also suggest that a second medium-size impact event occurred on a neighbouring part of the same target rock at ∼3.54 Ga. Concordant low-temperature step ages of the nine aliquots suggest that, at ∼3.42 Ga, a third smaller impact excavated parts of the ∼3.64 Ga and ∼3.54 Ga melt rocks and brought the fragments together. The lack of significant impact activity after 3.5 Ga, as recorded by the Bunburra Rockhole suggests that (1) either the meteorite was ejected in a small secondary parent body where it resided untouched by large impacts, or (2) it was covered by a porous heat

  10. Sobre a viagem de Enrico Fermi ao Brasil em 1934

    CERN Document Server

    Caruso, Francisco

    2014-01-01

    Enrico Fermi was one of the greater physicists of the XX century. In 1934, he gave several lectures in Brazil. Invited by Theodoro Ramos to work in S\\~ao Paulo, he preferred to stay in Rome and went to the USA in 1938. However, Fermi recommended Gleb Wataghin to come in his place. Wataghin made history in Brazil, becoming one of the first Professors of the future S\\~ao Paulo University. Besides his relevance to the History of Science, Fermi eventually leaved an indelible mark on the creation and institutionalization of national scientific research due to the indication of Wataghin. Despite this fact, very little is known about Fermi's trip to Brazil. This work tries to reconstruct the fullest possible steps of the famous Italian physicist in our lands.

  11. Crater Retention Ages from (4) Vesta Matching Independent Ar-Ar Ages of HED Meteorites

    Science.gov (United States)

    Schmedemann, Nico; Kneissl, Thomas; Ivanov, Boris A.; Michael, Gregory G.; Neukum, Gerhard; Nathues, Andreas; Sierks, Holger; Wagner, Roland; Krohn, Katrin; Le Corre, Lucille; Reddy, Vishnu; Ruesch, Ottaviano; Hiesinger, Harald; Jaumann, Ralf; Raymond, Carol A.; Russell, Christopher T.

    2013-04-01

    .054/-0.087) Ga and 3.63 (+0.058/-0.096) Ga. We also find seismic (miniscule ejecta blanket from Rheasilvia) resurfacing events in the time frame of ~3.56 to ~3.59 Ga at several areas in the northern hemisphere, indicative for a major seismic activity probably connected to the Rheasilvia formation. An antipodal activity is also suggested by hydrocode modeling [9]. By summation of age probability curves of measurements we link to the Rheasilvia formation, we find 3.58 (+0.07/-0.12) Ga. Using a similar attempt we find 3.75 (+0.05/-0.21) Ga for the Veneneia formation. Both crater retention ages correspond within the error bars with prominent peaks of independent Ar-Ar ages of Vesta related HED meteorites [10]. Acknowledgement: This work has been supported by the German Space Agency (DLR) on behalf of the Federal Ministry of Economics and Technology, grants 50OW1101(NS,TK), 50QM1001 (GM) and 50OW1102 (OR,HH). References: [1] Russell et al. (2007): Advances in Space Research 40(2): pp193-201, 2007. [2] Neukum and Ivanov: In: Gehrels T (ed) "Hazards due to comets and asteroids". University of Arizona Press, Tucson, 359-416, 1994. [3] O'Brien and Greenberg (2005): Icarus 178(1): 179-212. [4] Nesvorny et al. (2009): Icarus 200(2): 698-701. [5] Ivanov (2001): Chronology and Evolution of Mars 96, 87-104, 2001. [6] Schmedemann et al. (2012): 43.LPSC, The Woodlands, #1659. [7] Morbidelli et al. (2003): Icarus 162, 328-336. [8] Marchi et al. (2012): Science 336, 690. [9] Bowling et al. (2012): 75th Annual Meeting of the Meteoritical Society, 2012, Cairns, Australia. Meteoritics and Planetary Science Supplement, id.5256. [10] Bogard, D. D. (2011): Chemie der Erde - Geochemistry, vol. 71, issue 3: 207-226.

  12. 40Ar/39Ar geochronology, paleomagnetism, and evolution of the Boring volcanic field, Oregon and Washington, USA

    Science.gov (United States)

    Fleck, Robert J.; Hagstrum, Jonathan T.; Calvert, Andrew T.; Evarts, Russell C.; Conrey, Richard M.

    2014-01-01

    The 40Ar/39Ar investigations of a large suite of fine-grained basaltic rocks of the Boring volcanic field (BVF), Oregon and Washington (USA), yielded two primary results. (1) Using age control from paleomagnetic polarity, stratigraphy, and available plateau ages, 40Ar/39Ar recoil model ages are defined that provide reliable age results in the absence of an age plateau, even in cases of significant Ar redistribution. (2) Grouping of eruptive ages either by period of activity or by composition defines a broadly northward progression of BVF volcanism during latest Pliocene and Pleistocene time that reflects rates consistent with regional plate movements. Based on the frequency distribution of measured ages, periods of greatest volcanic activity within the BVF occurred 2.7–2.2 Ma, 1.7–0.5 Ma, and 350–50 ka. Grouped by eruptive episode, geographic distributions of samples define a series of northeast-southwest–trending strips whose centers migrate from south-southeast to north-northwest at an average rate of 9.3 ± 1.6 mm/yr. Volcanic activity in the western part of the BVF migrated more rapidly than that to the east, causing trends of eruptive episodes to progress in an irregular, clockwise sense. The K2O and CaO values of dated samples exhibit well-defined temporal trends, decreasing and increasing, respectively, with age of eruption. Divided into two groups by K2O, the centers of these two distributions define a northward migration rate similar to that determined from eruptive age groups. This age and compositional migration rate of Boring volcanism is similar to the clockwise rotation rate of the Oregon Coast Range with respect to North America, and might reflect localized extension on the trailing edge of that rotating crustal block.

  13. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Science.gov (United States)

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.

  14. High-Resolution Imaging of Asteroids/Satellites with AO

    Science.gov (United States)

    Merline, William

    2012-02-01

    We propose to make high-resolution observations of asteroids using AO, to measure size, shape, and pole position (spin vectors), and/or to search for satellites. We have demonstrated that AO imaging allows determination of the pole/dimensions in 1 or 2 nights on a single target, rather than the years of observations with lightcurve inversion techniques that only yield poles and axial ratios, not true dimensions. Our new technique (KOALA) combines AO imaging with lightcurve and occultation data for optimum size/shape determinations. We request that LGS be available for faint targets, but using NGS AO, we will measure several large and intermediate asteroids that are favorably placed in spring/summer of 2012 for size/shape/pole. Accurately determining the volume from the often-irregular shape allows us to derive densities to much greater precision in cases where the mass is known, e.g., from the presence of a satellite. We will search several d! ozen asteroids for the presence of satellites, particularly in under-studied populations, particularly NEOs (we have recently achieved the first-ever optical image of an NEO binary [Merline et al. 2008b, IAUC 8977]). Satellites provide a real-life lab for testing collisional models. We will search for satellites around special objects at the request of lightcurve observers, and we will make a search for debris in the vicinity of Pluto, in support of the New Horizons mission. Our shape/size work requires observations over most of a full rotation period (typically several hours).

  15. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    Directory of Open Access Journals (Sweden)

    Cenir Gonçalves Tier

    2008-06-01

    Full Text Available Instituições de Longa Permanência para Idosos (ILPI são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar Morin. Primeiro, se reflete sobre a complexidade; depois, se relaciona o cuidado ao idoso deprimido e residente em ILPI, com os princípios dialógico, recursivo e hologramático. Percebeu-se que a Complexidade pode sustentar teoricamente, não só a compreensão do fenômeno depressão no idoso residente em uma ILPI, como também inspirar o modo de cuidar que direcione aos trabalhadores da saúde, que atuam junto à pessoa idosa, a abordarem o idoso de forma mais global. Para tanto deve ser utilizada a Avaliação Multidimensional do Idoso, que analisa as várias dimensões da pessoa idosa, contribuindo no desenvolvimento de um plano de cuidado/tratamento e acompanhamento multidisciplinar e interdisciplinar adequados. A Complexidade vem sendo utilizada, por enfermeiros, para entender melhor a enfermagem e prestar cuidado mais adequado ao ser humano.

  16. LDEF results for polymer-matrix composite experiment AO 180

    International Nuclear Information System (INIS)

    This report represents a summary of the results obtained to-date on a polymer matrix composite experiment (AO 180) located at station D-12, about 82 deg off the 'ram' direction. Different material systems comprised of graphite, boron, and aramid (Kevlar) fiber reinforcements were studied. Although previous results were presented on in-situ thermal-vacuum cycling effects, particularly dimensional changes associated with outgassing, additional comparative data will be shown from ground-based tests on control and flight samples. The system employed was fully automated for thermal-vacuum cycling using a laser interferometer for monitoring displacements. Erosion of all three classes of materials due to atomic oxygen (AO) will also be discussed, including angle of incidence effects. Data from this experiment will be compared to published results for similar materials in other LDEF experiments. Composite materials' erosion yields will be presented on an AO design nomogram useful for estimating total material loss for given exposure conditions in low Earth orbit (LEO). Optical properties of these materials will also be compared with control samples. A survey of the damage caused by micrometeoroids/debris impacts will be addressed as they relate to polymer matrix composites. Correlations between hole size and damage pattern will be given. Reference to a new nomogram for estimating the number distribution of micrometeoroid/debris impacts for a given space structure as a function of time in LEO will be addressed based on LDEF data

  17. Simulations of (MC)AO for a 100-m telescope

    Science.gov (United States)

    Le Louarn, Miska; Verinaud, Christophe; Yaitskova, Natalia; Korkiakoski, Visa; Fedrigo, Enrico; Hubin, Norbert N.

    2004-10-01

    In this paper, we summarize the analysis made on various Adaptive Optics (AO) modes (including Shack-Hartmann (SH) and Pyramid Wavefront Sensors (PWS)) for the OverWhelmingly Large telescope (OWL). We will show some early results of the performance to be expected with a first generation AO system, working in the infrared. Several telescope diameters were considered to see the variations as a function of telescope diameter. This is also compatible with the concept of "grow a telescope" where the telescope diameter of OWL grows from 60m to 100m as a function of time. In a first phase, to simplify the problem, the effects of the central obstruction were neglected. However, for the Shack-Hartmann (SH) simulations, additional simulations were carried out with a simulated OWL pupil, including segmentation errors. We show some early results for a ground-layer correction system, working with three natural guide stars (NGSs) and a single deformable mirror (DM). An MCAO system based on 2 DMs, 3 NGSs is also investigated. For the last two systems, our results are found to be in very good agreement with Cibola, an analytical AO modeling tool. We show that some outer scale of turbulence effects improve slightly the correction quality when going from a telescope diameter of 10m to 100m.

  18. Resposta ao estresse: I. Homeostase e teoria da alostase

    Directory of Open Access Journals (Sweden)

    Maria Bernardete Cordeiro de Sousa

    2015-03-01

    Full Text Available ResumoOs seres vivos desenvolvem ao longo de sua história evolutiva mecanismos de enfrentamento às condições adversas originadas tanto no ambiente geofísico como no ambiente social. Esta resposta adaptativa é coordenada e envolve diferentes sistemas funcionais, particularmente, os sistemas nervoso, endócrino e imune, e é denominada de resposta ao estresse e deve atender a duas demandas principais da vida: sobrevivência e reprodução. Esta revisão tem o objetivo de discutir o emprego do conceito clássico de homeostase e um conceito alternativo, alostase, que inclui os mecanismos preditivos e reativos de regulação, assim como os diferentes níveis de impacto dos estressores crônicos, resultando em sobrecarga alostática que pode ou não se seguir de falha alostática. Os mecanismos neurais, hormonais, imunes, sistêmicos e moleculares, que compreendem os sistemas alóstaticos subjacentes à resposta ao estresse são também apresentados.

  19. Development of a Low-Level Ar-37 Calibration Standard

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Richard M.; Aalseth, Craig E.; Bowyer, Ted W.; Day, Anthony R.; Fuller, Erin S.; Haas, Derek A.; Hayes, James C.; Hoppe, Eric W.; Humble, Paul H.; Keillor, Martin E.; LaFerriere, Brian D.; Mace, Emily K.; McIntyre, Justin I.; Miley, Harry S.; Myers, Allan W.; Orrell, John L.; Overman, Cory T.; Panisko, Mark E.; Seifert, Allen

    2016-03-07

    Argon-37 is an important environmental signature of an underground nuclear explosion. Producing and quantifying low-level 37Ar standards is an important step in the development of sensitive field measurement instruments for use during an On-Site Inspection, a key provision of the Comprehensive Nuclear-Test-Ban Treaty. This paper describes progress at Pacific Northwest National Laboratory (PNNL) in the development of a process to generate and quantify low-level 37Ar standard material, which can then be used to calibrate sensitive field systems at activities consistent with soil background levels. The 37Ar used for our work was generated using a laboratory-scale, high-energy neutron source to irradiate powdered samples of calcium carbonate. Small aliquots of 37Ar were then extracted from the head space of the irradiated samples. The specific activity of the head space samples, mixed with P10 (90% stable argon:10% methane by mole fraction) count gas, is then derived using the accepted Length-Compensated Internal-Source Proportional Counting method. Due to the low activity of the samples, a set of three Ultra-Low Background Proportional-Counters designed and fabricated at PNNL from radio-pure electroformed copper was used to make the measurements in PNNL’s shallow underground counting laboratory. Very low background levels (<10 counts/day) have been observed in the spectral region near the 37Ar emission feature at 2.8 keV. Two separate samples from the same irradiation were measured. The first sample was counted for 12 days beginning 28 days after irradiation, the second sample was counted for 24 days beginning 70 days after irradiation (the half-life of 37Ar is 35.0 days). Both sets of measurements were analyzed and yielded very similar results for the starting activity (~0.1 Bq) and activity concentration (0.15 mBq/ccSTP argon) after P10 count gas was added. A detailed uncertainty model was developed based on the ISO Guide to the Expression of Uncertainty in

  20. Pneumonia lipoide secundária ao uso prolongado de óleo de prímula Lipoid pneumonia secondary to long-term use of evening primrose oil

    Directory of Open Access Journals (Sweden)

    Marcelo Fouad Rabahi

    2010-10-01

    Full Text Available A pneumonia lipoide é uma doença pouco diagnosticada, causada pela aspiração de partículas oleosas para dentro dos pulmões. Os casos relatados têm sido relacionados ao uso de óleo mineral como laxativo, mas outras soluções oleosas também podem causar a doença. Relatamos o caso de uma paciente de 50 anos com queixa de tosse produtiva, sendo diagnosticada inicialmente com hiper-reatividade brônquica e doença do refluxo gastroesofágico (DRGE. A paciente foi submetida a tratamento para DRGE. Devido à persistência da tosse, a paciente foi submetida a TC de tórax, fibrobroncoscopia e biópsia pulmonar a céu aberto, sendo diagnosticada com pneumonia lipoide. A paciente foi questionada quanto ao uso de substâncias oleosas, relatando o uso crônico de óleo de prímula. Com a suspensão do uso da substância e a continuidade do tratamento para DRGE, houve melhora do quadro.Lipoid pneumonia is an underdiagnosed disease that is caused by the aspiration of lipid particles into the lungs. Although most of the reported cases have been associated with the use of mineral oil as a laxative, other lipid substances can also cause the disease. We report the case of a 50-year-old female patient with a complaint of productive cough who was initially diagnosed with bronchial hyperresponsiveness and gastroesophageal reflux disease (GERD. The patient was treated for GERD. Because the productive cough persisted, the patient underwent chest CT, fiberoptic bronchoscopy, and open lung biopsy. She was diagnosed with lipoid pneumonia. The patient was questioned regarding the use of lipid substances, and she reported the chronic use of evening primrose oil. After the discontinuation of the substance and the maintenance of GERD treatment, her condition improved.

  1. Fatores associados a baixa adesao ao tratamento medicamentoso em idosos

    Directory of Open Access Journals (Sweden)

    Noemia Urruth Leao Tavares

    2013-12-01

    Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.

  2. Estudo exploratorio da qualidade do ar em escolas de educacao basica, Coimbra, Portugal

    Directory of Open Access Journals (Sweden)

    Ana Maria Conceicao Ferreira

    2013-12-01

    Full Text Available OBJETIVO : Analisar a qualidade do ar em escolas de educação básica e suas condições estruturais e funcionais. MÉTODOS : Foi avaliada a qualidade do ar de 51 escolas (81 salas de aula de educação básica da cidade de Coimbra, Portugal, tanto na parte interior das salas como na exterior, durante as quatro estações do ano, de 2010 a 2011. Foram avaliadas a temperatura (Tº, umidade relativa (Hr, concentrações de monóxido de carbono (CO, dióxido de carbono (CO 2 , ozona (O 3 , dióxido de nitrogênio (NO 2 , dióxido de enxofre (SO 2 , compostos orgânicos voláteis (COV, formaldeído e material particulado (PM 10 , de novembro de 2010 a fevereiro de 2011 (outono/inverno e de março de 2011 a junho de 2011 (primavera/verão. Procedeu-se ao preenchimento de uma grelha de caracterização das condições estruturais e funcionais das escolas. Aplicaram-se os testes estatísticos t- Student para amostras emparelhadas e o teste t de Wilcoxon. RESULTADOS : Em 47 escolas, as concentrações médias de CO 2 encontravam-se acima da concentração máxima de referência (984 ppm mencionada na legislação portuguesa. Os valores máximos de concentração encontrados no interior das salas foram críticos, principalmente no outono/inverno (5.320 ppm. As concentrações médias de COV e de PM 10 no interior ultrapassaram a concentração máxima de referência legislada em algumas escolas. Não foram detetados valores relevantes (risco de CO, formaldeído, NO 2 , SO 2 e O 3 . CONCLUSÕES : Houve maior concentração de poluentes no interior das salas, comparativamente com o exterior. A inadequada ventilação está associada à elevada concentração de CO 2 nas salas de aula.

  3. Ryoji Ikeda, Data Artist - Prix Ars Electronica Collide@CERN

    CERN Document Server

    CERN. Geneva; Koek, Ariane; Heuer, Rolf; Ikeda, Ryoji; Mr. Horst, Hoertner

    2014-01-01

    at the CERN Globe of Science and Innovation, CERN. You are very warmly invited to the opening presentation of Data Artist, Ryoji Ikeda’s residency at CERN. Ryoji Ikeda, one of the world’s leading electronic composers and visual artists, is the new Prix Ars Electronica Collide@CERN award winner. Ryoji Ikeda and his science inspiration partner, Theoretical Physicist, Dr. Tom Melia will talk about their work in arts and science. They are at the beginning of their creative journey together at CERN. A little about Ryoji Ikeda – the new Prix Ars Electronica Collide@CERN artist in residence. Ryoji Ikeda focuses on the essential characteristics of sound itself and that of visuals as light by means of both mathematical precision and mathematical aesthetics. Ikeda has gained a reputation as one of the few international artists working convincingly across both visual ...

  4. Progreso y retos de la geocronología 40Ar/39Ar en Costa Rica y Nicaragua Progress and Challenges Using 40Ar/39Ar Geochronology in Costa Rica and Nicaragua

    Directory of Open Access Journals (Sweden)

    Ian Saginor¹

    2011-12-01

    Full Text Available Con el principal objetivo de realizar mejores cálculos de la producción volcánica, en el Arco Volcánico de América Central, realizamos 61 dataciones 40Ar/39Ar en tefras y lavas en localidades de frente volcánico de Costa Rica y Nicaragua por medio de varias campañas de campo y análisis de laboratorio (preparación de muestras, envió al reactor nuclear, espectroscopía de masas de las muestras radiactivas, al laboratorio de gases nobles del Departamento de Ciencias de la Tierra y Planetarias de la Universidad Rutgers del 2002-2008. En este artículo presentamos diferentes observaciones que resultaron de este estudio donde se describe la precisión, exactitud y la confiabilidad de las edades 40Ar/39Ar. El primer resultado muestra las limitaciones de esta técnica en muestras baja en K2O con edades To better estimate the extrusive flux of the Central American Arc, from 2002-2008, we obtained sixty one high precision 40Ar/39Ar ages on geographically well-situated lavas and tephra from Costa Rica and Nicaragua. Here, we describe a number of observations encountered during this study using four examples that well document the precision, accuracy and general reliability of the 40Ar/39Ar ages. First, low K2O values, particularly in samples from Nicaragua, is a major limitation in or attempts to obtain reliable dates on samples under 1 My. Second, extensive weathering of samples due to the tropical climate of Central America has resulted in various levels of argon loss even when the hand sample appeared unaltered. Third, our field and geochronological data lead us to conclude that eruptive rates have not been constant over the past 15 to 20 My, but rather appears punctuated by gaps of up to several million years. We attempted to address the temporal gaps in several ways. First, geochemical analyses were used to identify samples that may have erupted during time periods without known volcanism. For example, U/Th values in the active Central

  5. Medidas da umidade relativa do ar em um ambiente fechado

    Directory of Open Access Journals (Sweden)

    Costa Eden V.

    2003-01-01

    Full Text Available Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de preencher a lacuna dos livros de texto de física, que, em geral, negligenciam este tópico.

  6. Simulation of Carbon Nanotube Welding through Ar bombardment

    CERN Document Server

    Kucukkal, Mustafa U

    2014-01-01

    Single-walled carbon nanotubes show promise as nanoscale transistors, for nanocomputing applications. This use will require appropriate methods for creating electrical connections between distinct nanotubes, analogous to welding of metallic wires at larger length scales, but methods for performing nanoscale chemical welding are not yet sufficiently understood. This study examined the effect of Ar bombardment on the junction of two crossed single-walled carbon nanotubes, to understand the value and limitations of this method for generating connections between nanotubes. A geometric criterion was used to assess the quality of the junctions formed, with the goal of identifying the most productive conditions for experimental ion bombardment. In particular, the effects of nanotube chirality, Ar impact kinetic energy, impact particle flux and fluence, and annealing temperature were considered. The most productive bombardment conditions, leading to the most crosslinking of the tubes with the smallest loss of graphit...

  7. Constraining the alteration history of a Late Cretaceous Patagonian volcaniclastic bentonite-ash-mudstone sequence using K-Ar and 40Ar/39Ar isotopes

    Science.gov (United States)

    Warr, L. N.; Hofmann, H.; van der Pluijm, B. A.

    2016-03-01

    Smectite is typically considered unsuitable for radiometric dating, as argon (40Ar) produced from decay of exchangeable potassium (40K) located in the interlayer sites can be lost during fluid-rock interaction and/or during wet sample preparation in the laboratory. However, age analysis of Late Cretaceous Argentinian bentonites and associated volcaniclastic rocks from Lago Pellegrini, Northern Patagonia, indicates that, in the case of these very low-permeability rocks, the radioactive 40Ar was retained and thus can provide information on smectite age and the timing of rock alteration. This study presents isotopic results that indicate the ash-to-bentonite conversion and alteration of the overlying tuffaceous mudstones in Northern Patagonia was complete ~13-17 my after middle Campanian sedimentation when the system isotopically closed. The general absence of illite in these smectite-rich lithologies reflects the low activity of K and the low temperature (<60 °C) of the formation waters that altered the parent ash.

  8. Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem

    Directory of Open Access Journals (Sweden)

    Edilene Aparecida Araújo da Silveira

    2011-06-01

    Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.

  9. arXiv in the classical Russian literature

    CERN Document Server

    Silagadze, Z K

    2012-01-01

    The creation of arXiv, a highly democratic open access repository of research papers in high-energy physics more than twenty years ago was undoubtedly the most spectacular and landmark event for the high-energy physics community. However, we report a curious observation which indicates that the general cultural significance of this event extends far beyond the boundaries assumed at the beginning.

  10. BUSINESS ETHICS: THE CASE OF AR CONSULTORIA LTD A

    Directory of Open Access Journals (Sweden)

    Fernando Fantoni Bencke

    2014-03-01

    business: the significant taxes, lack of incentives and credit available and the opportunity to “make a little extra” through informal sales. AR Consultoria’s entry to the market was marked by these and other difficulties. This case aims at presenting a real situation that can be found in some organizational sectors areas, which demands readers to take a decision and an ethical stance when faced with moral challenges.

  11. AR-based Method for ECG Classification and Patient Recognition

    OpenAIRE

    Branislav Vuksanovic; Mustafa Alhamdi

    2013-01-01

    The electrocardiogram (ECG) is the recording of heart activity obtained by measuring the signals from electrical contacts placed on the skin of the patient. By analyzing ECG, it is possible to detect the rate and consistency of heartbeats and identify possible irregularities in heart operation. This paper describes a set of techniques employed to pre-process the ECG signals and extract a set of features – autoregressive (AR) signal parameters used to characterise ECG signal. Extracted paramet...

  12. AR-based Method for ECG Classification and Patient Recognition

    Directory of Open Access Journals (Sweden)

    Branislav Vuksanovic

    2013-09-01

    Full Text Available The electrocardiogram (ECG is the recording of heart activity obtained by measuring the signals from electrical contacts placed on the skin of the patient. By analyzing ECG, it is possible to detect the rate and consistency of heartbeats and identify possible irregularities in heart operation. This paper describes a set of techniques employed to pre-process the ECG signals and extract a set of features – autoregressive (AR signal parameters used to characterise ECG signal. Extracted parameters are in this work used to accomplish two tasks. Firstly, AR features belonging to each ECG signal are classified in groups corresponding to three different heart conditions – normal, arrhythmia and ventricular arrhythmia. Obtained classification results indicate accurate, zero-error classification of patients according to their heart condition using the proposed method. Sets of extracted AR coefficients are then extended by adding an additional parameter – power of AR modelling error and a suitability of developed technique for individual patient identification is investigated. Individual feature sets for each group of detected QRS sections are classified in p clusters where p represents the number of patients in each group. Developed system has been tested using ECG signals available in MIT/BIH and Politecnico of Milano VCG/ECG database. Achieved recognition rates indicate that patient identification using ECG signals could be considered as a possible approach in some applications using the system developed in this work. Pre-processing stages, applied parameter extraction techniques and some intermediate and final classification results are described and presented in this paper.

  13. Assalto ao Estado e ao mercado, neoliberalismo e teoria econômica Assault on the State and on the market: Neoliberalism and economic theory

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Bresser-Pereira

    2009-01-01

    Full Text Available O Estado e o mercado são instituições complementares. O Estado é a instituição principal que coordena as sociedades modernas; é o sistema constitucional e a organização que o garante; é o principal instrumento por meio do qual as sociedades democráticas estão moldando o capitalismo de modo a alcançar seus próprios objetivos políticos. Os mercados são instituições baseadas na competição regulada pelo Estado para que contribuam com a coordenação da economia. Enquanto o liberalismo emergiu no século XVIII para combater o Estado autocrático, desde os anos 1980 o neoliberalismo (uma distorção maior do liberalismo econômico tornou-se dominante e montou um assalto ao Estado em nome do mercado, mas eventualmente também atacou o mercado. A macroeconomia neoclássica e a teoria da escolha pública foram as metaideologias que deram a esse assalto um apelo "científico" e matemático.State and market are complementary institutions. The state is the major institution coordinating modern societies; it is the constitutional system and the organizations guaranteeing it; it is the main instrument through which democratic societies have been changing capitalism so as to achieve their own agreed political objectives. Markets are institutions based on competition which the state regulates so that they contribute to the coordination of the economy. While liberalism emerged in the 18th century to fight an autocratic state, since the 1980s neoliberalism (a major distortion of economic liberalism became dominant and mounted a political assault to the state in the name of the market, but eventually also attacked the market. Neoclassical macroeconomics and public choice theory were the meta-ideologies that gave to this assault a "scientific" and mathematical allure.

  14. Transfer ionization of the isocharge sequence ion and Ar collisions

    Institute of Scientific and Technical Information of China (English)

    Cai Xiao-Hong; Yu De-Yang; Cao Zhu-Rong; Lu Rong-Chun; Yang Wei; Shao Cao-Jie; Chen Xi-Meng

    2004-01-01

    The ratios of transfer ionization to single capture for isocharge Cq+, Nq+, Oq+, Neq+ ions on Ar atoms are measured by using position-sensitive and time-of-flight techniques. It is found that the ratio R1 increases with nuclear charge Z in a q=4 sequence, and the ratio R1 sequences have the minimum values at Z=7 and Z=8 in q=5 and q=6 sequences, respectively, and the ratio R1 decreases with the increase in the nuclear charge Z in a q=7 sequence. The results may be explained within the frame of the statistical model. It may be concluded that the transfer ionization depends remarkably upon the electronic structure of the projectile. The projectiles used in this study have the same charge state and velocity, but different electronic structures. The dependence of the ratio R1 on q is studied for Neq+-Ar collisions. The ratio R1 is found to increase as q increases for Neq+-Ar collisions. The measured dependence of the ratio R1 on q is compared with the calculation using the molecular Coulomb over-barrier model.

  15. Electrical properties and dielectric spectroscopy of Ar+ implanted polycarbonate

    Science.gov (United States)

    Chawla, Mahak; Shekhawat, Nidhi; Aggarwal, Sanjeev; Sharma, Annu; Nair, K. G. M.

    2015-05-01

    The aim of the present paper is to study the effect of argon ion implantation on electrical and dielectric properties of polycarbonate. Specimens were implanted with 130 keV Ar+ ions in the fluence ranging from 1×1014 to 1×1016 ions cm-2. The beam current used was ˜0.40 µA cm-2. The electrical conduction behaviour of virgin and Ar+ implanted polycarbonate specimens have been studied through current-voltage (I-V characteristic) measurements. It has been observed that after implantation conductivity increases with increasing ion fluence. The dielectric spectroscopy of these specimens has been done in the frequency range of 100 kHz-100 MHz. Relaxation processes were studied by Cole-Cole plot of complex permittivity (real part of complex permittivity, ɛ' vs. imaginary part of complex permittivity, ɛ″). The Cole-Cole plots have also been used to determine static dielectric constant (ɛs), optical dielectric constant (ɛ∞), spreading factor (α), average relaxation time (τ0) and molecular relaxation time (τ). The dielectric behaviour has been found to be significantly affected due to Ar+ implantation. The possible correlation between this behaviour and the changes induced by the implantation has been discussed.

  16. Atomic data and spectral line intensities for Ar XIII

    International Nuclear Information System (INIS)

    The energy levels, oscillator strengths, spontaneous radiative decay rates, and electron impact collision strengths are calculated for Ar XIII using the recently developed Flexible Atomic Code (FAC). These data pertain to the 224 levels belonging to the following configurations: 2s22p2, 2s2p3, 2p4, 2s22p3l, 2s2p23l, 2s22p4l (l = s, p, d, f), 2s22p5s, 2s22p5p, and 2s22p5d. Effective collision strengths are obtained at five electron temperatures: log Te (K) = 5.0, 5.5, 6.0, 6.5, and 7.0 by integrating the collision strengths over a Maxwellian electron distribution. These atomic data are generated to support the interpretation of astrophysical objects as well as fusion plasmas, which frequently contain emission lines from Ar XIII. This work supplements previous work published by Bhatia by extending the calculation of effective collision strengths and radiative decay rates to n = 5 configurations. Level populations and spectral line intensities are obtained by solving the rate equations of the 224 energy levels at densities of 108, 109, 1010, 1011, and 1012 cm-3 and a temperature of 2.51 x 106 K. This temperature is typical for Ar XIII when formed at equilibrium by collisional ionization and recombination

  17. Microclima e produção da uva de mesa 'Niagara Rosada' conduzida em espaldeira a céu aberto e em manjedoura na forma de "Y" sob cobertura de telado plástico

    Directory of Open Access Journals (Sweden)

    Mário José Pedro Júnior

    2011-10-01

    Full Text Available Foi desenvolvido um experimento em vinhedos de 'Niagara Rosada', conduzidos em espaldeira e em manjedoura na forma de Y com cobertura de telado plástico, visando a comparar as alterações microclimáticas induzidas pelo sistema de condução e uso de telado plástico, e o efeito na produtividade das videiras. Entre os parâmetros microclimáticos avaliados, apenas a radiação solar foi atenuada pelo telado plástico em cerca de 20%, acima do dossel, tendo sido transmitido para a altura do cacho, cerca de 41% da radiação solar no sistema em Y sob telado plástico e 21% no espaldeira. As temperaturas máximas e mínimas foram semelhantes em ambos os sistemas. A produção por planta e a massa dos cachos foram mais elevadas no sistema em Y sob telado plástico, em comparação ao espaldeira.

  18. Drosophila ARSs contain the yeast ARS consensus sequence and a replication enhancer.

    OpenAIRE

    Mills, J S; Kingsman, A J; Kingsman, S M

    1986-01-01

    A number of restriction fragments that function as autonomously replicating sequences (ARSs) in yeast have been isolated from Drosophila melanogaster DNA. The behaviour in yeast of plasmids containing Drosophila ARS elements was studied and compared to that exhibited by the archetypal yeast ARS-1 plasmid. ARS functions were localised by subcloning and BAL-31 deletion analysis. These studies demonstrated the structural and functional complexity of Drosophila ARSs. Each Drosophila ARS element h...

  19. A comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas for dry etching applications

    International Nuclear Information System (INIS)

    The effect of the O2/Ar mixing ratio in CF4/O2/Ar and C4F8/O2/Ar inductively coupled plasmas with a 50% fluorocarbon gas content on plasma parameters and active species densities, which influence dry etching mechanisms, was analyzed. The investigation combined plasma diagnostics using Langmuir probes and zero-dimensional plasma modeling. It was found that, in both gas systems, the substitution of Ar for O2 results in a similar change in the ion energy flux but causes the opposite behavior for the F atom flux. The mechanisms of these phenomena are discussed with regards to plasma chemistry. - Highlights: • The goal was to conduct a comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas. • The focus was on the parameters directly influencing dry etching mechanisms. • Model-based analysis for neutral species was used in this paper

  20. Quantificação em escala de bancada do volume de ar em ligações prediais de água Measuring air volume in household pipes by means of a pilot scale study

    Directory of Open Access Journals (Sweden)

    Ney Procópio Lopes

    2011-12-01

    Full Text Available A presente pesquisa em escala piloto, simulando trecho de uma rede interligada a um ramal predial, visou quantificar o volume de ar aferido pelos hidrômetros residenciais. Para tal fim, testaram-se ventosas, bloqueadores de ar e válvulas eliminadoras de ar. Sob condições normais de operação da rede, o volume de ar medido pelos hidrômetros é comparável ao encontrado na água natural, não justificando a instalação de equipamento de eliminação de ar de qualquer natureza. Todavia, logo após esvaziamento da rede interligada ao ramal, a sobremedição pode atingir até 21% em condições de pressão máxima na rede de distribuição (500 kPa. Por fim, verificou-se que a menor vazão afluente associa-se ao maior volume de ar aferido pelo hidrômetro. Dessa forma, é possível supor que os consumidores situados na menor faixa de consumo sejam os mais prejudicados pela situação de desabastecimento.The purpose of the present work is to evaluate the volume of air measured in domestic water supply pipe connections. Tests were performed to evaluate the efficiency and applicability of air reducing valves in domestic water supply connections. The results obtained under regular water supply conditions showed that the volume of air in the water measured by the hydrometers is comparable to the one found in natural waters. On the other hand, other tests, right after emptying the network connected to the domestic water supply pipe, revealed that the volume of water which gets to the gauged reservoir comprehends up to 21% of the total air-water volume recorded by the hydrometer for the experiments performed under pressure of 500 kPa.

  1. Chromosomal context and replication properties of ARS plasmids in Schizosaccharomyces pombe

    Indian Academy of Sciences (India)

    Aditya S Pratihar; Vishnu P Tripathi; Mukesh P Yadav; Dharani D Dubey

    2015-12-01

    Short, specific DNA sequences called as Autonomously Replicating Sequence (ARS) elements function as plasmid as well as chromosomal replication origins in yeasts. As compared to ARSs, different chromosomal origins vary greatly in their efficiency and timing of replication probably due to their wider chromosomal context. The two Schizosaccharomyces pombe ARS elements, ars727 and ars2OO4, represent two extremities in their chromosomal origin activity - ars727 is inactive and late replicating, while ars2OO4 is a highly active, early-firing origin. To determine the effect of chromosomal context on the activity of these ARS elements, we have cloned them with their extended chromosomal context as well as in the context of each other in both orientations and analysed their replication efficiency by ARS and plasmid stability assays. We found that these ARS elements retain their origin activity in their extended/altered context. However, deletion of a 133-bp region of the previously reported ars727-associated late replication enforcing element (LRE) caused advancement in replication timing of the resulting plasmid. These results confirm the role of LRE in directing plasmid replication timing and suggest that the plasmid origin efficiency of ars2OO4 or ars727 remains unaltered by the extended chromosomal context.

  2. Bartlett correction in the stable AR(1) model with intercept and trend

    NARCIS (Netherlands)

    N.P.A. van Giersbergen

    2009-01-01

    Bartlett corrections are derived for testing hypotheses about the autoregressive parameter ρ in the stable (a) AR(1) model, (b) AR(1) model with intercept, (c) AR(1) model with intercept and linear trend. The correction is found explicitly as a function of ρ. In the models with deterministic terms,

  3. File list: Oth.ALL.20.AR.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.AR.AllCell hg19 TFs and others AR All cell types SRX595676,SRX595671,SRX...736053,SRX502068,SRX092448,SRX092447,SRX861678,SRX147604,SRX1033268 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.ALL.20.AR.AllCell.bed ...

  4. File list: Oth.Brs.05.AR.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Brs.05.AR.AllCell hg19 TFs and others AR Breast SRX1339020,SRX1339018,SRX250092...,SRX1339019,SRX1339016,SRX1339017,SRX1339015 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Brs.05.AR.AllCell.bed ...

  5. Repression of Runx2 by Androgen Receptor (AR) in Osteoblasts and Prostate Cancer Cells: AR Binds Runx2 and Abrogates Its Recruitment to DNA

    OpenAIRE

    Baniwal, Sanjeev K.; Khalid, Omar; Sir, Donna; Buchanan, Grant; Coetzee, Gerhard A.; Frenkel, Baruch

    2009-01-01

    Runx2 and androgen receptor (AR) are master transcription factors with pivotal roles in bone metabolism and prostate cancer (PCa). We dissected AR-mediated repression of Runx2 in dihydrotestosterone (DHT)-treated osteoblastic and PCa cells using reporter assays and endogenous Runx2 target genes. Repression required DHT, but not AR’s transactivation function, and was associated with nuclear colocalization of the two proteins. Runx2 and AR coimmunoprecipitated and interacted directly in glutath...

  6. Timing of gold mineralisation in the Ballarat goldfields, central Victoria: constraints from 40Ar/39Ar results

    International Nuclear Information System (INIS)

    40Ar/39Ar data for muscovite separates and hydrothermally altered whole-rock samples from the Ballarat West and the Ballarat East goldfields indicate that mesothermal gold mineralisation at Ballarat occurred during several episodic pulses, ranging in age from the Late Ordovician to the Early Devonian, initial formation of auriferous structures in the Ballarat goldfields coincided with folding and thrusting associated with the development of the western Lachlan Fold Belt between 460 and 440 Ma. Subsequent fault reactivation and magmatism resulted in remobilisation and additional mineralisation between 410 and 380 Ma, and around 370 Ma. The results presented herein are in agreement with findings for other major gold deposits in central Victoria and further constrain the history of deformation, metamorphism and mineralisation in the western subprovince of the Lachlan Fold Belt. Copyright (1999) Geological Society of Australia

  7. Emplacement of Amba Dongar Carbonatite-alkaline Complex at Cretaceous/Tertiary Boundary: Evidence from 40Ar-39Ar Chronology

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande; T R Venkatesan

    2000-03-01

    40Ar-39Ar analyses of three fresh alkaline rock samples and a phlogopite separate from a carbonatite from Amba Dongar carbonatite-alkaline complex of the Deccan Flood Basalt Province, India, yield indistinguishable precise plateau ages of 64.8 ± 0.6, 64.7 ± 0.5, 65.5 ± 0.8 and 65.3 ± 0.6 Ma, giving a mean plateau age of 65.0 ± 0.3 Ma, which is the age of emplacement of this complex. This age implies contemporaneity of Amba Dongar with several other carbonatite-alkaline activities of Chhota Udaipur subprovince and is consistent with their Reunion-Deccan plume origin hypothesis. The emplacement of these complexes at 65 Ma makes them very significant in the ongoing debate on the K/T extinctions owing to their capacity to rapidly inject a substantial amount of CO2 and SO2 into the atmosphere.

  8. 40Ar/39Ar Dating of Zn-Pb-Ag Mineralization in the Northern Brooks Range, Alaska

    Science.gov (United States)

    Werdon, Melanie B.; Layer, Paul W.; Newberry, Rainer J.

    2004-01-01

    The 40Ar/39Ar laser step-heating method potentially can be used to provide absolute ages for a number of formerly undatable, low-temperature ore deposits. This study demonstrates the use of this method by determining absolute ages for Zn-Pb-Ag sediment-hosted massive sulfide deposits and vein-breccia occurrences found throughout a 300-km-long, east-west-trending belt in the northern Brooks Range, Alaska. Massive sulfide deposits are hosted by Mississippian to Pennsylvanian(?) black carbonaceous shale, siliceous mudstone, and lesser chert and carbonate turbidites of the Kuna Formation (e.g., Red Dog, Anarraaq, Lik (Su), and Drenchwater). The vein-breccia occurrences (e.g., Husky, Story Creek, West Kivliktort Mountain, Vidlee, and Kady) are hosted by a deformed but only weakly metamorphosed package of Upper Devonian to Lower Mississippian mixed continental and marine clastic rocks (the Endicott Group) that stratigraphically underlie the Kuna Formation. The vein-breccias are mineralogically similar to, but not spatially associated with, known massive sulfide deposits. The region's largest shale-hosted massive sulfide deposit is Red Dog; it has reserves of 148 Mt grading 16.6 percent zinc, 4.5 percent lead, and 77 g of silver per tonne. Hydrothermally produced white mica in a whole-rock sample from a sulfide-bearing igneous sill within the Red Dog deposit yielded a plateau age of 314.5 Ma. The plateau age of this whole-rock sample records the time at which temperatures cooled below the argon closure temperature of the white mica and is interpreted to represent the minimum age limit for massive sulfide-related hydrothermal activity in the Red Dog deposit. Sulfide-bearing quartz veins at Drenchwater crosscut a hypabyssal intrusion with a maximum biotite age of 337.0 Ma. Despite relatively low sulfide deposition temperatures in the vein-breccia occurrences (162°-251°C), detrital white mica in sandstone immediately adjacent to large vein-breccia zones was partially to

  9. Charge-exchange, ionization and excitation in low-energy Li$^{+}-$ Ar, K$^{+}-$ Ar, and Na$^{+}-$He collisions

    CERN Document Server

    Lomsadze, Ramaz A; Kezerashvili, RomanYa; Schulz, Michael

    2016-01-01

    Absolute cross sections are measured for charge-exchange, ionization, and excitation within the same experimental setup for the Li$^{+}-$Ar, K$^{+}-$ Ar, and Na$^{+}-$ He collisions in the ion energy range $0.5-10$ keV. Results of our measurements along with existing experimental data and the schematic correlation diagrams are used to analyze and determine the mechanisms for these processes. The experimental results show that the charge-exchange processes are realized with high probabilities and electrons are predominately captured in ground states. The cross section ratio for charge exchange, ionization and excitation processes roughly attains the value $10:2:1$, respectively. The contributions of various partial inelastic channels to the total ionization cross sections are estimated and a primary mechanism for the process is defined. The energy-loss spectrum, in addition, is applied to estimate the relative contribution of different inelastic channels and to determine the mechanisms for the ionization and f...

  10. Empirical Likelihood Inference for AR(p) Model%AR(p)模型的经验似然推断

    Institute of Scientific and Technical Information of China (English)

    陈燕红; 赵世舜; 宋立新

    2008-01-01

    In this article we study the empirical likelihood inference for AR(p) model.We propose the moment restrictions, by which we get the empirical likelihood estimator of the model parametric, and we also propose an empirical log-likelihood ratio base on this estimator.Our result shows that the EL estimator is asymptotically normal, and the empirical log-likelihood ratio is proved to be asymptotically standard chi-squared.

  11. Geochemical and 40Ar/39Ar constraints on the evolution of volcanism in the Woodlark Rift, Papua New Guinea

    Science.gov (United States)

    Catalano, Joseph P.

    The tectonic mechanisms producing Pliocene to active volcanism in eastern Papua New Guinea (PNG) have been debated for decades. In order to assess mechanisms that produce volcanism in the Woodlark Rift, we evaluate the evolution of volcanism in eastern PNG using 40Ar/39Ar thermochronology and whole rock geochemistry. Active volcanism in southeastern Papua New Guinea occurs on the Papuan Peninsula (Mt. Lamington, Mt. Victory and Waiwa), in the Woodlark Rift (Dobu Island, SE Goodenough Island, and Western Fergusson Island), and in the Woodlark Basin. In the Woodlark Basin, seafloor spreading is active and decompression melting of the upper mantle is producing basaltic magmatism. However, the cause of Pliocene and younger volcanism in the Woodlark Rift is controversial. Two hypotheses for the tectonic setting have been proposed to explain Pliocene and younger volcanism in the Woodlark Rift: (1) southward subduction of Solomon Sea lithosphere beneath eastern PNG at the Trobriand Tough and (2) decompression melting of mantle, previously modified by subduction, as the lithosphere undergoes extension associated with the opening of the Woodlark Basin. A comparison of 40Ar/39Ar ages with high field strength element (HFSE) concentrations in primary magmas indicates that HFSE concentrations correlate with age in the Woodlark rift. These data support the hypothesis that Pliocene to active volcanism in the Woodlark Rise and D'Entrecasteaux Islands results from decompression melting of a relict mantle wedge. The subduction zone geochemical signatures (negative HFSE anomalies) in Woodlark Rift lavas younger than 4 m.y. are a relict from older subduction beneath eastern Papua, likely in the middle Miocene. As the lithosphere is extended ahead of the tip of the westward propagating seafloor spreading center in the Woodlark Basin, the composition of volcanism is inherited from prior arc magmatism (via flux melting) and through time evolves toward magmatism associated with a rifting

  12. Mineralogy and Ar-Ar Age of the Tarahumara IIE Iron, with Reference to the Origin of Alkali-Rich Materials

    Science.gov (United States)

    Takeda, Hiroshi; Bogard, Donald D.; Otsuki, Mayumi; Ishii, Teruaki

    2003-01-01

    Silicate inclusions in nine known IIE irons show diversity in mineralogy, and Colomera, Kodaikanal, Elga and Miles contain alkali-rich silicate inclusions. Bogard et al. showed evidence of a complex parent body evolution for IIE irons based on Ar-39-Ar-40 ages. Colomera contained a sanidine-rich surface inclusion and the K-enrichment trends in the Na-rich inclusions are different from those of other IIEs. To elucidate the origin of K-rich materials, we studied the mineralogy and Ar-Ar age of silicate inclusions from the Tarahumara IIE iron meteorite.

  13. 40Ar/39Ar dating of Quaternary volcanic ashes by multi-collection noble gas mass spectrometry: protocols, precision and intercalibration

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie;

    for single crystal 40Ar/39Ar dating of Quaternary samples because of: (i) improved source sensitivity; (ii) ion-counting electron multipliers, which have low signal to noise ratios enabling precise measurement of very small 36Ar signals - resulting in accurate correction for atmospheric-derived 40Ar; (iii......) higher mass resolution allows hydrocarbon interferences to be pseudo resolved for the different argon isotopes; and (iv) multi-collection, allowing more data to be gathered in a fixed time in comparison with single-collector peak-switching measurements. We evaluate (i) protocols for detector inter...

  14. Oficina de trabalho: "mulher-uma viagem ao seu corpo"

    Directory of Open Access Journals (Sweden)

    Maria Helena Costa Amorim

    1996-06-01

    Full Text Available Nas mulheres brasileiras, a morbidade por câncer de colo uterino e de mama é alta, mesmo que estas patologias sejam preveníveis e diagnosticadas precocemente. A cobertura dos serviços de saúde nesta área é inadequada, considerando-se a tecnologia simples e barata a ser utilizada na prevenção e detecção precoce destes tipos de câncer. Observamos que poucas são as atividades desenvolvidas com o objetivo de educar a mulher quanto ao auto conhecimento do corpo. Dessa forma, em 1993, elaboramos uma Oficina de Trabalho intitulada: " Mulher-uma viagem ao seu corpo", composta de 6 (seis dinâmicas onde a participação de cada mulher é intensa por ser um processo envolvente. A Oficina é desenvolvida por 1 (um docente, 3 (três enfermeiras e acadêmicos de Enfermagem da Universidade Federal do Espírito Santo. São inscritas 30 (trinta participantes por Oficina, sendo que cada uma recebe crachá de participação. Esta oficina é composta de 6 (cinco dinâmicas que se desenvolvem num ambiente descontraído e aconchegante: Dinâmica 1 - História de Bolso; Dinâmica 2 - Toque das Mãos; Dinâmica 3 - Desenho/Modelagem; Dinâmica 4 - Viagem ao Corpo; Dinâmica 5 - O Auto Exame; Dinâmica 6 - Percebendo o corpo.

  15. Integrando a retórica ao game design

    OpenAIRE

    Moroni, Leonardo Mendes

    2013-01-01

    Resumo: O potencial dos jogos eletrônicos como mídia que atinge camadas cada vez mais extensas da população, com reflexos sociais, culturais e econômicos, é evidente. No entanto, jogos que alcançam grande sucesso comercial objetivam, essencialmente, propiciar diversão aos seus usuários. Com base nesta premissa, tanto usuários quanto avaliadores desta mídia acabam por desconsiderar o potencial que os jogos oferecem em termos de veicular mensagens com conteúdo relevante para a vida real, como, ...

  16. Mudança organizacional : do prescrito ao real

    OpenAIRE

    Sinval, Jorge Fernando Pereira

    2011-01-01

    As organizações dos dias de hoje enfrentam um ambiente cada vez mais dinâmico e em constante mudança. Necessitam de adaptar-se aos novos desafios. Com as crescentes evoluções tecnológicas, que ocorrem em quase todos os sectores de atividade, a maior parte dos trabalhadores é confrontada, em algum momento do seu percurso profissional, com a introdução de mudanças no seu posto de trabalho, mudanças com as quais terão de lidar. A mudança organizacional influencia quer a empresa, quer o trabalhad...

  17. Akreos Adapt AO Intraocular Lens Opacification: A Case Report

    Directory of Open Access Journals (Sweden)

    Matteo Forlini

    2013-09-01

    Full Text Available A 79-year-old hyperglycemic patient was referred to the ‘Santa Maria delle Croci' Hospital, Ravenna, Italy. He presented with visual impairment in the right eye. Four years ago, he had had an uneventful cataract surgery in the right eye. We observed an opacification of the intraocular lens (IOL causing significant visual disturbance. The IOL was exchanged. Unfortunately, pathologic analysis was not performed. Patient-related factors such as hyperglycemia and hypertension might have been responsible for the opacification. To our knowledge, there is only one previous report of opacification of the Akreos Adapt AO IOL.

  18. Audit, Control and Monitoring Design Patterns (ACMDP for Autonomous Robust Systems (ARS

    Directory of Open Access Journals (Sweden)

    C. Trad

    2008-11-01

    Full Text Available This paper proposes the Audit, Control and Monitoring Design Patterns (ACMDP for building Autonomous and Robust Systems (ARS such as Mobile Robot Systems (MRS. These patterns are also applicable to other Mission Critical and Complex Systems (MCCS. This paper presents a proposal which will help ARS project managers and engineers design, build and estimate the probability that an ARS will succeed or fail. Furthermore, this proposal offers the possibility to ARS problems with the help of audit, monitoring and controlling components, adjust the project management pathways, and define the problem sources as well as their possible solutions, in order to deliver an ARS or an MRS.

  19. High-Energy Ions Emitted from Ar Clusters Irradiated by Intense Femtosecond Laser Pulses

    Institute of Scientific and Technical Information of China (English)

    LI Zhong; LEI An-Le; NI Guo-Quan; XU Zhi-Zhan

    2000-01-01

    We have experimentally studied the energy spectra of Ar ions emitted from Ar clusters irradiated by intense femtosecond laser pulses. The Ar clusters were produced in the adiabatic expansion of Ar gas into vacuum at high backing pressures. The laser peak intensity was about 2×106 W/cm2 with a pulse duration of 45 fs. The maximum and the average energies of Ar ions are 0.2 MeV and 15kev at a backing pressure of 2. S MPa, respectively. They are almost independent of the backing pressures in the range of 0.6 to 4.5 MPa.

  20. Resistência ao estresse e crescimento de larvas de peixes neotropicais alimentadas com diferentes dietas Stress resistance and growth of larvae of neotropical fish feed with different diets

    Directory of Open Access Journals (Sweden)

    Ronald Kennedy Luz

    2007-01-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da alimentação na resistência ao estresse e no crescimento de larvas das espécies de peixes neotropicais: Astronotus ocellatus (Oscar, Piaractus mesopotamicus (pacu e Pseudoplatystoma coruscans (pintado. As larvas receberam diferentes tipos de alimentos (Artemia sp., larvas de Colossoma macropomum e dieta artificial Fry Feed Kyowa. Foram realizados testes de exposição ao ar e a taxa de sobrevivência, determinada 24 horas depois. A fim de avaliar o crescimento, medidas de peso foram realizadas em larvas dos diferentes tratamentos. Larvas de A. ocellatus alimentadas com náuplios de Artemia sp. apresentaram tendência de maior peso e resistência ao estresse, quando comparadas com o uso de dieta artificial. Larvas de P. mesopotamicus apresentaram melhores valores de peso e taxas de resistência ao estresse, quando alimentadas com Artemia sp. ou alimentação mista (Artemia sp. + dieta artificial. Em P. coruscans, o uso de larvas forrageiras resultou em indivíduos mais resistentes aos testes de exposição ao ar do que os que receberam apenas Artemia sp. Valores de peso, nos dois manejos alimentares, foram semelhantes entre si. O alimento vivo desempenha importante atuação no crescimento em peso e na melhora da resistência ao estresse das espécies estudadas.The objective of this work was to evaluate the effect of feeding on stress resistance and growth in larvae of neotropical fish of the species: Astronotus ocellatus, Piaractus mesopotamicus, and Pseudoplatystoma coruscans. Larvae received different types of food (Artemia sp., Colossoma macropomum larvae and artificial microdiet Fry Feed Kyowa. Resistance tests to air exposure were applied, and larvae survival was determined after 24 hours. To evaluate the growth, weight measures were performed during the different treatments. A. ocellatus larvae fed on Artemia sp. nauplii tended to better resistant and weight than others that received

  1. Protein kinase D1 (PKD1) influences androgen receptor (AR) function in prostate cancer cells

    International Nuclear Information System (INIS)

    Protein kinase D1 (PKD1), founding member of PKD protein family, is down-regulated in advanced prostate cancer (PCa). We demonstrate that PKD1 and androgen receptor (AR) are present as a protein complex in PCa cells. PKD1 is associated with a transcriptional complex which contains AR and promoter sequence of the Prostate Specific Antigen (PSA) gene. Ectopic expression of wild type PKD1 and the kinase dead mutant PKD1 (K628W) attenuated the ligand-dependent transcriptional activation of AR in prostate cancer cells and yeast cells indicating that PKD1 can affect AR transcription activity, whereas knocking down PKD1 enhanced the ligand-dependent transcriptional activation of AR. Co-expression of kinase dead mutant with AR significantly inhibited androgen-mediated cell proliferation in both LNCaP and DU145 PC cells. Our data demonstrate for the first time that PKD1 can influence AR function in PCa cells

  2. Rotational Spectrum of Ar...PROPARGYL Alcohol Complex

    Science.gov (United States)

    Mani, Devendra; Shahi, Abhishek; Arunan, E.

    2012-06-01

    Pure rotational spectrum for Ar...Propargyl alcohol complex has been observed and fitted. Fitted rotational constants for the complex are : A=4346.17307(90) MHz, B=1617.15317(19)MHz and C= 1245.42065(15) MHz. These rotational constants are very close to the ab-initio rotational constants for the geometry, in which propargyl alcohol exists in gauche conformation and Ar interacts with both, the hydroxyl group and the acetylenic group of propargyl alcohol. Rotational spectrum of deuterated isotopologue (-OD) of the complex further confirms the existence of the above mentioned geometry. In previous studies tunneling frequency corresponding to -OH tunneling motion in propargyl alocohol monomer was determined to be 652.4 GHz and for -OD tunneling motion in mono-deuterated species, it was 213.5 GHz. In Ar...Propargyl alcohol complex also, a-type and c-dipole transitions show tunneling splitting. In the parent complex, for a-type transitions, tunneling splitting was 10 KHz and for c-type transitions (c-dipole of the complex is in the same direction as in propargyl alcohol monomer, and it is antisymmetric with respect to OH tunneling motion in both monomer and the complex), it was 2.59 MHz. In deuterated complex (OD) splitting was not resolvable for a-type transitions while for c-type it reduces to 900 KHz. Search for C-13 isotopologues is in progress. Moreover, propargyl alcohol offers several possibilities for H-bonding and we are planning to study its complexes with water in near future. Results will be presented in the talk. E. Hirota,J. Mol. Spectrosc. 26 (1968) 335-350. J.C. Pearson, B.J. Drouin, J. Mol. Spectrosc. 234 (2005) 149-156.

  3. Flares and magnetic non-potentiality of NOAA AR 11158

    International Nuclear Information System (INIS)

    Magnetic non-potentiality is important for understanding flares and other solar activities in active regions (ARs). Five non-potential parameters, i.e. electric current, current helicity, source field, photospheric free energy, and angular shear, are calculated to quantify the non-potentiality of NOAA AR 11158. Benefitting from the high spatial resolution, high cadence and continuous temporal coverage of vector magnetograms from the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory, both the long-term evolution of the AR and the rapid change during flares are studied. We confirm that, compared with the magnetic flux, the magnetic non-potentiality has a closer connection with the flare, and the emerging flux regions are important for understanding the magnetic non-potentiality and flares. The main results are as follows. (1) The vortex in the source field directly displays the deflection of the horizontal magnetic field. The deflection corresponds to the fast rotating sunspot with a time delay, which suggests that the sunspot rotation leads to an increase in the non-potentiality. (2) Two areas that have evident changes in the azimuth of the vector magnetic field are found near the magnetic polarity inversion line. The change rates of the azimuth are about 1.3° h−1 and 3.6° h−1, respectively. (3) Rapid and prominent increases are found in the variation of helicity during four flares in the regions where their initial brightening occurs. The recovery of the increases takes 3–4 h for the two biggest flares (X2.2 and M6.6), but only takes about 2 h for the two other smaller flares (M2.2 and M1.6).

  4. Flares and magnetic non-potentiality of NOAA AR 11158

    Institute of Scientific and Technical Information of China (English)

    Qiao Song; Jun Zhang; Shu-Hong Yang; Yang Liu

    2013-01-01

    Magnetic non-potentiality is important for understanding flares and other solar activities in active regions (ARs).Five non-potential parameters,i.e.electric current,current helicity,source field,photospheric free energy,and angular shear,are calculated to quantify the non-potentiality of NOAA AR 11158.Benefitting from the high spatial resolution,high cadence and continuous temporal coverage of vector magnetograms from the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory,both the long-term evolution of the AR and the rapid change during flares are studied.We confirm that,compared with the magnetic flux,the magnetic non-potentiality has a closer connection with the flare,and the emerging flux regions are important for understanding the magnetic non-potentiality and flares.The main results are as follows.(1) The vortex in the source field directly displays the deflection of the horizontal magnetic field.The deflection corresponds to the fast rotating sunspot with a time delay,which suggests that the sunspot rotation leads to an increase in the non-potentiality.(2) Two areas that have evident changes in the azimuth of the vector magnetic field are found near the magnetic polarity inversion line.The change rates of the azimuth are about 1.3° h-1 and 3.6° h-1,respectively.(3) Rapid and prominent increases are found in the variation of helicity during four flares in the regions where their initial brightening occurs.The recovery of the increases takes 3-4 h for the two biggest flares (X2.2 and M6.6),but only takes about 2 h for the two other smaller flares (M2.2 and M1.6).

  5. Estudio del sistema simbiótico AR Pavonis

    Science.gov (United States)

    Quiroga, C.; Brandi, E.; Ferrer, O.; García, L.; Barbá, R.

    Se presenta un estudio espectroscópico y polarimétrico de la binaria eclipsante AR Pavonis a partir de observaciones obtenidas con el telescopio de 2.15 m. del CASLEO (San Juan). El estudio de la naturaleza del sistema se realizó a través del análisis de algunos espectros reunidos entre los años 1990 y 1995 y de datos polarimétricos correspondientes al intervalo 1995 y 1997. El análisis espectroscópico indica que AR Pav está compuesta por una gigante roja M3.7 y una componente caliente compacta, con una temperatura mayor a 90000 K y una luminosidad del orden de 500Lsolar. A lo largo del período orbital, las variaciones observadas en flujo y en velocidades radiales, reflejan que las emisiones permitidas se forman en una región que rodea la componente caliente. El estudio de la polarización lineal de AR Pav indica que además de una componente interestelar, existe una componente intrínseca del sistema que varía temporalmente y con la longitud de onda de la luz polarizada. El distinto comportamiento del grado de polarización y del ángulo de posición observado en fases diferentes, sugiere que distintos mecanismos pueden estar actuando, dependiendo de la región de scattering observado a lo largo de la línea de la visual.

  6. Avaliação da exposição ocupacional ao chumbo: proposta de uma estratégia de monitoramento para prevenção dos efeitos clínicos e subclínicos

    OpenAIRE

    Araujo Ulisses C.; Pivetta Fatima R.; Moreira Josino C

    1999-01-01

    A produção de baterias chumbo-ácidas representa um dos segmentos industriais de maior consumo de chumbo, estando os trabalhadores expostos a riscos elevados. Neste trabalho são discutidos os resultados obtidos na avaliação da exposição ao chumbo de trabalhadores de uma fábrica de baterias da cidade do Rio de Janeiro, de acordo com as normas vigentes da legislação brasileira e com dados científicos atualizados. Os métodos empregados neste estudo foram a amostragem de ar-pessoal e a determinaçã...

  7. A comunidade como espaço de produção de saúde mental: contribuições da Psicologia Comunitária ao processo de desinstitucionalização

    OpenAIRE

    Dayane Silva Rodrigues; Maria Aparecida Alves Sobreira de Carvallho; Verônica Morais Ximenes

    2011-01-01

    No contexto de implantação da reforma psiquiátrica brasileira, importantes conquistas foram obtidas com a proposição de serviços substitutivos ao manicômio. Contudo, a desinstitucionalização da loucura ultrapassa a esfera da desospitalização e se constitui, ainda, em um desafio cada vez mais atual. Para avançar nessa problemática, a comunidade tem sido crescentemente destacada como espaço potencialmente rico na produção coletiva da saúde mental. Contudo, observam-se poucos questionamentos e d...

  8. X-ray calculations for a NLTE Ar plasma

    Institute of Scientific and Technical Information of China (English)

    WUZe-qing; PANGJin-qiao; HANGuo-xing

    2004-01-01

    A model is developed to calculate emission spectrum of non-local thermodynamic equilibrium(NLTE)plasmas. The Collisional-Radiative model is adopted for non-LTE population calculations. Configuration-averaged rate coefficients that needed in the rate equations are obtained based on the first order perturbation theory. The Hatree-Fock-Slater self-consistent-field method is used to calculate electron wave functions. The present model is applied to the calculation of emissivity from a Ar plasma. The features of the spectra are in good agreement with those calculated by other theoretical models, but the data of the integrated emissivity differ by a factor 2-8.

  9. Predication of Crane Condition Parameters Based on SVM and AR

    Science.gov (United States)

    Xiuzhong, Xu; Xiong, Hu; Congxiao, Zhou

    2011-07-01

    Through statistic analysis of vibration signals of motor on the container crane hoisting mechanism in a port, the feature vectors with vibration are obtained. Through data preprocessing and training data, Training models of condition parameters based on support vector machine (SVM) are established. The testing data of condition monitoring parameters can be predicted by the training models. During training the models, the penalty parameter and kernel function of model are optimized by cross validation. In order to analysis the accurate of SVM model, autoregressive model is used to predict the trend of vibration. The research showed the predicted results of model using SVM are better than the results by autoregressive (AR) modeling.

  10. Energy Levels of Highly Ionized Ar ⅩⅣ

    Institute of Scientific and Technical Information of China (English)

    CHENG Zhang; LI Ping; DENG Xiao-Hui

    2006-01-01

    With the Breit interaction and quantum electrodynamics corrections considered, relativistic configuration interaction calculations have been carried out in the extended optimal level scheme using multi-configuration Dirac-Fock wave functions on the 204 energy levels and electric dipole transitions of Ar ⅩⅣ. The results of electric dipole transitions are in good agreement with experiments. Among the energy levels calculated, the lowest 125 levels are in good agreement with available experimental and other theoretical ones, and the other 79 levels are new ones obtained by the present work. This wide range of atomic energy levels is useful in astrophysics and plasma physics.

  11. Tissue Characterization on Common Carotid Artery using AR Model

    Science.gov (United States)

    Koya, Yoshiharu; Mizoshiri, Isao

    This study uses one image with a echocardiography and detects arteriosclerosis on the common carotid artery by tissue characterization. The conventional methods are measurement of thickness on the vessel wall or stiffness on the common carotid artery. However, they need frames of several beats and great calculation times. But, we detect the arteriosclerosis with only one image. Our method estimate the grade of arteriosclerosis by AR model parameters fitted to the texture on the lumen-intima wall. Experimental results show the validity of the proposed method.

  12. Oscillator strengths for Ar VII, Ca IX and Fe XV

    Science.gov (United States)

    Tayal, S. S.

    1986-01-01

    The excitation energies and oscillator strengths are calculated for electric-dipole-allowed and intercombination transitions between 3s2 1S, 3s3p(1,3)P0, 3p2 3P, 1D, 1S and 3s3d(1,3)D states in Ar VII, Ca IX, and Fe XV ions of the magnesium sequence. These states are represented by the fairly large configuration-interaction expansions. The calculations have been carried out in both LS and intermediate coupling schemes. The relativistic corrections have been included through the Breit-Pauli Hamiltonian. The results are compared with previous theoretical calculations and with measurements.

  13. The readout system for the ArTeMis camera

    Science.gov (United States)

    Doumayrou, E.; Lortholary, M.; Dumaye, L.; Hamon, G.

    2014-07-01

    During ArTeMiS observations at the APEX telescope (Chajnantor, Chile), 5760 bolometric pixels from 20 arrays at 300mK, corresponding to 3 submillimeter focal planes at 450μm, 350μm and 200μm, have to be read out simultaneously at 40Hz. The read out system, made of electronics and software, is the full chain from the cryostat to the telescope. The readout electronics consists of cryogenic buffers at 4K (NABU), based on CMOS technology, and of warm electronic acquisition systems called BOLERO. The bolometric signal given by each pixel has to be amplified, sampled, converted, time stamped and formatted in data packets by the BOLERO electronics. The time stamping is obtained by the decoding of an IRIG-B signal given by APEX and is key to ensure the synchronization of the data with the telescope. Specifically developed for ArTeMiS, BOLERO is an assembly of analogue and digital FPGA boards connected directly on the top of the cryostat. Two detectors arrays (18*16 pixels), one NABU and one BOLERO interconnected by ribbon cables constitute the unit of the electronic architecture of ArTeMiS. In total, the 20 detectors for the tree focal planes are read by 10 BOLEROs. The software is working on a Linux operating system, it runs on 2 back-end computers (called BEAR) which are small and robust PCs with solid state disks. They gather the 10 BOLEROs data fluxes, and reconstruct the focal planes images. When the telescope scans the sky, the acquisitions are triggered thanks to a specific network protocol. This interface with APEX enables to synchronize the acquisition with the observations on sky: the time stamped data packets are sent during the scans to the APEX software that builds the observation FITS files. A graphical user interface enables the setting of the camera and the real time display of the focal plane images, which is essential in laboratory and commissioning phases. The software is a set of C++, Labview and Python, the qualities of which are respectively used

  14. Consumo de arsénico y riesgo cardiovascular

    OpenAIRE

    Lachiner Saborío Morales; Luis Fernando Hidalgo Murillo

    2015-01-01

    El arsénico (As) es un elemento considerado como ubicuo, cuyas fuentes pueden ser naturales o productos de la actividad humana. La exposición a este elemento ocurre principalmente por la vía oral. Las presentaciones inorgánicas del As son consideradas como las más tóxicas. La absorción del As ocurre en el intestino delgado y por medio de acuaporinas ingresa a los hepatocitos, en casos de ingesta crónica el As tiende acumularse en hígado, riñones, corazón, sistema nervioso, pulmones, músculo, ...

  15. Analyzing House Fly's Exploration Behavior with AR Methods

    CERN Document Server

    Takahashi, H; Ikegamai, T; Shimada, M; Horibe, Naoto; Ikegamai, Takahshi; Shimada, Masakazu; Takahashi, Hisanao

    2007-01-01

    This paper presents a detailed characterization of the trajectory of a single housefly freely walking in a square cage. The trajectory of the fly is recorded and transformed into time series, which is fully analyzed by the method of AR model. A main discovery is that the fly switches the styles of motion from the low dimensional regular pattern to the higher dimensional disordered pattern. In particular, the anomalous diffusion is found to well characterize the fly's exploration behavior. The exploration behavior analysis is important form both psychological and dynamical system' point of view.

  16. X-ray calculations for a NLTE Ar plasma

    Institute of Scientific and Technical Information of China (English)

    WU Ze-qing; PANG Jin-qiao; HAN Guo-xing

    2004-01-01

    A model is developed to calculate emission spectrum of non-local thermodynamic equilibrium(NLTE) plasmas. The Collisional-Radiative model is adopted for non-LTE population calculations. Configuration-averaged rate coefficients that needed in the rate equations are obtained based on the first order perturbation theory. The Hatree-Fock-Slater self-consistent-field method is used to calculate electron wave functions. The present model is applied to the calculation of emissivity from a Ar plasma. The features of the spectra are in good agreement with those calculated by other theoretical models, but the data of the integrated emissivity differ by a factor 2~8.

  17. Fatores relacionados à fidelidade ao tratamento do glaucoma: opiniões de pacientes de um hospital universitário Factors related to glaucoma treatment compliance: patients' opinions from a University Hospital

    Directory of Open Access Journals (Sweden)

    Lucas Ravagnani Silva

    2010-04-01

    Full Text Available OBJETIVO: Considerando que a não-adesão ao tratamento do glaucoma é um dos fatores de risco para a sua progressão, o objetivo do presente trabalho foi coletar informações sobre: 1 conhecimento e sentimentos dos pacientes sobre a doença; 2 a não-fidelidade ao tratamento e fatores relacionados; e 3 eventual influência da doença no estilo de vida participantes. MÉTODOS: Foram realizadas entrevistas, utilizando questionário semiestruturado, com 50 pacientes com glaucoma primário de ângulo aberto. A análise das respostas foi feita utilizando a técnica do ''Discurso do Sujeito Coletivo'' (DSC (qualitativa/quantitativa. RESULTADOS: Trinta e oito por cento dos pacientes não se consideraram bem informados sobre o glaucoma. A porcentagem de pacientes que declararam nãofidelidade ao tratamento foi de 20%. Os principais fatores relacionados foram: efeitos colaterais dos medicamentos (24%; falta de informação sobre a doença (22%; dificuldade de comunicação com o médico (14%; dificuldades na administração do tratamento (14%; falta de recursos financeiros para adquirir medicamentos (10%; atitudes e crenças (10%. Dezoito por cento dos participantes afirmaram que a doença alterou a qualidade de vida. CONCLUSÃO: Na população estudada, os fatores relacionados à não-adesão ao tratamento de glaucoma, abrangem desde o desconhecimento do que é a doença até atitudes, valores e crenças. Na sua maioria, podem causar a progressão da doença. A influência desses fatores pode ser diminuída com medidas educacionais, intervenções sobre comportamentos e atitudes, melhora da relação médico-paciente e suprimento de medicamentos.PURPOSE: Considering that noncompliance to glaucoma treatment is one of the risk factors associated with disease´s progression, the purpose of the present study was to evaluate: 1 knowledge and feelings about the disease; 2 self-reported noncompliance to treatment and related factors; and 3 influence of

  18. Ultra-high precision 40Ar/39Ar ages for Fish Canyon Tuff and Alder Creek Rhyolite sanidine: New dating standards required?

    Science.gov (United States)

    Phillips, D.; Matchan, E. L.

    2013-11-01

    The 40Ar/39Ar dating technique is a high precision (ACR). Despite common usage, the ages of FCT and ACR sanidine have proven contentious, with reported values varying by >2%; well outside the ±0.1% aspiration of EARTHTIME (http://www.earth-time.org).

  19. Eruption of the Continental Flood Basalts at ~259 Ma in the Emeishan Large Igneous Province, SW China: Evidence from Laser Microprobe 40Ar/39Ar Dating

    Institute of Scientific and Technical Information of China (English)

    HOU Zengqian; CHEN Wen; LU Jiren

    2006-01-01

    A suite of continental flood basalts sampled over a vast exposure and stratigraphic thickness in the Emeishan large igneous province (LLP), SW China was investigated for laser microprobe 40Ar/39Ar dating. There are two 40Ar/39Ar age groups for these basalts, corresponding to 259-246 Ma and 177-137 Ma, respectively. A well-defined isochron gives an eruption age of huge quantities of mafic magmas at 258.9±3.4 Ma, which is identical to previous dating and paleontological data. Much younger 40Ar/39Ar ages for some basalts with low-greenschist metamorphic facies probably recorded a late thermo-tectonic event caused by collision between the Yangtze and Qiangtang continental blocks during the Mesozoic, which resulted in the reset of argon isotope system. The 40Ar/39Ar age data, we present here, combined with previous dating and paleontological data, suggest relatively short duration (about 3 Ma) of mafic volcanism, which have important implication on mantle plume genesis of the Emeishan continental flood basalts in the LIP.

  20. Constraining the age of the Matuyama-Brunhes reversal using intercalibrated 40Ar/39Ar and astronomical ages of the Bishop Tuff and Australasian Tektite

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Palike, Heiko;

    ). However, this age offset is not synchronous with a new astronomically intercalibrated 40Ar/39Ar age for the normal-polarity Quaternary Bishop Tuff, stratigraphically above the MB boundary by approximately 15 ka. In order to best constrain the age of the boundary, an astronomically calibrated radio...

  1. Noble Gases in the Monahans Chondrite and Halite: Ar-39 - Ar-40 Age, Space Exposure Age, Trapped Solar Gases, and Neutron Fluence

    Science.gov (United States)

    Garrison, Daniel H.; Bogard, Donald D.

    2000-01-01

    For the Monahans chondrite and halite, we determined Ar-39 - Ar-40 ages of silicate = 4.53 Ga, halite > 4.3 Ga; a space exposure age of approx. 5 Ma; a regolith pre-irradiation; solar gas concentrations in the dark phase; and a regolith thermal neutron fluence.

  2. Precise molybdenite Re-Os and mica Ar-Ar dating of the Mesozoic Yaogangxian tungsten deposit, central Nanling district, South China

    Science.gov (United States)

    Peng, Jiantang; Zhou, Mei-Fu; Hu, Ruizhong; Shen, Nengping; Yuan, Shunda; Bi, Xianwu; Du, Andao; Qu, Wenjun

    2006-10-01

    The Yaogangxian deposit in the central Nanling region, South China consists of vein-type ore bodies hosted in Cambrian to Jurassic strata and Mesozoic granitic intrusions. Wolframite and molybdenite are the dominant ore minerals intergrown with gangue minerals of quartz, feldspar, phlogopite, and muscovite. We have carried out molybdenite Re-Os and phlogopite and muscovite 40Ar/39Ar dating to better understand the timing and genesis of mineralization. Re-Os dating of eight molybdenite samples yielded model ages ranging from 152.0±3.5 to 161.1±4.5 Ma, with an average of 156.0 Ma. The Re-Os analyses give a well-defined 187Re/187Os isochron with an age of 154.9±2.6 Ma (MSWD=2.4). Hydrothermal phlogopite and muscovite display extremely flat 40Ar/39Ar age spectra. Phlogopite yields a 40Ar/39Ar plateau age of 153.0±1.1 Ma, whereas muscovite yields a plateau age of 155.1±1.1 Ma. Both 40Ar/39Ar ages are in good agreement with the Re-Os ages, placing the timing of tungsten mineralization at about 154 Ma. This age is consistent with the field relationships. Our new data, when combined with published geochronological results from other major deposits in this region, suggest that large scale W-Sn mineralization occurred throughout the central Nanling region in the Late Jurassic.

  3. An Early Jurassic 40Ar/39Ar Age for the Puchezh-Katunki Impact Structure (Russia) — No Causal Link to an Extinction Event

    Science.gov (United States)

    Holm-Alwmark, S.; Alwmark, C.; Lindström, S.; Ferrière, L.; Scherstén, A.; Masaitis, V. L.; Mashchak, M. S.; Naumov, M. V.

    2016-08-01

    We propose a revised age of 192.0 ± 0.8 Ma for the formation of the Puchezh-Katunki impact structure, Russia, based on 40Ar/39Ar step-heating analyses of five impact melt rock samples. This age does not correlate with any known extinction event.

  4. Utilização de Sistema de Informação Geográfica como ferramenta para gestão do monitoramento da qualidade do ar na Região Metropolitana do Rio de Janeiro

    OpenAIRE

    Eduardo Monteiro Martins; Júlio Domingos Nunes Fortes; Gilberto Pessanha Ribeiro; Marcus Felipe Mourão Pereira

    2014-01-01

    A preocupação com a gestão da qualidade do ar na cidade do Rio de Janeiro tem aumentado nos últimos anos devido aos grandes eventos que a cidade irá receber em um futuro próximo. A utilização de Sistema de Informação Geográfica como uma ferramenta para a gestão da qualidade do ar foi avaliada neste trabalho. Foi feita uma nova delimitação das bacias aéreas com a utilização de dados digitais que proporcionou o surgimento de três novas bacias aéreas e a alteração da configuração espacial das ba...

  5. 40Ar/39Ar Dating of the Shaxi Porphyry Cu-Au Deposit in the Southern Tan-Lu Fault Zone, Anhui Province

    Institute of Scientific and Technical Information of China (English)

    YANG Xiaoyong; ZHENG Yongfei; XIAO Yilin; DU Jianguo; SUN Weidong

    2007-01-01

    Four samples of plagioclase and biotite from the Shaxi porphyry in the lower part of the Yangtze metallogenic belt were analyzed for age determination with the 40Ar/39Ar method. The results yield reproducible ages of 126 Ma to 135 Ma with a high level of confidence according to the agreement between isochron and plateau ages. The four Ar-Ar ages are relatively consistent within the analytical error. These ages are also consistent with, but more precise than, previous K-Ar and Rb-Sr ages and thus provide better constraints on the time of porphyry formation and associated Cu-Au mineralization along the middle to lower part of the Yangtze metallogenic belt. The ages of 126 to 135 Ma are interpreted to represent the intrusive time of the Shaxi porphyry, so that the Cu-Au mineralization should have occurred later due to the post-magmatic hydrothermal event.

  6. Preservation of Sub-Microscopic Scale Structural Relics in Biotite: Implications for 40AR/39AR Geochronology

    Science.gov (United States)

    Beltrando, M.; Di Vincenzo, G.; Ferraris, C.

    2012-12-01

    Relic crystals of magmatic biotite that undewent eclogite facies metamorphism were investigated by laser step-heating and laser in-situ 40Ar/39Ar techniques, in conjunction with SEM, EMP and TEM analyses, to elucidate the influence of recrystallization on K-Ar systematics. Samples were collected from meta-granitoids of the Gran Paradiso Massif (Western Alps), emplaced at upper crustal depths (P~0.25-0.35 GPa) in the Permian and metamorphosed at P>2.0 GPa and T~500-600°C in the Middle-Late Eocene. Two different samples, which underwent different degrees of Alpine re-equilibration, were examined. Sample JT1007 still preserves the original cm-sized magmatic quartz, k-feldspar and brown biotite (Bt 1), rarely rimmed by small green biotite crystals (Bt 2) related to Alpine metamorphism. Sample JT1008, instead, is characterized by a larger degree of Alpine re-equilibration, with static re-crystallization of the original magmatic quartz into aggregates of fine-grained polygonal crystals and common green biotite rims around brown Bt 1. Compositional profiling across Bt 1 in sample JT1007 reveals a progressive decrease in Ti content towards the crystal rims, which overlap with the composition of Bt 2. Compositional profiling across Bt 1 in sample JT1008, instead, reveals a homogeneous Ti content across the grain. This compositional pattern is mirrored by TEM investigation at the sub-micron scale, revealing a systematic zoning in Bt 1 from sample JT1007, with high-temperature magmatic politypes, surrounded by 1M politypes, still preserved in crystal cores. Crystal rims, instead, are characterized by 1M politypes only. Biotites from JT1008, instead, are homogeneous, solely consisting of 1M politypes. Infrared laser step-heating experiments on mineral separates from the two samples gave contrasting results: JT1008 yielded a flat spectrum, for more than 90% of the released 39ArK, with an error-weighted mean age of 36.5±0.3 Ma; JT1007 yielded a slightly saddle-shaped profile

  7. Tratamento preservativo de Bambusa tuldoides Munro para sua utilizaçao na indústria de móveis

    OpenAIRE

    Penna, Jose Eduardo

    2013-01-01

    Resumo: São apresentados tratamentos com preservativo à "base de CCB para evitar o ataque de Lyotus brunneus Steph. Usaram-se bambus nos estados verde e parcialmente seco ao ar. Efetuaram-se tratamentos no campo (imersão-difusão), na linha de produção da industria (vaporização-imersão/difusão à temperatura ambiente) e no laboratório (imersão-difusão a temperatura controlada). Usaram-se colmos com os septos nodais perfurados e não perfurados. Procedeu-se a estudos anatômicos, de penetração , r...

  8. Newly combined 40Ar/39Ar and U-Pb ages of the Upper Cretaceous timescale from Hokkaido, Japan

    Science.gov (United States)

    Gaylor, J. R.; Heredia, B. D.; Quidelleur, X.; Takashima, R.; Nishi, H.; Mezger, K.

    2011-12-01

    The main targets for GTS next project (www.gtsnext.eu) are to develop highly refined geological time scales, including the Upper Cretaceous. The Cretaceous period is characterised by numerous global anoxic events in the marine realm, rich ammonitic fossil assemblages and specialised foraminifera. However, lack of age diagnostic macro and micro fossils in the North Pacific sections has made it difficult to link these with global sections such as the Western Interior Basin (North America). Using advances with terrestrial C-isotope and planktic foraminifera records within Central Hokkaido we are able to correlate these sections globally. The Cretaceous Yezo group in Central Hokkaido comprises deep marine mudstones and turbidite sandstones interbedded with acidic volcanic tuffs. Using various sections within the Yezo group, we radiometrically dated tuffs at the main stage boundaries in the Upper Cretaceous. The samples derive from the Kotanbetsu, Shumarinai, Tiomiuchi and the Hakkin river sections, spanning the time from the Albian-Cenomanian up until the Campanian-Santonian boundaries, and were dated using 40Ar/39Ar, K/Ar and U-Pb techniques. Recent age constraints in the Hokkaido counterparts (Kotanbetsu sections) show good coherence between radiometric chronometers on the various Upper Cretaceous stage boundaries. These additional ages together with our isotope ages from the different sections around the Hokkaido basin are well linked by the various faunal assemblages and C-isotope curves. The combined radio isotope ages contribute to previous attempts (such as those focused in the Western Interior Basin) supporting the synchronicity of events such as global oceanic anoxic events. Finally, the ages obtained here also compliment the previous C-isotope and planktic foraminifera records allowing for a more precise climatic history of the Northwest Pacific during the Cretaceous. The research within the GTSnext project is funded by the European Community's Seventh

  9. The tectonic significance of pre-Scandian 40Ar/39Ar phengite cooling ages in the Caledonides of western Norway

    Science.gov (United States)

    Andersen, T.B.; Berry, H.N.; Lux, D.R.; Andresen, A.

    1998-01-01

    Pre-Silurian continental-margin deposits in western Norway, non-conformably overlying allochthonous continental orthogneisses retain Ordovician 40Ar/39Ar cooling ages for phengites, implying either rapid cooling immediately after a Late Ordovician orogenic event, or less likely, a slow cooling following an Early Ordovician or older orogeny. The Dalsfjord Suite-H??yvik Group basement-cover pair are probably a lateral equivalent to Late Proterozoic sandstones ('sparagmites') covering the Jotun Nappe gneisses of the Middle Allochthon in central-south Norway. The H??yvik Group underwent polyphase deformation, greenschist-facies metamorphism (Tmax Baltica and Laurentia. Phengitic white micas from the H??yvik Group yield cooling ages of 446.1 ?? 3.0, 449.1 ?? 2.2 and 447.5 ?? 4.0 Ma, respectively, identical within experimental error. One sample gives a plateau over 72% of the gas analysed, whereas the other samples were slightly disturbed after initial cooling, as indicated by systematically lower apparent ages at low experimental extraction temperatures. Minor 40Ar loss probably occurred during subsequent Scandian deformation and late to post-orogenic extension. The H??yvik Group rocks were unroofed before the Wenlock time (423-428 Ma) and cooled through the temperature for argon retention in phengite at c. 447 ?? 4 Ma, indicating a maximum cooling rate between 14 and 22??C/Ma-1 through Ashgill and Llandovery times before being subjected to low-grade metamorphism during the Scandian orogeny. Rapid pre-Scandian cooling, combined with peak metamorphic conditions of 450??C or less, may indicate that the Dalsfjord-H??yvik basement-cover pair were affected by an orogenic event during the Late Ordovician (Caradoc) time. The data also suggest that the Caledonian margin of Baltica may have experienced a more protracted tectonism during the Caledonian cycle than previously models focusing on Early Caledonian and Tremadoc (or older) ophiolite obduction and the Scandian

  10. Surface modification and biocompatible improvement of polystyrene film by Ar, O{sub 2} and Ar + O{sub 2} plasma

    Energy Technology Data Exchange (ETDEWEB)

    Chen Yashao, E-mail: yschen@snnu.edu.cn [Key Laboratory of Applied Surface and Colloid Chemistry (Shaanxi Normal University), Ministry of Education, School of Chemistry and Chemical Engineering, Xi' an 710062 (China); Gao Qiang; Wan Haiyan; Yi Jinhong; Wei Yanlin [Key Laboratory of Applied Surface and Colloid Chemistry (Shaanxi Normal University), Ministry of Education, School of Chemistry and Chemical Engineering, Xi' an 710062 (China); Liu Peng [Key Laboratory of Biorheological Science and Technology (Chongqing University), Ministry of Education, College of Bioengineering, Chongqing 400044 (China)

    2013-01-15

    Highlights: Black-Right-Pointing-Pointer NVP is successfully grafted onto the different discharge gases (Ar, O{sub 2}, and Ar + O{sub 2}) plasma-treated PS film surface by Ar plasma induced graft polymerization. Black-Right-Pointing-Pointer Compare with Ar and O{sub 2} plasma, the Ar + O{sub 2} plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. Black-Right-Pointing-Pointer According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. Black-Right-Pointing-Pointer Cellular compatibility tests indicate that Ar + O{sub 2} plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O{sub 2}, and Ar + O{sub 2}) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O{sub 2} plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  11. An industrial approach to design compelling VR and AR experience

    Science.gov (United States)

    Richir, Simon; Fuchs, Philippe; Lourdeaux, Domitile; Buche, Cédric; Querrec, Ronan

    2013-03-01

    The convergence of technologies currently observed in the field of VR, AR, robotics and consumer electronic reinforces the trend of new applications appearing every day. But when transferring knowledge acquired from research to businesses, research laboratories are often at a loss because of a lack of knowledge of the design and integration processes in creating an industrial scale product. In fact, the innovation approaches that take a good idea from the laboratory to a successful industrial product are often little known to researchers. The objective of this paper is to present the results of the work of several research teams that have finalized a working method for researchers and manufacturers that allow them to design virtual or augmented reality systems and enable their users to enjoy "a compelling VR experience". That approach, called "the I2I method", present 11 phases from "Establishing technological and competitive intelligence and industrial property" to "Improvements" through the "Definition of the Behavioral Interface, Virtual Environment and Behavioral Software Assistance". As a result of the experience gained by various research teams, this design approach benefits from contributions from current VR and AR research. Our objective is to validate and continuously move such multidisciplinary design team methods forward.

  12. Scientia sexualis versus ars erotica: Foucault, van Gulik, Needham.

    Science.gov (United States)

    Rocha, Leon Antonio

    2011-09-01

    This paper begins with a discussion of the scientia sexualis/ars erotica distinction, which Foucault first advances in History of Sexuality Vol. 1, and which has been employed by many scholars to do a variety of analytical work. Though Foucault has expressed his doubts regarding his conceptualization of the differences between Western and Eastern discourses of desire, he never entirely disowns the distinction. In fact, Foucault remains convinced that China must have an ars erotica. I will explore Foucault's sources of authority. To this end, I introduce the work of famous Dutch sinologist Robert Hans van Gulik, who published the tremendously influential Sexual Life in Ancient China in 1961, and also explore Joseph Needham's view on Chinese sex. I argue that, Foucault, in his fierce polemic against the "Repressive Hypothesis", himself imagined a utopian Other where pleasure and desire were organised differently. I end on a discuss on Orientalism and the project of "Sinography" of comparative literature scholars Haun Saussy, Eric Hayot and others.

  13. archAR: an archaeological augmented reality experience

    Science.gov (United States)

    Wiley, Bridgette; Schulze, Jürgen P.

    2015-03-01

    We present an application for Android phones or tablets called "archAR" that uses augmented reality as an alternative, portable way of viewing archaeological information from UCSD's Levantine Archaeology Laboratory. archAR provides a unique experience of flying through an archaeological dig site in the Levantine area and exploring the artifacts uncovered there. Using a Google Nexus tablet and Qualcomm's Vuforia API, we use an image target as a map and overlay a three-dimensional model of the dig site onto it, augmenting reality such that we are able to interact with the plotted artifacts. The user can physically move the Android device around the image target and see the dig site model from any perspective. The user can also move the device closer to the model in order to "zoom" into the view of a particular section of the model and its associated artifacts. This is especially useful, as the dig site model and the collection of artifacts are very detailed. The artifacts are plotted as points, colored by type. The user can touch the virtual points to trigger a popup information window that contains details of the artifact, such as photographs, material descriptions, and more.

  14. Electron capture and fragmentation in Ar11+ + CO collisions

    International Nuclear Information System (INIS)

    Collisions between 3, 10, and 50 keV/q Ar11+ ions and CO molecules have been studied using the Macdonald Lab CRYEBIS. Coincidence time of flight was used to detect all recoil ions and a position sensitive detector was used to determine final projectile charge states. Single- and double-electron capture are much larger than ionization at these collision energies. The dominant recoil channel associated with the Ar10+ final state is the CO+ molecular ion. The main ion-pair channel is the C+ + O+ dissociation of CO2+ while higher charge states of the transient COq+ fall off rapidly. Charge states up to CO4+ are formed in the collision indicating that many electrons are captured, but only one (and sometimes two) is retained by the projectile. This is due to autoionization of the highly excited states occupied by the captured electrons. In general, the fragmentation pattern of the CO molecule resembles the fragmentation associated with ionization caused by fast highly charged ions. This is as expected, since both processes happen at large impact parameters

  15. Arabic Sign Language (ArSL Recognition System Using HMM

    Directory of Open Access Journals (Sweden)

    Aliaa A. A.Youssif

    2011-11-01

    Full Text Available Hand gestures enabling deaf people to communication during their daily lives rather than by speaking. A sign language is a language which, instead of using sound, uses visually transmitted gesture signs which simultaneously combine hand shapes, orientation and movement of the hands, arms, lip-patterns, body movements and facial expressions to express the speaker's thoughts. Recognizing and documenting Arabic sign language has only been paid attention to recently. There have been few attempts to develop recognition systems to allow deaf people to interact with the rest of society. This paper introduces an automatic Arabic sign language (ArSL recognition system based on the Hidden Markov Models (HMMs. A large set of samples has been used to recognize 20 isolated words from the Standard Arabic sign language. The proposed system is signer-independent. Experiments are conducted using real ArSL videos taken for deaf people in different clothes and with different skin colors. Our system achieves an overall recognition rate reaching up to 82.22%.

  16. Ar + CO2 and He + CO2 Plasmas in ASTRAL

    Science.gov (United States)

    Boivin, R. F.; Gardner, A.; Munoz, J.; Kamar, O.; Loch, S.

    2007-11-01

    Spectroscopy study of the ASTRAL helicon plasma source running Ar + CO2 and He + CO2 gas mixes is presented. ASTRAL produces plasmas with the following parameters: ne = 10^10 - 10^13 cm-3, Te = 2 - 10 eV and Ti = 0.03 - 0.5 eV, B-field <= 1.3 kGauss, rf power <= 2 kWatt. A 0.33 m scanning monochromator is used for this study. Using Ar + CO2 gas mixes, very different plasmas are observed as the concentration of CO2 is changed. At low CO2 concentration, the bluish plasma is essentially atomic and argon transitions dominate the spectra. Weak C I and O I lines are present in the 750 - 1000 nm range. At higher CO2 concentration, the plasma becomes essentially molecular and is characterized by intense, white plasma columns. Here, spectra are filled with molecular bands (CO2, CO2^+, CO and CO^+). Limited molecular dissociative excitation processes associated with the production of C I and O I emission are also observed. On the other hand, He + CO2 plasmas are different. Here, rf matches are only possible at low CO2 concentration. Under these conditions, the spectra are characterized by strong C I and O I transitions with little or no molecular bands. Strong dissociative processes observed in these plasmas can be link to the high Te associated with He plasmas. An analysis of the spectra with possible scientific and industrial applications will be presented.

  17. Re-measurement of $^{32}$Ar to test the IMME

    CERN Multimedia

    The Isobaric Multiplet Mass Equation (IMME) has been subject to extensive studies in the low-mass region. Especially at the A = 32 quintet, the predicted quadratic form could not be confirmed, possible explanations being the insufficient accuracy of input parameters or higher-order interactions within the nucleon. For this quintet, the uncertainty on the mass-excess values of four of the five T = 2 multiplet members is extremely low: 0.6 keV for $^{32}$Cl, 0.3 keV for $^{32}$S, 0.2 keV for $^{32}$P, and 0.7 keV for $^{32}$Si. In the case of $^{32}$Ar, however, the uncertainty is as large as 1.8 keV. State-of-the-art high-precision Penning-trap mass spectrometry makes it possible to decrease this uncertainty. We propose to remeasure the mass of $^{32}$Ar at the Penning-trap mass spectrometer ISOLTRAP thus decreasing the uncertainty by a factor of 3-5. The proposed measurement is part of an experimental collaboration with JYFLTRAP, where the remaining masses of the T = 2 isospin quintet at A = 32 will be remeas...

  18. 40 Ar/39 Ar Ages of Auriferous Quartz Veins from the Fengyang and Zhangbaling Regions and Their Geological Significance

    Institute of Scientific and Technical Information of China (English)

    应汉龙; 赵利清

    2003-01-01

    Geotectonically the Fengyang and Zhangbaling regions belong to the North China craton and the Dabie-Sulu orogene, respectively. Neo-Archean gneiss and amphibolite and metamor-phosed sea-facies sodic volcanic rocks are the main outcrops in the two regions, respectively. The Zhangbaling terrane strike-skipped along the Tancheng-Lujiang fault zone in Mesozoic and Cenozo-ic eras and got close to the Fengyang terrane. Mesozoic Yanshanian intrusions occur broadly in the two regions. Gold-bearing quartz veins occur in the metamorphic rocks in the Fengyang region and in the granodiorite and metamorphosed sea-facies sodic volcanic rocks in the Zhangbaling region.Generally, the formation of the auriferous quartz veins involved three stages. At the first stage, gold-poor sulfide quartz veins were formed; at the second stage gold-rich quartz sulfide veins were formed; and at the third stage gold-poor barite and/or carbonate veins were formed. The 40Ar/39Ar step-heating plateau ages of the first-stage and the second-stage quartz aggregates from the Zhuding, Maoshan and Shangcheng gold deposits range between 116.1 + 0.6 Ma and 118.3 + 0.5 Ma and are pretty close to their least apparent ages and isochronal ages, respectively. All plat-eau, least apparent and isochronal ages range between 113.4 ± 0.4 Ma and 118.3 ± 0.5 Ma,which are considered as the formation age range of the quartz. It is reasonable and reliable to take the 40Ar/39Ar age range of the quartz as the formation age range of gold-bearing quartz veins on the basis of spatial relationship between gold-bearing quartz veins and their country rocks. The gold deposits in the two regions were formed in Aptian, Cretaceous, when the Tancheng-Lujiang fault zone moved as a normal fault with slightly right-lateral strike-skip, was extensional and expe-rienced very strong magmatic process. It is shown that the magmatic hydrothermal fluid is a very important part of the gold ore-forming hydrothermal fluid in the Fengyang and

  19. New accurate measurement of 36ArH+ and 38ArH+ ro-vibrational transitions by high resolution IR absorption spectroscopy and ion kinetics in Ar/H2 cold plasmas

    OpenAIRE

    Cueto, Maite; Jiménez-Redondo, Miguel; Cernicharo, José; Herrero, Víctor J.; Tanarro, Isabel; Domenech, José Luis

    2014-01-01

    Molecules containing noble gases had not been observed in space until the recent identification (from spectra of the Herschel space observatory) of 36ArH+ in the Crab Nebula [1] and the diffuse interstellar medium (ISM) [2]. Space platforms are the only suitable ones to observe pure rotational lines of 36ArH+ in space, since atmospheric transmission is very low at the required frequencies (R(0) and R(1) lie at 617.5 and 1234.6 GHz). After the recent end of the Herschel mission, the ArH+ isoto...

  20. Episodios de reactivación del sistema de fallas del Romeral en la parte Nor-Occidental de los Andes Centrales de Colombia a través de resultados 39AR-40AR y K-AR.

    OpenAIRE

    Vinasco Vallejo, Cesar; Cordani, Umberto

    2012-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  1. Arsenic binding and transfer by the ArsD As(III) metallochaperone.

    Science.gov (United States)

    Yang, Jianbo; Rawat, Swati; Stemmler, Timothy L; Rosen, Barry P

    2010-05-01

    ArsD is a metallochaperone that delivers trivalent metalloids [As(III) or Sb(III)] to the ArsA ATPase, the catalytic subunit of the ArsAB pump encoded by the arsRDABC operon of Escherichia coli plasmid R773. Interaction with ArsD increases the affinity of ArsA for As(III), conferring resistance to environmental concentrations of arsenic. Previous genetic analysis suggested that ArsD residues Cys12, Cys13, and Cys18 are involved in the transfer of As(III) to ArsA. Here X-ray absorption spectroscopy was used to show that As(III) is coordinated with three sulfur atoms, consistent with the three cysteine residues forming the As(III) binding site. Two single-tryptophan derivatives of ArsD exhibited quenching of intrinsic protein fluorescence upon binding of As(III) or Sb(III), which allowed estimation of the rates of binding and affinities for metalloids. Substitution of Cys12, Cys13, or Cys18 decreased the affinity for As(III) more than 10-fold. Reduced glutathione greatly increased the rate of binding of As(III) to ArsD but did not affect binding of As(III) to ArsA. This suggests that in vivo cytosolic As(III) might be initially bound to GSH and transferred to ArsD and then to ArsAB, which pumps the metalloid out of the cell. The As(III) chelator dimercaptosuccinic acid did not block the transfer from ArsD to ArsA, consistent with channeling of the metalloid from one protein to the other, as opposed to release and rebinding of the metalloid. Finally, transfer of As(III) from ArsD to ArsA occurred in the presence of MgATP at 23 degrees C but not at 4 degrees C. Neither MgADP nor MgATP-gamma-S could replace MgATP. These results suggest that transfer occurs with a conformation of ArsA that transiently forms during the catalytic cycle. PMID:20361763

  2. Os ditongos do latim ao português

    Directory of Open Access Journals (Sweden)

    Quednau, Laura Rosane

    2005-01-01

    Full Text Available O presente trabalho trata da evolução dos ditongos já existentes e do surgimento de novos ditongos do latim ao português, analisando a motivação de sua redução quando esta ocorre. Para tanto, apresentamos cada ditongo separadamente, trazendo informações sobre a sua forma em latim clássico, latim vulgar e português. Além disso, tratamos de outros processos de formação de ditongos em português, uma vez que o português possui um número maior de ditongos do que o latim. Por fim, apresentamos um quadro-resumo, sintetizando as informações mais importantes do trbalho: quais ditongos permaneceram, quais foram reduzidos, quais surgiram por outros processos e quais são as causas da formação de ditongos em português

  3. Arquitectura de peso. Do monumento ao (anti)monumento

    OpenAIRE

    Eva Patrícia da Silva Rocha Florindo

    2012-01-01

    Este ensaio reflecte sobre as raízes do conceito de monumento e a sua evolução ao longo dos tempos como forma de dar resposta à questão o que é quot;ser monumento hoje? A pertinência do tema fundamenta-se no paradoxo que acompanha a actual existência do monumento: embora continue muito presente na nossa sociedade é comummente negada a sua edificação, sendo-lhe atribuídas outras designações, como a de quot;ícone arquitectónico.Pretende-se assim desfazer o conflito moral que tem perseguido este...

  4. Correla\\c{c}\\~ao de longa-dura\\c{c}\\~ao e anal\\'ise bayesiana da evolu\\c{c}\\~ao temporal dos terremotos ao longo da falha de samambaia, nordeste do brasil

    CERN Document Server

    de Freitas, D B; Pereira, L L S; Pedro, L S; Atanazio, M G N; Vilar, C S

    2013-01-01

    A Bayesian approach is adopted to analyze the sequence of seismic events and their magnitudes near Jo\\~ao C\\^amara which occurred mainly from 1983 to 1998 along the Samambaia fault. In this work, we choose a Bayesian model for the process of occurrence times conditional on the observed magnitude values following the same procedure suggested by Stavrakakis and Tselentis (1987). The model parameters are determined on the basis of historical and physical information. We generate posterior samples from the joint posterior distribution of the model parameters by using a variant of the Metropolis-Hastings algorithm. We use the results in a variety of ways, including the construction of pointwise posterior confidence bands for the conditional intensity of the point process as a function of time, as well as, a posterior distribuition as a function of the mean of occurrence per unit time.

  5. NFIRAOS First Facility AO System for the Thirty Meter Telescope

    CERN Document Server

    Herriot, Glen; Atwood, Jenny; Boyer, Corinne; Byrnes, Peter; Caputa, Kris; Ellerbroek, Brent; Gilles, Luc; Hill, Alexis; Ljusic, Zoran; Pazder, John; Rosensteiner, Matthias; Smith, Malcolm; Spano, Paolo; Szeto, Kei; Véran, Jean-Pierre; Wevers, Ivan; Wang, Lianqi; Wooff, Robert

    2014-01-01

    NFIRAOS, the Thirty Meter Telescope's first adaptive optics system is an order 60x60 Multi-Conjugate AO system with two deformable mirrors. Although most observing will use 6 laser guide stars, it also has an NGS-only mode. Uniquely, NFIRAOS is cooled to -30 C to reduce thermal background. NFIRAOS delivers a 2-arcminute beam to three client instruments, and relies on up to three IR WFSs in each instrument. We present recent work including: robust automated acquisition on these IR WFSs; trade-off studies for a common-size of deformable mirror; real-time computing architectures; simplified designs for high-order NGS-mode wavefront sensing; modest upgrade concepts for high-contrast imaging.

  6. Há alternativas ao uso dos transgênicos?

    Directory of Open Access Journals (Sweden)

    Hugh Lacey

    2007-07-01

    Full Text Available A existência ou não de alternativa ao uso de transgênicos capaz de satisfazer a demanda mundial por alimento e nutrientes é uma questão que permanece aberta à investigação científica. A importância dos transgênicos ainda não está bem fundamentada no conhecimento científico disponível, em parte porque as conquistas e o potencial da agroecologia não foram objeto de atenção científica suficiente.Whether or not there are alternatives to using transgenics, that would be able to satisfy the world's food and nutrition needs, remains open to further scientific investigation. The necessity for using transgenics is not currently well based on available scientific knowledge, in part because the achievements and potential of agroecology have received insufficient scientific attention.

  7. O prazer associado ao consumo de alimentos e factores influenciadores

    OpenAIRE

    Gomes, Filipe Gonçalo Ferreira

    2013-01-01

    Projeto de Pós-Graduação/Dissertação apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Ciências Farmacêuticas Os indivíduos quando sujeitos a várias sensações transmitem respostas que surgem de reacções fisiológicas resultantes de certos estímulos, gerando a interpretação das propriedades intrínsecas aos alimentos, sendo a análise sensorial realizada em função dessas respostas individuais. As sensações são medidas por efeitos psicológic...

  8. Há alternativas ao uso dos transgênicos?

    OpenAIRE

    Hugh Lacey

    2007-01-01

    A existência ou não de alternativa ao uso de transgênicos capaz de satisfazer a demanda mundial por alimento e nutrientes é uma questão que permanece aberta à investigação científica. A importância dos transgênicos ainda não está bem fundamentada no conhecimento científico disponível, em parte porque as conquistas e o potencial da agroecologia não foram objeto de atenção científica suficiente.Whether or not there are alternatives to using transgenics, that would be able to satisfy the world's...

  9. Virtópsia: o adeus ao bisturi?

    OpenAIRE

    Andrade, Sílvia da Luz Meneses Duarte de

    2015-01-01

    A investigação médico-legal atual tem cada vez mais ao seu dispor técnicas radiológicas que visam auxiliar o diagnóstico da causa de morte e mecanismos fisiopatológicos determinantes da mesma. Contudo, a dúvida levantada pela utilização desses métodos é se estes poderiam vir a ser substitutos da autópsia convencional, ou se apenas têm capacidade de ser implementados como adjuntos da mesma. Nesta revisão tentou-se focar os pontos a favor e contra de algumas das técnicas utilizadas, nomeadament...

  10. Introdução ao LaTeX

    Directory of Open Access Journals (Sweden)

    Eric Batista Ferreira

    2012-12-01

    Full Text Available O pacote de macros para o processamento de textos, LaTeX{}, que utiliza o TeX{} como principal ferramenta, é fundamental para a produção de textos matemáticos e científicos de alto nível e emph{layout} profissional. A necessidade de conhecê-los se torna ainda mais real para profissionais e estudantes das Ciências Exatas. Além de adequado para a notação Matemática, o LaTeX{} tem muitas outras vantagens, como ser gratuito, multiplataforma e livre de vírus. Por esses e outros motivos, o minicurso ``Introdução ao LaTeX{}'' foi ministrado na emph{I Semana da Matemática da Unifal-MG}, a convite de sua comissão organizadora.

  11. Acetalated dextran encapsulated AR-12 as a host-directed therapy to control Salmonella infection.

    Science.gov (United States)

    Hoang, Ky V; Borteh, Hassan M; Rajaram, Murugesan V S; Peine, Kevin J; Curry, Heather; Collier, Michael A; Homsy, Michael L; Bachelder, Eric M; Gunn, John S; Schlesinger, Larry S; Ainslie, Kristy M

    2014-12-30

    AR-12 has been evaluated in clinical trials as an anti-cancer agent but also has demonstrated host-directed, broad-spectrum clearance of bacteria. We have previously shown that AR-12 has activity in vitro against Salmonella enterica serovar Typhimurium and Francisella species by inducing autophagy and other host immune pathways. AR-12 treatment of S. Typhimurium-infected mice resulted in a 10-fold reduction in bacterial load in the liver and spleen and an increased survival time. However, AR-12 treatment did not protect mice from death, likely due poor formulation. In the current study, AR-12 was encapsulated in a microparticulate carrier formulated from the novel degradable biopolymer acetalated dextran (Ace-DEX) and subsequently evaluated for its activity in human monocyte-derived macrophages (hMDMs). Our results show that hMDMs efficiently internalized Ace-DEX microparticles (MPs), and that encapsulation significantly reduced host cell cytotoxicity compared to unencapsulated AR-12. Efficient macrophage internalization of AR-12 loaded MPs (AR-12/MPs) was further demonstrated by autophagosome formation that was comparable to free AR-12 and resulted in enhanced clearance of intracellular Salmonella. Taken together, these studies provide support that Ace-DEX encapsulated AR-12 may be a promising new therapeutic agent to control intracellular bacterial pathogens of macrophages by targeting delivery and reducing drug toxicity.

  12. The importance of non-nuclear AR signaling in prostate cancer progression and therapeutic resistance.

    Science.gov (United States)

    Zarif, Jelani C; Miranti, Cindy K

    2016-05-01

    The androgen receptor (AR) remains the major oncogenic driver of prostate cancer, as evidenced by the efficacy of androgen deprivation therapy (ADT) in naïve patients, and the continued effectiveness of second generation ADTs in castration resistant disease. However, current ADTs are limited to interfering with AR ligand binding, either through suppression of androgen production or the use of competitive antagonists. Recent studies demonstrate 1) the expression of constitutively active AR splice variants that no longer depend on androgen, and 2) the ability of AR to signal in the cytoplasm independently of its transcriptional activity (non-genomic); thus highlighting the need to consider other ways to target AR. Herein, we review canonical AR signaling, but focus on AR non-genomic signaling, some of its downstream targets and how these effectors contribute to prostate cancer cell behavior. The goals of this review are to 1) re-highlight the continued importance of AR in prostate cancer as the primary driver, 2) discuss the limitations in continuing to use ligand binding as the sole targeting mechanism, 3) discuss the implications of AR non-genomic signaling in cancer progression and therapeutic resistance, and 4) address the need to consider non-genomic AR signaling mechanisms and pathways as a viable targeting strategy in combination with current therapies. PMID:26829214

  13. ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells.

    Science.gov (United States)

    Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H; Morton, Derrick J; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep

    2016-09-01

    Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. PMID:27462022

  14. Curvas de isodose no ar em uma sala de mamografia Air isodose curves in a mammography room

    Directory of Open Access Journals (Sweden)

    Maria Cecília Baptista Todeschini Adad

    2008-08-01

    Full Text Available OBJETIVO: O objetivo deste trabalho foi obter a distribuição da dose absorvida no ar numa sala de mamografia durante a simulação de um exame mamográfico, visando a reavaliar a necessidade do uso de barreiras de proteção radiológica nessas salas e a exposição das pacientes. MATERIAIS E MÉTODOS: Os dados da dose absorvida no ar foram coletados mediante simulação de exame mamográfico de um simulador de mama de BR12, em um equipamento Senograph 600T-Senix HF. Para tal, 158 pastilhas de CaSO4 foram distribuídas em malhas retangulares em torno do bucky, em três alturas distintas. RESULTADOS: O valor mais elevado da dose absorvida no ar, registrado no ponto central da superfície do simulador, centralizado no feixe primário, foi de 8,33 mGy, enquanto o menor valor registrado, devido exclusivamente ao espalhamento, foi de 0,008 mGy. CONCLUSÃO: Estes resultados indicam que o uso de blindagem adicional nas salas de mamografia pode não ser necessário na incidência crânio-caudal, desde que as distâncias consideradas neste trabalho sejam observadas. No entanto, eles enfatizam a necessidade de proteção da paciente.OBJECTIVE: The present study was aimed at evaluating the absorbed dose in air in a medical examination room during a mammography simulation, to re-evaluate the level of patients' exposure as well as the necessity of radiological protection barriers. MATERIALS AND METHODS: Data regarding absorbed dose in air were collected during mammography simulation with a BR12 breast phantom in a Senograph 600T-Senix HF mammograph. For this purpose, 158 CaSO4 dosimeters were distributed over rectangular grids around the bucky at three different heights. RESULTS: The highest value for absorbed dose in air recorded on the center of the phantom surface and centralized on the primary beam was 8.33 mGy, while the lowest value recorded exclusively due to radiation scattering was 0.008 mGy. CONCLUSION: These results indicate that the utilization

  15. 40Ar/39Ar geochronology and geochemical reconnaissance of the Eocene Lowland Creek volcanic field, west-central Montana

    Science.gov (United States)

    Dudas, F.O.; Ispolatov, V.O.; Harlan, S.S.; Snee, L.W.

    2010-01-01

    We report geochronological and geochemical data for the calc-alkalic Lowland Creek volcanic field (LCVF) in westcentral Montana. 40Ar/ 39Ar age determinations show that the LCVF was active from 52.9 to 48.6 Ma, with tuff-forming eruptions at 52.9 ?? 0.14 and 51.8 ?? 0.14 Ma. These dates span the age range of vigorous Eocene igneous activity in the Kamloops-Absaroka-Challis belt. The LCVF evolved upward from basal rhyolites (SiO 2>71 wt%) to dacites and andesites (SiO 2 > 62 wt%). Compositional change parallels a transition from early explosive volcanism to late effusive activity. Four geochemical components can be detected in the rocks. A component with 206Pb/204Pb 18.3 and epsilon;Nd>-9 contain a third component; and an andesite with low Nd content and epsilon;Nd near-9 probably contains a fourth component. The first three components probably derive from the lower and middle crust, whereas the fourth is probably from the lithospheric mantle. ?? 2010 by The University of Chicago.

  16. 40Ar-39Ar Age Constraints on Volcanism and Tectonism in the Terror Rift of the Ross Sea, Antarctica

    Science.gov (United States)

    2007-01-01

    Volcanic sills and dikes inferred from seismic reflection profiles and geophysical studies of the Ross Sea are thought to be related to the rift basins in the region, and their emplacement to be coeval with extension. However, lack of precise geochronology in the Terror Rift of the Ross Sea region has left these inferred relationships poorly constrained and has hindered neotectonic studies, because of the large temporal gaps between seismic reflectors of known ages. New 40Ar/39Ar geochronology presented here for submarine volcanic rocks provides better age constraints for neotectonic interpretations within the Terror Rift. Several samples from seamounts yielded young ages between 156 ± 21 and 122 ± 26 Ka. These ages support interpretations that extension within the Terror Rift was active at least through the Pleistocene. Three evenly spaced samples from the lowermost 100 m of Franklin Island range in age from 3.28 ± 0.04 to 3.73 ± 0.05 Ma. These age determinations demonstrate that construction of a small volcanic edifice such as Franklin Island took at least several hundred thousand years, and therefore that much larger ones in the Erebus Volcanic Province are likely to have taken considerably longer than previously inferred. This warrants caution in applying a limited number of age determinations to define the absolute ages of events in the Ross Sea region

  17. 40Ar/ 39Ar mineral ages from basement rocks in the Eastern Kunlun Mountains, NW China, and their tectonic implications

    Science.gov (United States)

    Liu, Yongjiang; Genser, Johann; Neubauer, Franz; Jin, Wei; Ge, Xiaohong; Handler, Robert; Takasu, Akira

    2005-04-01

    40Ar/ 39Ar dating and estimates of regional metamorphic P- T conditions were carried out on the basement rocks of the Eastern Kunlun Mountains, Western China. Samples from the Jinshuikou, Xiaomiao, Kuhai, Wanbaogou, and Nachitai groups revealed distinct metamorphic events and four age groups. The age group in the range from 363 to 439 Ma is interpreted to represent cooling after Middle Silurian-Late Devonian granulite(?) and amphibolite facies metamorphism, which is dominated by low-middle pressure/high temperature conditions. This tectono-thermal event is related to the closure of an oceanic basin or marginal sea. An age group of 212-242 Ma represents cooling after Triassic metamorphic overprint, which is probably associated with magmatic intrusions. This thermal event, together with the Permo-Triassic ophiolite zone along the South Kunlun Fault, relates to the closure of a major ocean (between India and Eurasia) and the eventual N-ward accretion of the Qiangtang block in Permo-Triassic times. The significance of the age group of 104-172 Ma may be related to the ductile deformation along the Xidatan fault due to the northward-directed accretion of the Lhasa block. Biotites from Nachitai record a partial isotopic resetting at ca. 32 Ma that is interpreted to represent a late-stage exhumation caused by further crustal shortening.

  18. Geological relationships and 40Ar/39Ar age constraints on gold mineralisation at Tarcoola, central Gawler gold province, South Australia

    International Nuclear Information System (INIS)

    The Tarcoola Goldfield is one of several districts included in the recently proposed central Gawler gold province. Understanding of the genesis of the deposits in this metallogenic province is in its infancy, and dating the age of alteration, mineralisation and microdiorite dyke intrusions has been carried out at Tarcoola as a first step towards developing mineral-systems models for the province. At Tarcoola, four samples of sericite from alteration as well as one sample of hornblende from a microdiorite dyke yield 40Ar/39Ar ages of ca 1580 Ma, Geological and petrological relationships suggest that this age represents the time of fracture-controlled Au mineralisation. These data provide evidence for coeval Au mineralisation, microdiorite dyke intrusion and local deformation. This mineralisation age is indistinguishable from U-Pb ages for the regional Gawler Range - Hiltaba volcano-plutonic complex, and is more than 100 million years younger than the Paxton Granite, which is part-host to the mineralisation. Possible temporal and genetic relationships with other deposits in the central Gawler gold province remain to be tested. Copyright (2004) Geological Society of Australia

  19. Potash-rich volcanic rocks and lamprophyres in western Shandong Province: 40Ar39Ar dating and source tracing

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Highly precise 40Ar39Ar dating results demonstrate that the ages of potash-rich volcanic rocks in western Shandong Province are 114.7-124.3 Ma, and that of the lamprophyres is 119.6 Ma. The potash-rich volcanic rocks have relatively high (87Sr/86Sr)i ratios ( 0.708715-0.711418)and distinctly negative εNd values ( -11.47 - -17.54), and are enriched in radiogenic lead (206Pb/204pb=17.341-17.622,207pb/204Pb=15.525-15.538, 208Pb/204pb = 37.563-37.684).Similarly, the lamprophyres also have quite low εNd values ( -11.57 - -19.64). Based on the fact that the Sr, Nd and Pb isotopic compositions of potash-rich volcanic rocks are very consistent with that of the clinopyroxene separates, and by integrating comprehensive analyses of their tectonic settings,and extensive comparisons of the Sr, Nd isotopic compositions with that of the related simultaneous rocks, it is concluded that the potash-rich volcanic rocks and lamprophyres in western Shandong Province were most possibly derived from the partial melting of enriched mantle which was caused by source contamination and metasomatism of subducted continental crustal materials.``

  20. 40Ar-39Ar Age and Geological Significance of the Sawur Gold Belt in Northern Xinjiang, China

    Institute of Scientific and Technical Information of China (English)

    SHEN Ping; SHEN Yuanchao; ZENG Qingdong; LIU Tiebing; LI Guangming

    2005-01-01

    The 40Ar-39Ar age method is employed in this work to analyze fluid inclusions of quartz in the ore bodies from the Kuo'erzhenkuola and Bu'erkesidai gold deposits in the Sawur gold belt, northern Xinjiang. The results show that the main mineralization occurred in 332.05±2.02-332.59±0.51 Ma and 335.53±0.32 Ma-336.78±0.50 Ma for the Kuo'erzhenkuola and Bu'erkesidai gold deposits respectively, indicating that the two deposits are formed almost at the same time, and the metallogenic time of the two deposits are close to those of the hosting rocks formed by volcanic activity of the Sawur gold belt. This geochronological study supplies new evidence for determining the timing of gold mineralization, the geneses of gold deposits, and identifies that in the Hercynian period, the Altay area developed a tectonic-magmatic-hydrothermal mineralization of the Early Carboniferous period, except the two known mineralization periods including the tectonic-magmatic-hydrothermal mineralization of the Devonian period and Late CarboniferousPermian period.

  1. Composition of Ar-Kr, Kr-Xe, and N2-Ar clusters produced by supersonic expansion of gas mixtures

    CERN Document Server

    Konotop, O P; Danylchenko, O G; Samovarov, V N

    2014-01-01

    An electron-diffraction study is made of the composition of binary Ar-Kr, Kr-Xe, and N2-Ar clusters of various size produced by expansion through a supersonic nozzle of gas mixtures with various component concentrations. The resulting clusters are shown to have compositions substantially different from those of the primary gas mixtures and dependent on cluster size. We have found that the key parameters needed for an analysis of cluster composition are the critical cluster radius and the heavier component concentration in the gas mixture which can be used to establish the regions of existence of homogeneous and heterogeneous clusters. These critical values determine the coefficient of the enrichment of clusters with the heavier component with respect to its concentration in the primary gas mixture. Theoretical relations are obtained which provide a good quantitative description of the experimental results and can be expected to be also valid for finding the composition of binary clusters of other van der Waal...

  2. Teoria da Resposta ao Item Teoria de la respuesta al item Item response theory

    Directory of Open Access Journals (Sweden)

    Eutalia Aparecida Candido de Araujo

    2009-12-01

    Full Text Available A preocupação com medidas de traços psicológicos é antiga, sendo que muitos estudos e propostas de métodos foram desenvolvidos no sentido de alcançar este objetivo. Entre os trabalhos propostos, destaca-se a Teoria da Resposta ao Item (TRI que, a princípio, veio completar limitações da Teoria Clássica de Medidas, empregada em larga escala até hoje na medida de traços psicológicos. O ponto principal da TRI é que ela leva em consideração o item particularmente, sem relevar os escores totais; portanto, as conclusões não dependem apenas do teste ou questionário, mas de cada item que o compõe. Este artigo propõe-se a apresentar esta Teoria que revolucionou a teoria de medidas.La preocupación con las medidas de los rasgos psicológicos es antigua y muchos estudios y propuestas de métodos fueron desarrollados para lograr este objetivo. Entre estas propuestas de trabajo se incluye la Teoría de la Respuesta al Ítem (TRI que, en principio, vino a completar las limitaciones de la Teoría Clásica de los Tests, ampliamente utilizada hasta hoy en la medida de los rasgos psicológicos. El punto principal de la TRI es que se tiene en cuenta el punto concreto, sin relevar las puntuaciones totales; por lo tanto, los resultados no sólo dependen de la prueba o cuestionario, sino que de cada ítem que lo compone. En este artículo se propone presentar la Teoría que revolucionó la teoría de medidas.The concern with measures of psychological traits is old and many studies and proposals of methods were developed to achieve this goal. Among these proposed methods highlights the Item Response Theory (IRT that, in principle, came to complete limitations of the Classical Test Theory, which is widely used until nowadays in the measurement of psychological traits. The main point of IRT is that it takes into account the item in particular, not relieving the total scores; therefore, the findings do not only depend on the test or questionnaire

  3. A combined noble gas and {sup 40}Ar-{sup 39}Ar study of Salt Lake Crater xenolith SL322 from Oahu, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Trieloff, M. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Rocholl, A. [Heidelberg Univ. (Germany). Mineralogisch-Petrographisches Inst.; Jessberger, E.K. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany)]|[Muenster Univ. (Germany). Inst. fuer Planetologie

    1998-12-31

    The microdistribution of noble gases in a garnet pyroxenite nodule from Salt Lake Crater (SLC), Oahu, Hawaii, was investigated by a detailed step-heating and -crushing analysis and a {sup 40}Ar-{sup 39}Ar-study. A noble gas component with MORB type argon, helium and neon resides in CO{sub 2}-rich fluid inclusions trapped in <30 km depth. This component was most probably derived from the nephelinitic SLC host magma and confirms the dominance of MORB type noble gases in the late post-erosional magmatic stages of Hawaiian volcanism, as suggested previsouly (Kurz et al., 1983; Valbracht et al., 1996). A second previously detected (Rocholl et al., 1996) low {sup 40}Ar/{sup 36}Ar ({proportional_to}5000) component turned out to be associated with two different reservoirs. The larger reservoir is most probably related to garnet, the other one is associated with low retentive sites containing few K and Cl and could not yet be adequately identified. The low {sup 40}Ar/{sup 36}Ar ({proportional_to}5000) component hosted by garnet can be interpreted as a mixture of MORB and plume type noble gas components with specific {sup 4}He/{sup 40}Ar ratios. The results demonstrate the complexity of the microdistribution of noble gases in ultramafic nodules and allow insight into plume induced metasomatism of the Hawaiian lithosphere. (orig.)

  4. HNBR/AO80共混阻尼橡胶的结构和性能%Structure and Properties of Vulcanized HNBR/AO80 Damping Rubbers

    Institute of Scientific and Technical Information of China (English)

    王爽; 张继华; 赵云峰

    2013-01-01

    在氢化丁腈橡胶(HNBR)中添加受阻酚AO80,制备HNBR/AO80共混橡胶,以改善HNBR的阻尼性能.采用DMA和FTIR等方法研究了HNBR/AO80共混硫化体系结构和性能之间的关系,并通过热处理的方法,研究了该体系的稳定性.结果表明:由于AO80的羟基与HNBR的腈基间强氢键作用,使HNBR/AO80硫化体系具有较好的阻尼性能.而热处理后,硫化体系中一些与橡胶分子有氢键作用的AO80,会不断自聚形成AO80的富相区、结晶、长大,形成大的结晶聚集体,导致共混体系的阻尼性能不稳定.%In order to improve the damping properties of hydrogenated nitrilebutadiene rubber (HNBR ) ,3,9-bis[ 1, 1-dimethyl-21 {β-(3-tertbutyl-4-hydroxy-5-methylphenyl) propionyloxy} ethyl ] -2,4,8,10-tetraoxaspi-ro [ 5, 5 ] -undecane (AO80) were added into it to prepare the vulcanized HNBR/AO80 rubbers. The relationship between the damping properties and micro-structure of this blending system was characterized by DMA & FTIR. Then the stability of this system was studied by thermal treatment at 8011. The results showed good damping property of this blending system, which was due to the effect of intermolecular hydrogen bonds between the hydroxyl groups of AO80 and the nitrile groups of HNBR. But the damping property of this curing system become unstable after thermal treated because of the self polymerization of AO80. With the increasing of thermal treated time, large number of AO80 formed rich phase,crystallized,grewed up,then formed large crystallise aggregates.

  5. Li^+ attachment mass spectrometric investigation of high-mass neutral species in the downstream region of Ar/CF4, Ar/CF4/O2 and Ar/CF4/H2 plasmas

    Science.gov (United States)

    Furuya, Kenji; Okumura, Hiroshi; Tamai, Yuji; Ide, Akihiro; Harata, Akira

    2008-10-01

    Recently gaseous high-mass species have received significant attentions as important contributors to the nucleation of films and particulates in fluorocarbon plasmas. We have unambiguously identified the gaseous high-mass neutral species in the downstream region of the Ar/CF4 plasma [1], using the Li^+ attachment ionization technique that is a fragment-free ionization method. In this report, we show the results of mass analysis of high-mass neutral species in the Ar/CF4/O2 and Ar/CF4/H2 plasmas as well as Ar/CF4. In the Ar/CF4 plasma, we observed CnF2n+2 (n = 2-7) and CnF2n (n = 4-8) as neutral species. Adding O2 to the Ar/CF4 plasma resulted in the intensity decrease of CnF2n+2 and CnF2n, especially of those with relatively small n values. CnF2nO (n = 1-7) were newly observed in the Ar/CF4/O2 plasma. In contrast, adding H2 to the Ar/CF4 plasma resulted in the production of various new compounds, such as CnF2n-2 (n=3-8), CnF2n-4 (n=3-9), CnF2n+1H (n=1-7), CnF2n-1H (n=2-8), CnF2n-3H (n=4-9) and CnF2n-5H (n=5-9). These species are produced through the abstraction of F from various CnFm species by the H radical and the addition of H to them. [1] K. Furuya, S. Yukita, H. Okumura, A. Harata, Chem. Lett. 34, 224 (2005).

  6. TSEE from aluminas and spinels subjected to Ar+-ion irradiation

    International Nuclear Information System (INIS)

    TSEE from Ar+-ion and/or X-ray irradiated alumina and spinel was investigated. A TSEE peak at 150 deg C from X-ray irradiated alumina was suppressed when the alumina was further irradiated by Ar+-ions. A TSEE peak at 300 deg C was observed for Ar+-ion irradiated alumina and was suppressed by the combined effect of Ar+-ion and X-ray irradiations. Only weak TSEE peaks were observed between 250 and 350 deg C in Ar+-ion irradiated spinels. Generally, sprayed spinel specimens showed weaker TSEE peaks than the specimens of a single-crystal spinel. This is attributable to the fact that a plasma-sprayed spinel becomes amorphous more easily than its single crystals. X-ray irradiated spinel single-crystal showed well-defined TSEE when they were not irradiated with Ar+-ions. (author)

  7. Further support for a Cretaceous age for the feathered-dinosaur beds of Liaoning,China:New 40Ar/39Ar dating of the Yixian and Tuchengzi Formations

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    We report new 40Ar/39Ar dating results obtained from total fusion and incremental-heating analyses of sanidine and biotite from three tuffs found interbedded within the fossil-bearing deposits of Liaoning, northeast China. The first is a new sample of the Bed 6 Sihetun tuff from the Yixian Formation, previously dated by our team as middle Early Cretaceous, and recently considered by Lo et al., partially reset due to metamorphism from a nearby basaltic sill. The second is the Yixian Bed 9 tuff from Hengdaozi considered by Lo et al. to be unaffected by metamorphism and whose age, based on total fusion 40Ar/39Ar dating of biotite, argues for a Jurassic age for the Yixian Formation.The third tuff is a previously undated tuff from the upper part of the underlying Tuchengzi Formation. Single crystal total fusion 40Ar/39Ar analyses of the Sihetun sanidine showed homogeneous radiogenic Ar, Ca/K ratios, excellent reproducibility and gave a mean age of 125.0 ± 0.18 (1SD) ±0.04 (SE) Ma. Single sanidine crystal total fusion 40Ar/39Aranalyses of the Hengdaozi tuff gave a mean age of 125.0 +0.19 (1SD) ± 0.04 (SE) Ma, which is indistinguishable from the Sihetun tuff. The Tuchengzi Formation tuff gave a mean age of 139.4 ± 0.19 (1SD) ± 0.05 (SE) Ma. Detailed laser incremental-heating analyses of biotite from Sihetun, Hengdaozi, and Tuchengzi tuffs show disturbed Ar release patterns and evidence of trapped argon components. We conclude from these analyses that the total fusion dates on biotite by Lo et al. are erroneously old and isotopic dating of both biotite and sanidine from tuffs of the Yixian Formation point to a middle Early Cretaceous age. The upper part of the Tuchengzi Formation can be referred to the Early Cretaceous.``

  8. Wavelength shifting reflector foils for liquid Ar scintillation light

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Manuel [Physik Institut, Universitaet Zuerich (Switzerland); Collaboration: GERDA-Collaboration

    2013-07-01

    Liquid argon is used as a scintillator in several present and upcoming experiments. In Gerda it is used as a coolant, shielding and will be instrumented to become an active veto in Phase II. Its scintillation light has a wavelength of 128 nm, that gets absorbed by quartz. In order to measure the light using photo multiplier tubes (PMT) for cryogenic temperatures which have a quartz window, it is converted to longer wavelength by coated reflector foils. The conversion efficiency and stability of several such coatings was optimized using VM2000 and Tetratex separately as reflector foils. The efficiency has been measured in a liquid Ar set up build especially for this purpose. It employs a 3'' low radioactivity PMT of type R11065-10 from Hamamatsu, the favorite photo sensor candidate to be used in Gerda.

  9. Modification of surface properties of polyethylene by Ar plasma discharge

    Energy Technology Data Exchange (ETDEWEB)

    Svorcik, V. [Department of Solid State Engineering, Institute of Chemical Technology, Technicka 5, 166 28 Prague (Czech Republic)]. E-mail: vaclav.svorcik@vscht.cz; Kotal, V. [Department of Solid State Engineering, Institute of Chemical Technology, Technicka 5, 166 28 Prague (Czech Republic); Slepicka, P. [Department of Solid State Engineering, Institute of Chemical Technology, Technicka 5, 166 28 Prague (Czech Republic); Blahova, O. [Department of Mechanics, Faculty of Applied Sciences, University of West Bohemia, Univerzitni 22, 306 14 Plzen (Czech Republic); Spirkova, M. [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovskeho Sq. 2, 162 06 Prague (Czech Republic); Sajdl, P. [Department of Power Engineering, Institute of Chemical Technology, 166 28 Prague (Czech Republic); Hnatowicz, V. [Nuclear Physics Institute, Academy of Sciences of the Czech Republic, 250 68 Rez (Czech Republic)

    2006-03-15

    Polyethylene (PE) surface was modified by Ar plasma discharge. The changes of surface morphology and surface wettability (characterized by contact angle) were followed using AFM microscopy and standard goniometry, respectively. The changes of chemical structure of PE polymeric chain were characterized by FTIR and XPS techniques. A nanoindenter was used to study mechanical properties (microhardness, elasticity module and microscratch test) of modified PE. After exposition to the plasma discharge a fast decline of the contact angle is observed. The decline depends on the discharge power and the time elapsed from the plasma exposition. FTIR and XPS measurements indicate an oxidation of degraded polymeric chains and creation of hydroxyl, carbonyl, ether, ester and carboxyl groups. Surface morphology of modified PE depends on the plasma discharge power and exposure time. Maximum microhardness and elastic module, observed on PE specimens exposed to plasma discharge for 240 s, may be connected with PE crosslinking initiated by plasma discharge.

  10. Microanalysis of Ar and He bombarded biomedical polymer films

    Energy Technology Data Exchange (ETDEWEB)

    Manso Silvan, M. [Departamento de Fisica Aplicada C-XII, Universidad Autonoma de Madrid, 28049 Madrid (Spain)]. E-mail: miguel.manso@uam.es; Gago, R. [Departamento de Fisica Aplicada C-XII, Universidad Autonoma de Madrid, 28049 Madrid (Spain); Centro de Microanalisis de Materiales, Universidad Autonoma de Madrid, 28049 Madrid (Spain); Valsesia, A. [European Commission, Institute for Health and Consumer Protection, Via Enrico Fermi, 21020 Ispra (Italy); Climent Font, A. [Departamento de Fisica Aplicada C-XII, Universidad Autonoma de Madrid, 28049 Madrid (Spain); Centro de Microanalisis de Materiales, Universidad Autonoma de Madrid, 28049 Madrid (Spain); Duart, J.M. Martinez [Departamento de Fisica Aplicada C-XII, Universidad Autonoma de Madrid, 28049 Madrid (Spain); Rossi, F. [European Commission, Institute for Health and Consumer Protection, Via Enrico Fermi, 21020 Ispra (Italy)

    2007-04-15

    Implantations onto polyethyleneglycol, polycaprolactone and polymethylmethacrylate, carried out with Ar and He ions at 25 and 100 KeV with fluences of 5 x 10{sup 13} cm{sup -2}, have been made with identical ion currents (20 {mu}A) but different sweep areas in order to take into account the effect of the ion flux on the composition and structure of these biopolymers. Vibrational (Fourier transformed infrared spectroscopy), microanalytical (Rutherford backscattering and energy recoil detection) and microscopic techniques (atomic force microscopy) confirm that, even in this low fluence regime, the ion flux effect is responsible of scaled modifications. More interestingly, these techniques indicate that the damage seems to be higher for He. All these factors suggest that He could be preferentially used to engineer biomedical polymers exploiting the tailoring opportunities offered by ion flux effects.

  11. A Model of White Dwarf Pulsar AR Scorpii

    CERN Document Server

    Geng, Jin-Jun; Huang, Yong-Feng

    2016-01-01

    A 3.56-hour white dwarf (WD) - M dwarf (MD) close binary system, AR Scorpii, was recently reported to show pulsating emission in radio, IR, optical, and UV, with a 1.97-minute period, which suggests the existence of a WD with a rotation period of 1.95 minutes. We propose a model to explain the temporal and spectral characteristics of the system. The WD is a nearly perpendicular rotator, with both open field line beams sweeping the MD stellar wind periodically. A bow shock propagating into the stellar wind accelerates electrons in the wind. Synchrotron radiation of these shocked electrons can naturally account for the broad-band (from radio to X-rays) spectral energy distribution of the system.

  12. A contribution to the comparison of 39Ar and 14C concentrations in the groundwater

    International Nuclear Information System (INIS)

    This study reports about the comparative 39Ar and 14C concentration measurements performed on a sandstone aquifer in the Saarland. From the results a region suitable for the groundwater determination could be established, which also considers the limestone strata covering one water withdrawal site. The effects and influences of a subterranean 39Ar production in such an aquifer can be neglected, since the production ranges below 1% of 39Ar modern. (orig.)

  13. The burden of allergic rhinitis (AR) in Canada: perspectives of physicians and patients

    OpenAIRE

    Keith Paul K; Desrosiers Martin; Laister Tina; Schellenberg R; Waserman Susan

    2012-01-01

    Abstract Background Allergic rhinitis (AR) is a common problem and we sought to examine the burden of disease and its management in Canada from the perspectives of patients and physicians. Methods Two parallel, Canadawide structured telephone interviews surveyed 1,001 AR patients and 160 physicians in July 2006. Results 44% of patients had experienced nasal symptoms unrelated to a cold and 20% had a physician diagnosis of AR. At screening 27% reported asthma, 15% chronic or recurrent sinusiti...

  14. 39Ar measurements on samples extracted from ocean water. Final report

    International Nuclear Information System (INIS)

    The penetration into the ocean of disturbance at the atmosphere-ocean interface is studied by the analysis of transient tracers like bomb-produced 14C, 3H and anthropogenic 85Kr and freons, and of radioactive isotopes produced by cosmic radiation in the atmosphere, like pre-nuclear 14C and 39Ar. This paper discusses the use of 39Ar and gives examples of measurements of 39Ar taken in the Atlantic and Pacific Oceans

  15. A yeast mutation that stabilizes a plasmid bearing a mutated ARS1 element.

    OpenAIRE

    Thrash-Bingham, C; Fangman, W L

    1989-01-01

    To identify the trans-acting factors involved in autonomously replicating sequence (ARS) function, we initiated a screen for Saccharomyces cerevisiae mutants capable of stabilizing a plasmid that contains a defective ARS element. The amm (altered minichromosome maintenance) mutations recovered in this screen defined at least four complementation groups. amm1, a mutation that has been studied in detail, gave rise to a 17-fold stabilization of one defective ARS1 plasmid over the level seen in w...

  16. Testing coeffcients of AR and bilinear time series models by a graphical approach

    Institute of Scientific and Technical Information of China (English)

    IP; WaiCheung

    2008-01-01

    AR and bilinear time series models are expressed as time series chain graphical models, based on which, it is shown that the coefficients of AR and bilinear models are the conditional correlation coefficients conditioned on the other components of the time series. Then a graphically based procedure is proposed to test the significance of the coeffcients of AR and bilinear time series. Simulations show that our procedure performs well both in sizes and powers.

  17. Experiencia en el cuidado de enfermería: herida de abdomen abierto en el adulto Experiência no cuidado de enfermagem: ferida de abdômen aberto em adultos Nursing care experience: open abdomen wound in adults

    Directory of Open Access Journals (Sweden)

    Ricardo Alfonso Castro Becerra

    2011-12-01

    -truturada feita ao profissional de enfermagem da Clínica de feridas que foi tomada como referência, servindo de guia na qual é recomendado aprofundar em pesquisas posteriores. Resultados: um protocolo de cuidados de enfermagem é estruturado e integrado por doze (12 diagramas de fluxo, agrupados e distribuídos em quatro lineamentos básicos. Conclusões: O protocolo é o resultado da descrição e análise, dos procedimentos realizados pelo pessoal de enfermagem, contando com uma ampla experiência no cuidado de pessoas com feridas de abdômen, à luz da literatura. No entanto, a continuação da estruturação deste protocolo é necessária, levando em conta tanto o processo de cicatrização quanto as dimensões psicossociais que intervém no cuidado dos adultos com feridas abertas no abdômen.Goal: the creation of a nursing protocol for adults with open abdomen wounds, in a State-owned social enterprise of the city of Bogota. Method: a descriptive and transversal study, whose sample was constituted by four (4 people with an open abdomen wound, and the contribution of the experience of the institution's professional nurse. The information gathered from an observation guide, from the photographic register of the evolution of four adults with an open abdomen wound and from a semi-structured interview made to a nursing professional form the Wound Clinics taken as reference, which serves as a guide and should be used further in future researches. Results: a nursing protocol is created, and is composed by twelve (12 flowcharts, grouped and divided in four basic guidelines. Conclusions: the protocol is the result of the description and analysis of the procedures performed by the nursing staff, who has a rich experience in the care of people with open abdomen wounds thanks to literature available to them. However, the construction of the protocol must be continued, taking into consideration not only the physiological aspect of the scarification process, but also the psychosocial

  18. Planktic foraminifer census data from Northwind Ridge cores PI-88-AP P3, PI-88-AR P7 and PI-88-AR P9, Arctic Ocean

    Science.gov (United States)

    Foley, Kevin M.; Poore, Richard Z.

    1993-01-01

    The U.S. Geological Survey recovered 9 piston cores from the Northwind Ridge in the Canada Basin of the Arctic Ocean from a cruise of the USCGC Polar Star during 1988. Preliminary analysis of the cores suggests sediments deposited on Northwind Ridge preserve a detailed record of glacial and interglacial cycles for the last few hundred-thousand to one million years. This report includes quantitative data on foraminifers and selected sediment size-fraction data in 98 samples from Northwind Ridge core PI-88AR P3, 51 samples from core PI-88-AR P7 and 117 samples from core PI-88-AR P9.

  19. Tracking the timing of subduction and exhumation using 40Ar/39Ar phengite ages in blueschist- and eclogite-facies rocks (Sivrihisar, Turkey)

    Science.gov (United States)

    Fornash, Katherine F.; Cosca, Michael A.; Whitney, Donna L.

    2016-07-01

    Geochronologic studies of high-pressure/low-temperature rocks can be used to determine the timing and rates of burial and exhumation in subduction zones by dating different stages of the pressure-temperature history. In this study, we present new in situ UV laser ablation 40Ar/39Ar phengite ages from a suite of lawsonite blueschist- and eclogite-facies rocks representing different protoliths (metabasalt, metasediment), different structural levels (within and outside of a high-strain zone), and different textural positions (eclogite pod core vs. margin) to understand the timing of these events in an exhumed Neo-Tethyan subduction zone (Sivrihisar Massif, Tavşanlı Zone, Turkey). Weighted mean in situ 40Ar/39Ar ages of phengite from the cores of lawsonite eclogite pods (90-93 Ma) are distinctly older than phengite from retrogressed, epidote eclogite (82 ± 2 Ma). These ages are interpreted as the age of peak and retrograde metamorphism, respectively. Eclogite records the narrowest range of ages (10-14 m.y.) of any rock type analyzed. Transitional eclogite- and blueschist-facies assemblages and glaucophane-rimmed lawsonite + garnet + phengite veins from eclogite pod margins record a much wider age range of 40Ar/39Ar ages (~20 m.y.) with weighted mean ages of ~91 Ma. Blueschists and quartzites record more variable 40Ar/39Ar ages that may in part be related to structural position: samples within a high-strain zone at the tectonic contact of the HP rocks with a meta-ultramafic unit have in situ UV laser ablation 40Ar/39Ar ages of 84.0 ± 1.3-103.7 ± 3.1 Ma, whereas samples outside this zone range to older ages (84.6 ± 2.4-116.7 ± 2.7 Ma) and record a greater age range (22-38 m.y.). The phengite ages can be correlated with the preservation of HP mineral assemblages and fabrics as well as the effects of deformation. Collectively, these results show that high-spatial resolution UV laser ablation 40Ar/39Ar phengite data, when considered in a petrologic and structural

  20. Arsenic phytoextraction and hyperaccumulation by fern species Fitoextração e hiperacumulação de arsênio por espécies de samambaias

    Directory of Open Access Journals (Sweden)

    Maria Isidoria Silva Gonzaga

    2006-02-01

    Full Text Available Arsenic (As is an ubiquitous trace metalloid found in all environmental media. Its presence at elevated concentrations in soils derives from both anthropogenic and natural inputs. Arsenic is a toxic and carcinogenic element, which has caused severe environmental and health problem worldwide. Technologies currently available for the remediation of arsenic-contaminated sites are expensive, environmentally disruptive, and potentially hazardous to workers. Phytoextraction, a strategy of phytoremediation, uses plants to clean up contaminated soils and has been successfully applied to arsenic contaminated soils. It has the advantage of being cost-effective and environmentally friendly. A major step towards the development of phytoextraction of arsenic-impacted soils is the discovery of the arsenic hyper accumulation in ferns, first in Pteris vittata, which presented an extraordinary capacity to accumulate 2.3% arsenic in its biomass. Another fern, Pityrogramma calomelanos was found to exhibit the same hyperaccumulating characteristics. After that, screening experiments have revealed that the Pteris genus is really unique in that many species have the potential to be used in phytoextraction of arsenic. In general, these plants seem to have both constitutive and adaptive mechanisms for accumulating or tolerating high arsenic concentration. In the past few years, much work has been done to understand and improve the hyperaccumulating capability of these amazing plants. In particular, the field of molecular biology seems to hold the key for the future of the phytoremediation.O arsênio e um metalóide traço encontrado basicamente em todos os ambientes. Elevadas concentrações de arsênio no solo podem acontecer naturalmente devido ao intemperismo de rochas ricas em arsênio, como também de atividades antropogênicas. O arsênio é um elemento tóxico e cancerígeno. Em muitas partes do mundo, a contaminação pelo arsênio tem causado problemas