DEFF Research Database (Denmark)
Kongerslev, Mickey; Bo, Sune; Simonsen, Erik
2011-01-01
Aims: To test the validity of an age-appropriate adaptation of the Standardised Assessment of Personality - Abbreviated Scale (SAPAS) in a sample of incarcerated male youth Method: A sample of incarcerated boys, age 15 to 18, were administered the SAPAS by social workers from the participating pr...
DEFF Research Database (Denmark)
Bukh, Jens Drachmann; Bock, Camilla; Vinberg, Maj
2010-01-01
for comorbid personality disorder among patients suffering from depression would be of clinical use. METHOD: The present study aimed to assess the utility of the Standardised Assessment of Personality - Abbreviated Scale (SAPAS) as a screen for personality disorder in a population of patients recently......BACKGROUND: Personality disorder frequently co-occurs with depression and seems to be associated with a poorer outcome of treatment and increased risk for recurrences. However, the diagnosing of personality disorder can be lengthy and requires some training. Therefore, a brief screening interview...... diagnosed with first episode depression. A total number of 394 patients with an ICD-10 diagnosis of a single depressive episode were sampled consecutively via the Danish Psychiatric Central Research Register during a 2years inclusion period and assessed by the screening interview and, subsequently...
Directory of Open Access Journals (Sweden)
Maryam Sepehri
2017-06-01
Full Text Available Introduction: A short screening tool for high-risk individuals with personality disorder (PD is useful both for clinicians and researchers. The aim of this study was to assess the validity and reliability of the Farsi version of the Standardized Assessment of Personality-Abbreviated Scale (SAPAS. Methods: The original English version of the SAPAS questionnaire was translated into Farsi, and then, translated back into English by two professionals. A survey was then conducted using the questionnaire on 150 clients of primary health care centers in Tabriz, Iran. A total of 235 medical students were also studied for the reliability assessment of the questionnaire. The SAPAS was compared to the short form of Minnesota Multiphasic Personality Inventory (MMPI. The data analysis was performed using receiver operating characteristic (ROC curve technique, operating characteristic for diagnostic efficacy, Cronbach's alpha, and test-retest for reliability evaluation. Results: We found an area under the curve (AUC of 0.566 [95% confidence intervals (CI: 0.455-0.677]; sensitivity of 0.89 and specificity of 0.26 at the cut-off score of 2 and higher. The total Cronbach's alpha coefficient was 0.38 and Cohen's kappa ranged between 0.5 and 0.8. Conclusion: The current study showed that the Farsi version of the SAPAS was relatively less efficient, in term of validity and reliability, in the screening of PD in the population.
Innocent, Simeon; Podder, Priyanka; Ram, Jai Ranjan; Barnicot, Kirsten; Sen, Piyal
2018-02-01
Personality disorders (PDs) are common among psychiatric outpatients and are associated with increased morbidity and worse treatment outcomes. Epidemiological research conducted among this population in Asian countries is limited, reflecting a significant gap in the current literature. One barrier to this research is the lack of appropriate screening tools. The current research assessed the feasibility of using the SAPAS (Standardized Assessment of Personality-Abbreviated Scale) screening tool to identify individuals at high risk of PD in an Indian psychiatric outpatient population and provides an initial estimate of PD prevalence by using a validated diagnostic interview, the ICD-10 International Personality Disorder Examination. The findings suggest that whilst use of the SAPAS was feasible, acceptable to patients and led to clinically useful findings, when using the recommended cut-off score of 4, the SAPAS largely overdiagnoses the risk for PD in psychiatric outpatients in India (positive predictive value = 26.3%). The estimated prevalence of personality disorder in the sample was 11.1%, based on administering the International Personality Disorder Examination diagnostic interview to high-risk patients scoring 4 and above on the SAPAS, which is higher than previous estimates for this population and still likely to be an underestimation. Future studies should translate the measure into Bengali and evaluate its sensitivity and specificity at different cut-off points in order to optimize its use in Indian populations. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.
Venus - 3D Perspective View of Sapas Mons
1992-01-01
Sapas Mons is displayed in the center of this computer-generated three-dimensional perspective view of the surface of Venus. The viewpoint is located 527 kilometers (327 miles) northwest of Sapas Mons at an elevation of 4 kilometers (2.5 miles) above the terrain. Lava flows extend for hundreds of kilometers across the fractured plains shown in the foreground to the base of Sapas Mons. The view is to the southeast with Sapas Mons appearing at the center with Maat Mons located in the background on the horizon. Sapas Mons, a volcano 400 kilometers (248 miles) across and 1.5 kilometers (0.9 mile) high is located at approximately 8 degrees north latitude, 188 degrees east longitude, on the western edge of Atla Regio. Its peak sits at an elevation of 4.5 kilometers (2.8 miles) above the planet's mean elevation. Sapas Mons is named for a Phoenician goddess. The vertical scale in this perspective has been exaggerated 10 times. Rays cast in a computer intersect the surface to create a three-dimensional perspective view. Simulated color and a digital elevation map developed by the U.S. Geological Survey are used to enhance small-scale structure. The simulated hues are based on color images recorded by the Soviet Venera 13 and 14 spacecraft. The image was produced by the Solar System Visualization project and the Magellan Science team at the JPL Multimission Image Processing Laboratory and is a single frame from a video released at the April 22, 1992 news conference.
SAPA Paradigma Baru Sistem Akuntansi Sektor Publik dalam Pelaksanaan Otonomi Daerah
Directory of Open Access Journals (Sweden)
Lilis Setiatiti
2016-01-01
Full Text Available With the enactment of the law on regional autonomy and its implementing regulations, has led to changes in many aspects of local government birokrase environment. SAPA is a new paradigm scores within the public accounting system in anticipation of the implementation of regional autonomy. SAPA give a new alternative in local government accounting system previously used single entry. SAPA implementation is expected to improve the performance and direction of pemangunan area. By SAPA performance reports will be more comprehensive local, regional wealth will always be detected, accounting more secure, can be used as a reference for more accurate budgeting. Besides, the SAPA accounting information will be more accurate for local governments to make decisions because of the financial statements which are presented not only with cash flow considerations.
Development of the Abbreviated Masculine Gender Role Stress Scale.
Swartout, Kevin M; Parrott, Dominic J; Cohn, Amy M; Hagman, Brett T; Gallagher, Kathryn E
2015-06-01
Data gathered from 6 independent samples (n = 1,729) that assessed men's masculine gender role stress in college and community males were aggregated used to determine the reliability and validity of an abbreviated version of the Masculine Gender Role Stress (MGRS) Scale. The 15 items with the highest item-to-total scale correlations were used to create an abbreviated MGRS Scale. Psychometric properties of each of the 15 items were examined with item response theory (IRT) analysis, using the discrimination and threshold parameters. IRT results showed that the abbreviated scale may hold promise at capturing the same amount of information as the full 40-item scale. Relative to the 40-item scale, the total score of the abbreviated MGRS Scale demonstrated comparable convergent validity using the measurement domains of masculine identity, hypermasculinity, trait anger, anger expression, and alcohol involvement. An abbreviated MGRS Scale may be recommended for use in clinical practice and research settings to reduce cost, time, and patient/participant burden. Additionally, IRT analyses identified items with higher discrimination and threshold parameters that may be used to screen for problematic gender role stress in men who may be seen in routine clinical or medical practice. (c) 2015 APA, all rights reserved).
Test Review: Wechsler Abbreviated Scale of Intelligence, Second Edition
Irby, Sarah M.; Floyd, Randy G.
2013-01-01
The Wechsler Abbreviated Scale of Intelligence, Second Edition (WASI-II; Wechsler, 2011) is a brief intelligence test designed for individuals aged 6 through 90 years. It is a revision of the Wechsler Abbreviated Scale of Intelligence (WASI; Wechsler, 1999). During revision, there were three goals: enhancing the link between the Wechsler…
Directory of Open Access Journals (Sweden)
José Gil
2011-04-01
Full Text Available El diagnóstico serológico de la infección producida por Trypanosoma cruzi es de especial relevancia dado que los métodos parasitológicos tienen, en las fases indeterminada y crónica, una sensibilidad limitada. El antígeno SAPA fue usado en diversos estudios y demostró ser un buen candidato para el diagnóstico de la infección por T. cruzi. La enfermedad de Chagas y la leishmaniasis son endémicas en el norte de Salta, con posibles zonas de solapamiento. Este hecho suele dar lugar a infecciones mixtas T. cruzi-Leishmania spp., con la consecuente probabilidad de diagnóstico cruzado cuando se usan antígenos no específicos. Se evaluó la reactividad del antígeno GST-SAPA en la prueba de ELISA (ELISA-SAPA frente a sueros de personas infectadas por T. cruzi (n = 154, con leishmaniasis (n = 66, infecciones mixtas (n = 29 y controles negativos (n = 28, usando como pruebas de referencia para el diagnóstico de la infección por T. cruzi kits comerciales de ELISA y HAI. Se calculó la sensibilidad, especificidad e índice de concordancia kappa de la prueba de ELISA-SAPA, para la detección de infección por T. cruzi. Entre los sueros de pacientes con leishmaniasis estudiados se detectó un 30.5% de infecciones mixtas. Para la detección de infección por T. cruzi, ELISA-SAPA mostró una sensibilidad del 97.1% (intervalo de confianza del 95%: 94.5-99.9, una especificidad del 100% (intervalo de confianza del 95%: 99.5-100 y un índice de concordancia kappa de 96 (intervalo de confianza del 95%:93-99%, comparado con las pruebas serológicas comerciales. Los valores de sensibilidad, especificidad y concordancia calculados muestran una alta eficiencia de ELISA-SAPA.Serologic diagnosis of Trypanosoma cruzi infection is important due to the limited sensitivity of direct parasitologic methods for diagnosis in the indeterminate and chronic phases of disease. SAPA antigen has been used in several studies and has been shown to be a good marker for use
Test Review: Review of the Wechsler Abbreviated Scale of Intelligence, Second Edition (WASI-II)
McCrimmon, Adam W.; Smith, Amanda D.
2013-01-01
The Wechsler Abbreviated Scale of Intelligence, Second Edition (WASI-II; Wechsler, 2011), published by Pearson, is a newly updated abbreviated measure of cognitive intelligence designed for individuals 6 to 90 years of age. Primarily used in clinical, psychoeducational, and research settings, the WASI-II was developed to quickly and accurately…
False Color Image of Volcano Sapas Mons
1991-01-01
This false-color image shows the volcano Sapas Mons, which is located in the broad equatorial rise called Atla Regio (8 degrees north latitude and 188 degrees east longitude). The area shown is approximately 650 kilometers (404 miles) on a side. Sapas Mons measures about 400 kilometers (248 miles) across and 1.5 kilometers (0.9 mile) high. Its flanks show numerous overlapping lava flows. The dark flows on the lower right are thought to be smoother than the brighter ones near the central part of the volcano. Many of the flows appear to have been erupted along the flanks of the volcano rather than from the summit. This type of flank eruption is common on large volcanoes on Earth, such as the Hawaiian volcanoes. The summit area has two flat-topped mesas, whose smooth tops give a relatively dark appearance in the radar image. Also seen near the summit are groups of pits, some as large as one kilometer (0.6 mile) across. These are thought to have formed when underground chambers of magma were drained through other subsurface tubes and lead to a collapse at the surface. A 20 kilometer-diameter (12-mile diameter) impact crater northeast of the volcano is partially buried by the lava flows. Little was known about Atla Regio prior to Magellan. The new data, acquired in February 1991, show the region to be composed of at least five large volcanoes such as Sapas Mons, which are commonly linked by complex systems of fractures or rift zones. If comparable to similar features on Earth, Atla Regio probably formed when large volumes of molten rock upwelled from areas within the interior of Venus known as'hot spots.' Magellan is a NASA spacecraft mission to map the surface of Venus with imaging radar. The basic scientific instrument is a synthetic aperture radar, or SAR, which can look through the thick clouds perpetually shielding the surface of Venus. Magellan is in orbit around Venus which completes one turn around its axis in 243 Earth days. That period of time, one Venus day
Validation Study of the Abbreviated Math Anxiety Scale: Spanish Adaptation
Brown, Jennifer L.; Sifuentes, Lucía Macías
2016-01-01
With growing numbers of Hispanic students enrolling in post-secondary school, there is a need to increase retention and graduation rates. The purpose of this study was to validate the Spanish adaptation of the Abbreviated Math Anxiety Scale (AMAS). The AMAS was translated and administered to 804 freshman students at a post-secondary institution in…
DEFF Research Database (Denmark)
Guldager, Steen; Linneberg, Inger Holm; Hesse, Morten
2012-01-01
of Personality – Abbreviated Scale (SAPAS), completed the MCMI-III, the Beck Anxiety Inventory (BAI), and were rated with the Montgomery Åsberg Depression Rating Scale. Age at onset was lowest for conduct disorder/antisocial behaviour, followed by tasting alcohol, trying drugs, post-traumatic stress disorder...... for non-substance related disorder in 72%. Patients reporting that their axis I disorder predated their SUD reported more severe problems currently on the BAI and the SAPAS. Patients reporting that their conduct disorder/antisocial personality disorder criteria predated their SUD reported more aggressive......-sadistic personality traits than patients reporting that SUD predated conduct disorder/antisocial personality, but did not differ in terms of antisocial personality disorder traits. The findings are discussed in terms of their clinical implications....
Vélez Lopera, Johana María; Berbesí Fernández, Dedsy; Cardona Arango, Doris; Segura Cardona, Angela; Ordóñez Molina, Jaime
2012-07-01
To determine which abbreviated Zarit Scale (ZS) better evaluates the burden of the caregiver of an elderly patient in Medellin, Colombia. Validation study. Primary Care setting in the city of Medellin. Primary caregiver of dependent elderly patients over 65 years old. Sensitivity, specificity, positive predictive value, and negative predictive value for the different abbreviated Zarit scales, plus performing a reliability analysis using the Cronbach Alpha coefficient. The abbreviated scales obtained a sensitivity of between 36.84 and 81.58%, specificity between 95.99 and 100%, positive predictive values between 71.05 and 100%, and negative predictive values of between 91.64 and 97.42%. The scale that better determined caregiver burden in Primary Care was the Bedard Screening scale, with a sensitivity of 81.58%, a specificity of 96.35% and positive and negative predictive values of 75.61% and 97.42%, respectively. Copyright © 2010 Elsevier España, S.L. All rights reserved.
Introduction of the Abbreviated Westmead Post-Traumatic Amnesia Scale and Impact on Length of Stay
Watson, C. E.; Clous, E. A.; Jaeger, M.; D'Amours, S. K.
2017-01-01
Mild traumatic brain injury is a common presentation to Emergency Departments. Early identification of patients with cognitive deficits and provision of discharge advice are important. The Abbreviated Westmead Post-traumatic Amnesia Scale provides an early and efficient assessment of post-traumatic
The Neighborhood Environment Walkability Scale (NEWS) and its abbreviated form (NEWS-A) assess perceived environmental attributes believed to influence physical activity. A multilevel confirmatory factor analysis (MCFA) conducted on a sample from Seattle, WA, showed that, at the respondent level, th...
Abbreviations in Maritime English
Yang, Zhirong
2011-01-01
Aiming at the phenomena that more and more abbreviations occur in maritime English correspondences, the composing laws of the abbreviations in maritime English correspondence are analyzed, and the correct methods to answer the abbreviations are pointed out, and the translation method of abbreviations are summarized in this article, and the…
A Confirmatory Factor Analysis of the Structure of Abbreviated Math Anxiety Scale
Directory of Open Access Journals (Sweden)
Farahman Farrokhi
2011-06-01
Full Text Available "nObjective: The aim of this study is to explore the confirmatory factor analysis results of the Persian adaptation of Abbreviated Math Anxiety Scale (AMAS, proposed by Hopko, Mahadevan, Bare & Hunt. "nMethod: The validity and reliability assessments of the scale were performed on 298 college students chosen randomly from Tabriz University in Iran. The confirmatory factor analysis (CFA was carried out to determine the factor structures of the Persian version of AMAS. "nResults: As expected, the two-factor solution provided a better fit to the data than a single factor. Moreover, multi-group analyses showed that this two-factor structure was invariant across sex. Hence, AMAS provides an equally valid measure for use among college students. "nConclusions: Brief AMAS demonstrates adequate reliability and validity. The AMAS scores can be used to compare symptoms of math anxiety between male and female students. The study both expands and adds support to the existing body of math anxiety literature.
FDA Acronyms and Abbreviations
U.S. Department of Health & Human Services — The FDA Acronyms and Abbreviations database provides a quick reference to acronyms and abbreviations related to Food and Drug Administration (FDA) activities
Hsu, L-F; Hung, C-L; Kuo, L-J; Tsai, P-S
2017-09-01
No instrument is available to assess the impact of faecal incontinence (FI) of quality of life for Chinese-speaking population. The purpose of the study was to adapt the Faecal Incontinence Quality of Life Scale (FIQL) for patients with colorectal cancer, assess the factor structure and reduce the items for brevity. A sample of 120 participants were enrolled. Internal consistency, test-retest reliability, and convergent and contrasted-groups validity were assessed. Construct validity was analysed using an exploratory and confirmatory factor analyses (CFA). The internal consistency (Cronbach's α of the total scale and four subscales = 0.98 and 0.97, 0.96, 0.92, 0.82 respectively), test-retest reliability (intraclass correlation coefficients ≥.98 for all scales with p < .001) and significant correlations of all scales with selected subscales of the Medical Outcomes Study 36-Item Short-Form Health Survey and the Wexner scale suggested satisfactory reliability and validity. The severe FI group (with a Wexner score ≥9) scored significantly lower on the scale than the less severe FI group (with a Wexner score <9) did (p < .001). The CFA supported a two-factor structure and demonstrated an excellent model fit of the 15-item abbreviated version of the FIQL-Chinese. The FIQL-Chinese has satisfactory validity and reliability and the abbreviated version may be more practical and applicable. © 2016 John Wiley & Sons Ltd.
East Part of Sapas Mons with Flooded Crater
1991-01-01
This Magellan image centered near 9.6 degrees north latitude, 189.5 degrees east longitude of an area 140 kilometers (87 miles) by 110 kilometers (68 miles) covers part of the eastern flank of the volcano Sapas Mons on the western edge of Atla Regio. The bright lobate features along the southern and the western part of the image, oriented in northeast to southwest directions, are lava flows that are rough at the 12.6 centimeter wavelength of the radar. These flows range in width from 5 kilometers to 25 kilometers (3 to 16 miles) with lengths of 50 kilometers to 100 kilometers (31 to 62 miles), extending off the area shown here. Additional radar-dark (smooth) flows are also present. The radar-bright linear structures in the northwest part of the image are interpreted to be faults and fractures possibly associated with the emplacement of magma in the subsurface. Located near the center of the image is a 20 kilometer (12 mile) diameter impact crater. This crater is superimposed on a northeast/southwest trending fracture while the southern part of the crater's ejecta blanket is covered by a 6 kilometer (4 mile) wide radar-bright lava flow. These relations indicate that the crater post dates an episode of fracturing and is older than the lava flows covering its southern edge. This is one of only a few places on Venus in which an impact crater is seen to be covered by volcanic deposits.
The Modified Abbreviated Math Anxiety Scale: A Valid and Reliable Instrument for Use with Children.
Carey, Emma; Hill, Francesca; Devine, Amy; Szűcs, Dénes
2017-01-01
Mathematics anxiety (MA) can be observed in children from primary school age into the teenage years and adulthood, but many MA rating scales are only suitable for use with adults or older adolescents. We have adapted one such rating scale, the Abbreviated Math Anxiety Scale (AMAS), to be used with British children aged 8-13. In this study, we assess the scale's reliability, factor structure, and divergent validity. The modified AMAS (mAMAS) was administered to a very large ( n = 1746) cohort of British children and adolescents. This large sample size meant that as well as conducting confirmatory factor analysis on the scale itself, we were also able to split the sample to conduct exploratory and confirmatory factor analysis of items from the mAMAS alongside items from child test anxiety and general anxiety rating scales. Factor analysis of the mAMAS confirmed that it has the same underlying factor structure as the original AMAS, with subscales measuring anxiety about Learning and Evaluation in math. Furthermore, both exploratory and confirmatory factor analysis of the mAMAS alongside scales measuring test anxiety and general anxiety showed that mAMAS items cluster onto one factor (perceived to represent MA). The mAMAS provides a valid and reliable scale for measuring MA in children and adolescents, from a younger age than is possible with the original AMAS. Results from this study also suggest that MA is truly a unique construct, separate from both test anxiety and general anxiety, even in childhood.
Hyland, Philip; Shevlin, Mark; Adamson, Gary; Boduszek, Daniel
2014-01-01
The Attitudes and Belief Scale-2 (ABS-2: DiGiuseppe, Leaf, Exner, & Robin, 1988. The development of a measure of rational/irrational thinking. Paper presented at the World Congress of Behavior Therapy, Edinburg, Scotland.) is a 72-item self-report measure of evaluative rational and irrational beliefs widely used in Rational Emotive Behavior Therapy research contexts. However, little psychometric evidence exists regarding the measure's underlying factor structure. Furthermore, given the length of the ABS-2 there is a need for an abbreviated version that can be administered when there are time demands on the researcher, such as in clinical settings. This study sought to examine a series of theoretical models hypothesized to represent the latent structure of the ABS-2 within an alternative models framework using traditional confirmatory factor analysis as well as utilizing a bifactor modeling approach. Furthermore, this study also sought to develop a psychometrically sound abbreviated version of the ABS-2. Three hundred and thirteen (N = 313) active emergency service personnel completed the ABS-2. Results indicated that for each model, the application of bifactor modeling procedures improved model fit statistics, and a novel eight-factor intercorrelated solution was identified as the best fitting model of the ABS-2. However, the observed fit indices failed to satisfy commonly accepted standards. A 24-item abbreviated version was thus constructed and an intercorrelated eight-factor solution yielded satisfactory model fit statistics. Current results support the use of a bifactor modeling approach to determining the factor structure of the ABS-2. Furthermore, results provide empirical support for the psychometric properties of the newly developed abbreviated version.
MBA: a literature mining system for extracting biomedical abbreviations.
Xu, Yun; Wang, ZhiHao; Lei, YiMing; Zhao, YuZhong; Xue, Yu
2009-01-09
The exploding growth of the biomedical literature presents many challenges for biological researchers. One such challenge is from the use of a great deal of abbreviations. Extracting abbreviations and their definitions accurately is very helpful to biologists and also facilitates biomedical text analysis. Existing approaches fall into four broad categories: rule based, machine learning based, text alignment based and statistically based. State of the art methods either focus exclusively on acronym-type abbreviations, or could not recognize rare abbreviations. We propose a systematic method to extract abbreviations effectively. At first a scoring method is used to classify the abbreviations into acronym-type and non-acronym-type abbreviations, and then their corresponding definitions are identified by two different methods: text alignment algorithm for the former, statistical method for the latter. A literature mining system MBA was constructed to extract both acronym-type and non-acronym-type abbreviations. An abbreviation-tagged literature corpus, called Medstract gold standard corpus, was used to evaluate the system. MBA achieved a recall of 88% at the precision of 91% on the Medstract gold-standard EVALUATION Corpus. We present a new literature mining system MBA for extracting biomedical abbreviations. Our evaluation demonstrates that the MBA system performs better than the others. It can identify the definition of not only acronym-type abbreviations including a little irregular acronym-type abbreviations (e.g., ), but also non-acronym-type abbreviations (e.g., ).
McArthur-Bates Communicative Development Inventory (CDI: Proposal of an abbreviate version
Directory of Open Access Journals (Sweden)
Chamarrita Farkas Klein
2011-01-01
Full Text Available The McArthur-Bates Communicative Development Inventories (CDI assesses language development en children, through a significant caregiver report. The first inventory assesses verbal and non verbal language in infants who are from 8 to 18 months old and it is composed of 949 items distributed in 6 scales. This study proposes an abbreviate form of this instrument, and was tested on families and educators of 130 Chilean children of 11-15 months old. Analyses related to the items, reliability and validity of the instrument and factorial analyses of subscales were realized. The abbreviate version consider 241 items distributed in 4 scales. The evaluation of the psychometric properties of the instrument was acceptable, demonstrating adequate reliability and validity.
40 CFR 92.102 - Definitions and abbreviations.
2010-07-01
... the number of carbon atoms in a molecule of that compound. Precision means the standard deviation of... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Definitions and abbreviations. 92.102... Definitions and abbreviations. The definitions and abbreviations of subpart A of this part apply to this...
Adaptation of abbreviated mathematics anxiety rating scale for engineering students
Nordin, Sayed Kushairi Sayed; Samat, Khairul Fadzli; Sultan, Al Amin Mohamed; Halim, Bushra Abdul; Ismail, Siti Fatimah; Mafazi, Nurul Wirdah
2015-05-01
Mathematics is an essential and fundamental tool used by engineers to analyse and solve problems in their field. Due to this, most engineering education programs involve a concentration of study in mathematics courses whereby engineering students have to take mathematics courses such as numerical methods, differential equations and calculus in the first two years and continue to do so until the completion of the sequence. However, the students struggled and had difficulties in learning courses that require mathematical abilities. Hence, this study presents the factors that caused mathematics anxiety among engineering students using Abbreviated Mathematics Anxiety Rating Scale (AMARS) through 95 students of Universiti Teknikal Malaysia Melaka (UTeM). From 25 items in AMARS, principal component analysis (PCA) suggested that there are four mathematics anxiety factors, namely experiences of learning mathematics, cognitive skills, mathematics evaluation anxiety and students' perception on mathematics. Minitab 16 software was used to analyse the nonparametric statistics. Kruskal-Wallis Test indicated that there is a significant difference in the experience of learning mathematics and mathematics evaluation anxiety among races. The Chi-Square Test of Independence revealed that the experience of learning mathematics, cognitive skills and mathematics evaluation anxiety depend on the results of their SPM additional mathematics. Based on this study, it is recommended to address the anxiety problems among engineering students at the early stage of studying in the university. Thus, lecturers should play their part by ensuring a positive classroom environment which encourages students to study mathematics without fear.
Abbreviations used in scientific and technical reports
International Nuclear Information System (INIS)
Sun Chang.
1986-04-01
Reports contain a large number of abbreviations which have not yet been included in the current specialized dictionaries or lists of abbreviations. It is therefore often time-consuming or even fruitless to search for such abbreviations. The present alphabetical list of more than 4,000 abbreviations gathered from the report inventory of the Central Library of the KFA Juelich in the period from 1982-1986, taking into consideration all the scientific and technical disciplines, is intended to remedy a deficiency and to offer assistance which will undoubtedly be welcomed by scientists and engineers. (orig./HP) [de
Acronyms, initialisms, and abbreviations: Fourth Revision
Energy Technology Data Exchange (ETDEWEB)
Tolman, B.J. [comp.
1994-04-01
This document lists acronyms used in technical writing. The immense list is supplemented by an appendix containing chemical elements, classified information access, common abbreviations used for functions, conversion factors for selected SI units, a flowcharting template, greek alphabet, metrix terminology, proofreader`s marks, signs and symbols, and state abbreviations.
Validity and Reliability of the Abbreviated Barratt Impulsiveness Scale in Spanish (BIS-15S)*
Orozco-Cabal, Luis; Rodríguez, Maritza; Herin, David V.; Gempeler, Juanita; Uribe, Miguel
2010-01-01
Objective This study determined the validity and reliability of a new, abbreviated version of the Spanish Barratt Impulsiveness Scale (BIS-15S) in Colombian subjects. Method The BIS-15S was tested in non-clinical (n=283) and clinical (n=164) native Spanish-speakers. Intra-scale reliability was calculated using Cronbach’s α, and test-retest reliability was measured with Pearson correlations. Psychometric properties were determined using standard statistics. A factor analysis was performed to determine BIS-15S factor structure. Results 447 subjects participated in the study. Clinical subjects were older and more educated compared to non-clinical subjects. Impulsivity scores were normally distributed in each group. BIS-15S total, motor, non-planning and attention scores were significantly lower in non-clinical vs. clinical subjects. Subjects with substance-related disorders had the highest BIS-15S total scores, followed by subjects with bipolar disorders and bulimia nervosa/binge eating. Internal consistency was 0.793 and test-retest reliability was 0.80. Factor analysis confirmed a three-factor structure (attention, motor, non-planning) accounting for 47.87% of the total variance in BIS-15S total scores. Conclusions The BIS-15S is a valid and reliable self-report measure of impulsivity in this population. Further research is needed to determine additional components of impulsivity not investigated by this measure. PMID:21152412
Directory of Open Access Journals (Sweden)
Trachtenberg Felicia
2005-10-01
Full Text Available Abstract Background Despite the recent proliferation in research on patient trust, it is seldom a primary outcome, and is often a peripheral area of interest. The length of our original scales to measure trust may limit their use because of the practical needs to minimize both respondent burden and research cost. The objective of this study was to develop three abbreviated scales to measure trust in: (1 a physician, (2 a health insurer, and (3 the medical profession. Methods Data from two samples were used. The first was a telephone survey of English-speaking adults in the United States (N = 1117 and the second was a telephone survey of English-speaking adults residing in North Carolina who were members of a health maintenance organization (N = 1024. Data were analyzed to examine data completeness, scaling assumptions, internal consistency properties, and factor structure. Results Abbreviated measures (5-items were developed for each of the three scales. Cronbach's alpha was 0.87 for trust in a physician (test-retest reliability = 0.71, 0.84 for trust in a health insurer (test-retest reliability = 0.73, and 0.77 for trust in the medical profession. Conclusion Assessment of data completeness, scale score dispersion characteristics, reliability and validity test results all provide evidence for the soundness of the abbreviated 5-item scales.
Raggio, Donald J; Scattone, Dorothy; May, Warren
2010-04-01
This study examines the relationship between the Wechsler Abbreviated Scale of Intelligence (WASI) and the Kaufman Brief Intelligence Test-Second Edition (KBIT-2). Increasingly, psychologists are using brief measures of intelligence, but scant information exists regarding their clinical utility in various populations. 44 children referred for evaluation of ADHD were administered the KBIT-2 and WASI in counterbalanced order. Results of this study indicated the WASI to be a more stable measure of ADHD children's intelligence, that the KBIT-2 Vocabulary scores were significantly lower than the WASI Verbal score, and that there was significant variability within participants.
Link-topic model for biomedical abbreviation disambiguation.
Kim, Seonho; Yoon, Juntae
2015-02-01
The ambiguity of biomedical abbreviations is one of the challenges in biomedical text mining systems. In particular, the handling of term variants and abbreviations without nearby definitions is a critical issue. In this study, we adopt the concepts of topic of document and word link to disambiguate biomedical abbreviations. We newly suggest the link topic model inspired by the latent Dirichlet allocation model, in which each document is perceived as a random mixture of topics, where each topic is characterized by a distribution over words. Thus, the most probable expansions with respect to abbreviations of a given abstract are determined by word-topic, document-topic, and word-link distributions estimated from a document collection through the link topic model. The model allows two distinct modes of word generation to incorporate semantic dependencies among words, particularly long form words of abbreviations and their sentential co-occurring words; a word can be generated either dependently on the long form of the abbreviation or independently. The semantic dependency between two words is defined as a link and a new random parameter for the link is assigned to each word as well as a topic parameter. Because the link status indicates whether the word constitutes a link with a given specific long form, it has the effect of determining whether a word forms a unigram or a skipping/consecutive bigram with respect to the long form. Furthermore, we place a constraint on the model so that a word has the same topic as a specific long form if it is generated in reference to the long form. Consequently, documents are generated from the two hidden parameters, i.e. topic and link, and the most probable expansion of a specific abbreviation is estimated from the parameters. Our model relaxes the bag-of-words assumption of the standard topic model in which the word order is neglected, and it captures a richer structure of text than does the standard topic model by considering
Abbreviations for device names: a proposed methodology with specific examples.
Alam, Murad; Dover, Jeffrey S; Alam, Murad; Goldman, Mitchel P; Kaminer, Michael S; Orringer, Jeffrey; Waldorf, Heidi; Alam, Murad; Avram, Mathew; Cohen, Joel L; Draelos, Zoe Diana; Dover, Jeffrey S; Hruza, George; Kilmer, Suzanne; Lawrence, Naomi; Lupo, Mary; Metelitsa, Andrei; Nestor, Mark; Ross, E Victor
2013-04-01
Many devices used in dermatology lack generic names. If investigators use commercial device names, they risk the appearance of bias. Alternatively, reliance on ad-hoc names and abbreviations may confuse readers who do not recognize these. To develop a system for assigning abbreviations to denote devices commonly used in dermatology. Secondarily, to use this system to create abbreviations for FDA-approved neurotoxins and prepackaged injectable soft-tissue augmentation materials. The American Society for Dermatologic Surgery convened a Lexicon Task Force in March 2012. One charge of this Task Force was to develop criteria for assigning abbreviations to medical devices. A modified consensus process was used. Abbreviations to denote devices were to be: based on a standardized approach; transparent to the casual reader; markedly brief; and in all cases, different than the commercial names. Three-letter all caps abbreviations, some with subscripts, were assigned to denote each of the approved neurotoxins and fillers. A common system of abbreviations for medical devices in dermatology may avoid the appearance of bias while ensuring effective communication. The proposed system may be expanded to name other devices, and the ensuing abbreviations may be suitable for journal articles, continuing medical education lectures, or other academic or clinical purposes. © 2013 by the American Society for Dermatologic Surgery, Inc. Published by Wiley Periodicals, Inc.
Development of abbreviated eight-item form of the Penn Verbal Reasoning Test.
Bilker, Warren B; Wierzbicki, Michael R; Brensinger, Colleen M; Gur, Raquel E; Gur, Ruben C
2014-12-01
The ability to reason with language is a highly valued cognitive capacity that correlates with IQ measures and is sensitive to damage in language areas. The Penn Verbal Reasoning Test (PVRT) is a 29-item computerized test for measuring abstract analogical reasoning abilities using language. The full test can take over half an hour to administer, which limits its applicability in large-scale studies. We previously described a procedure for abbreviating a clinical rating scale and a modified procedure for reducing tests with a large number of items. Here we describe the application of the modified method to reducing the number of items in the PVRT to a parsimonious subset of items that accurately predicts the total score. As in our previous reduction studies, a split sample is used for model fitting and validation, with cross-validation to verify results. We find that an 8-item scale predicts the total 29-item score well, achieving a correlation of .9145 for the reduced form for the model fitting sample and .8952 for the validation sample. The results indicate that a drastically abbreviated version, which cuts administration time by more than 70%, can be safely administered as a predictor of PVRT performance. © The Author(s) 2014.
Development of Abbreviated Eight-Item Form of the Penn Verbal Reasoning Test
Bilker, Warren B.; Wierzbicki, Michael R.; Brensinger, Colleen M.; Gur, Raquel E.; Gur, Ruben C.
2014-01-01
The ability to reason with language is a highly valued cognitive capacity that correlates with IQ measures and is sensitive to damage in language areas. The Penn Verbal Reasoning Test (PVRT) is a 29-item computerized test for measuring abstract analogical reasoning abilities using language. The full test can take over half an hour to administer, which limits its applicability in large-scale studies. We previously described a procedure for abbreviating a clinical rating scale and a modified procedure for reducing tests with a large number of items. Here we describe the application of the modified method to reducing the number of items in the PVRT to a parsimonious subset of items that accurately predicts the total score. As in our previous reduction studies, a split sample is used for model fitting and validation, with cross-validation to verify results. We find that an 8-item scale predicts the total 29-item score well, achieving a correlation of .9145 for the reduced form for the model fitting sample and .8952 for the validation sample. The results indicate that a drastically abbreviated version, which cuts administration time by more than 70%, can be safely administered as a predictor of PVRT performance. PMID:24577310
Global change: Acronyms and abbreviations
Energy Technology Data Exchange (ETDEWEB)
Woodard, C.T. [Oak Ridge National Lab., TN (United States); Stoss, F.W. [Univ. of Tennessee, Knoxville, TN (United States). Energy, Environment and Resources Center
1995-05-01
This list of acronyms and abbreviations is compiled to provide the user with a ready reference to dicipher the linguistic initialisms and abridgements for the study of global change. The terms included in this first edition were selected from a wide variety of sources: technical reports, policy documents, global change program announcements, newsletters, and other periodicals. The disciplinary interests covered by this document include agriculture, atmospheric science, ecology, environmental science, oceanography, policy science, and other fields. In addition to its availability in hard copy, the list of acronyms and abbreviations is available in DOS-formatted diskettes and through CDIAC`s anonymous File Transfer Protocol (FTP) area on the Internet.
Czech Academy of Sciences Publication Activity Database
He, J.; Chen, J.; Hellwich, K. H.; Hess, M.; Horie, K.; Jones, R. G.; Kahovec, Jaroslav; Kitayama, T.; Kratochvíl, Pavel; Meille, S. V.; Mita, I.; dos Santos, C.; Vert, M.; Vohlídal, J.
2014-01-01
Roč. 86, č. 6 (2014), s. 1003-1015 ISSN 0033-4545 Institutional support: RVO:61389013 Keywords : abbreviations * IUPAC Polymer Division * polymer names Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.492, year: 2014
Abbreviations: Their Effects on Comprehension of Classified Advertisements.
Sokol, Kirstin R.
Two experimental designs were used to test the hypothesis that abbreviations in classified advertisements decrease the reader's comprehension of such ads. In the first experimental design, 73 high school students read four ads (for employment, used cars, apartments for rent, and articles for sale) either with abbreviations or with all…
Checklist of Abbreviations and Acronyms in the Physics Literature.
Bailey, Martha J.
This document provides a listing of 500 abbreviations and acronyms related to physics with the definition of each. Each abbreviation was used in journals received by the Purdue University Physics Library during the years 1973-1976. (SL)
Allie: a database and a search service of abbreviations and long forms
Yamamoto, Yasunori; Yamaguchi, Atsuko; Bono, Hidemasa; Takagi, Toshihisa
2011-01-01
Many abbreviations are used in the literature especially in the life sciences, and polysemous abbreviations appear frequently, making it difficult to read and understand scientific papers that are outside of a reader’s expertise. Thus, we have developed Allie, a database and a search service of abbreviations and their long forms (a.k.a. full forms or definitions). Allie searches for abbreviations and their corresponding long forms in a database that we have generated based on all titles and abstracts in MEDLINE. When a user query matches an abbreviation, Allie returns all potential long forms of the query along with their bibliographic data (i.e. title and publication year). In addition, for each candidate, co-occurring abbreviations and a research field in which it frequently appears in the MEDLINE data are displayed. This function helps users learn about the context in which an abbreviation appears. To deal with synonymous long forms, we use a dictionary called GENA that contains domain-specific terms such as gene, protein or disease names along with their synonymic information. Conceptually identical domain-specific terms are regarded as one term, and then conceptually identical abbreviation-long form pairs are grouped taking into account their appearance in MEDLINE. To keep up with new abbreviations that are continuously introduced, Allie has an automatic update system. In addition, the database of abbreviations and their long forms with their corresponding PubMed IDs is constructed and updated weekly. Database URL: The Allie service is available at http://allie.dbcls.jp/. PMID:21498548
Abbreviations [Annex to The Fukushima Daiichi Accident, Technical Volume 2/5
International Nuclear Information System (INIS)
2015-01-01
This annex is a list of abbreviations used in the publication The Fukushima Daiichi Accident, Technical Volume 2/5. The list includes the abbreviations for: • Agency for Natural Resources and Energy; • essential service water; • International Nuclear and Radiological Event Scale;• Integrated Regulatory Review Service; • Japan Atomic Energy Agency; • Japan Atomic Energy Commission; • Japan Power Engineering and Inspection Corp; • Japan Nuclear Energy Safety Organization; • low head safety injection; • low level radioactive waste; • Madras Atomic Power Station; • main control room; • Ministry of Economy, Trade and Industry; • Ministry of Education, Culture, Sports, Science and Technology; • Ministry of International Trade and Industry; • Ministry of Foreign Affairs; • Nuclear and Industrial Safety Agency; • Nuclear Power Corporation of India Limited; • nuclear power plant; • Nuclear Safety Commission; • Nuclear Power Engineering Corporation; • Nuclear Safety Technology Centre; • Onahama Port; • pressurized water reactor; • Science and Technology Agency; • Tokyo Electric Power Company
Frequency, comprehension and attitudes of physicians towards abbreviations in the medical record.
Hamiel, Uri; Hecht, Idan; Nemet, Achia; Pe'er, Liron; Man, Vitaly; Hilely, Assaf; Achiron, Asaf
2018-05-01
Abbreviations are common in the medical record. Their inappropriate use may ultimately lead to patient harm, yet little is known regarding the extent of their use and their comprehension. Our aim was to assess the extent of their use, their comprehension and physicians' attitudes towards them, using ophthalmology consults in a tertiary hospital as a model. We first mapped the frequency with which English abbreviations were used in the departments' computerised databases. We then used the most frequently used abbreviations as part of a cross-sectional survey designed to assess the attitudes of non-ophthalmologist physicians towards the abbreviations and their comprehension of them. Finally, we tested whether an online lecture would improve comprehension. 4375 records were screened, and 235 physicians responded to the survey. Only 42.5% knew at least 10% of the abbreviations, and no one knew them all. Ninety-two per cent of respondents admitted to searching online for the meanings of abbreviations, and 59.1% believe abbreviations should be prohibited in medical records. A short online lecture improved the number of respondents answering correctly at least 50% of the time from 1.2% to 42% (Pmedical records and are frequently misinterpreted. Online teaching is a valuable tool for physician education. The majority of respondents believed that misinterpreting abbreviations could negatively impact patient care, and that the use of abbreviations should be prohibited in medical records. Due to low rates of comprehension and negative attitudes towards abbreviations in medical communications, we believe their use should be discouraged. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Schnettler, Berta; Grunert, Klaus G; Miranda-Zapata, Edgardo; Orellana, Ligia; Sepúlveda, José; Lobos, Germán; Hueche, Clementina; Höger, Yesli
2017-06-01
The aims of this study were to test the relationships between food neophobia, satisfaction with food-related life and food technology neophobia, distinguishing consumer segments according to these variables and characterizing them according to willingness to purchase food produced with novel technologies. A survey was conducted with 372 university students (mean aged=20.4years, SD=2.4). The questionnaire included the Abbreviated version of the Food Technology Neophobia Scale (AFTNS), Satisfaction with Life Scale (SWLS), and a 6-item version of the Food Neophobia Scale (FNS). Using confirmatory factor analysis, it was confirmed that SWFL correlated inversely with FNS, whereas FNS correlated inversely with AFTNS. No relationship was found between SWFL and AFTNS. Two main segments were identified using cluster analysis; these segments differed according to gender and family size. Group 1 (57.8%) possessed higher AFTNS and FNS scores than Group 2 (28.5%). However, these groups did not differ in their SWFL scores. Group 1 was less willing to purchase foods produced with new technologies than Group 2. The AFTNS and the 6-item version of the FNS are suitable instruments to measure acceptance of foods produced using new technologies in South American developing countries. The AFTNS constitutes a parsimonious alternative for the international study of food technology neophobia. Copyright © 2017 Elsevier Ltd. All rights reserved.
Common Medical Abbreviations and Terminology: Modularized Instruction for Nurses.
Moseley, James L.
A learning module to introduce nurses to the main medical abbreviations and often-used prefixes and suffixes is presented. Learning objectives of the module are: to provide the definitions of often-used suffixes and prefixes, and to identify definitions of medical abbreviations. The following materials are presented: a pretest consisting of 30…
2010-01-01
... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Abbreviations. 995.5 Section 995.5 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) NATIONAL OCEANIC... Survey SENCSystem Electronic Navigational Chart SOLASSafety of Life at Sea VADValue Added Distributor ...
Abbreviated protocol for breast MRI: Are multiple sequences needed for cancer detection?
International Nuclear Information System (INIS)
Mango, Victoria L.; Morris, Elizabeth A.; David Dershaw, D.; Abramson, Andrea; Fry, Charles; Moskowitz, Chaya S.; Hughes, Mary; Kaplan, Jennifer; Jochelson, Maxine S.
2015-01-01
Highlights: • Abbreviated breast MR demonstrates high sensitivity for breast carcinoma detection. • Time to perform/interpret the abbreviated exam is shorter than a standard MRI exam. • An abbreviated breast MRI could reduce costs and make MRI screening more available. - Abstract: Objective: To evaluate the ability of an abbreviated breast magnetic resonance imaging (MRI) protocol, consisting of a precontrast T1 weighted (T1W) image and single early post-contrast T1W image, to detect breast carcinoma. Materials and methods: A HIPAA compliant Institutional Review Board approved review of 100 consecutive breast MRI examinations in patients with biopsy proven unicentric breast carcinoma. 79% were invasive carcinomas and 21% were ductal carcinoma in situ. Four experienced breast radiologists, blinded to carcinoma location, history and prior examinations, assessed the abbreviated protocol evaluating only the first post-contrast T1W image, post-processed subtracted first post-contrast and subtraction maximum intensity projection images. Detection and localization of tumor were compared to the standard full diagnostic examination consisting of 13 pre-contrast, post-contrast and post-processed sequences. Results: All 100 cancers were visualized on initial reading of the abbreviated protocol by at least one reader. The mean sensitivity for each sequence was 96% for the first post-contrast sequence, 96% for the first post-contrast subtraction sequence and 93% for the subtraction MIP sequence. Within each sequence, there was no significant difference between the sensitivities among the 4 readers (p = 0.471, p = 0.656, p = 0.139). Mean interpretation time was 44 s (range 11–167 s). The abbreviated imaging protocol could be performed in approximately 10–15 min, compared to 30–40 min for the standard protocol. Conclusion: An abbreviated breast MRI protocol allows detection of breast carcinoma. One pre and post-contrast T1W sequence may be adequate for detecting
Abbreviated protocol for breast MRI: Are multiple sequences needed for cancer detection?
Energy Technology Data Exchange (ETDEWEB)
Mango, Victoria L., E-mail: vlm2125@columbia.edu [Columbia University Medical Center, Herbert Irving Pavilion, 161 Fort Washington Avenue, 10th Floor, New York, NY 10032 (United States); Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States); Morris, Elizabeth A., E-mail: morrise@mskcc.org [Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States); David Dershaw, D., E-mail: dershawd@mskcc.org [Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States); Abramson, Andrea, E-mail: abramsoa@mskcc.org [Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States); Fry, Charles, E-mail: charles_fry@nymc.edu [Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States); New York Medical College, 40 Sunshine Cottage Rd, Valhalla, NY 10595 (United States); Moskowitz, Chaya S. [Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States); Hughes, Mary, E-mail: hughesm@mskcc.org [Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States); Kaplan, Jennifer, E-mail: kaplanj@mskcc.org [Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States); Jochelson, Maxine S., E-mail: jochelsm@mskcc.org [Memorial Sloan-Kettering Cancer Center, Breast and Imaging Center, 300 East 66th Street, New York, NY 10065 (United States)
2015-01-15
Highlights: • Abbreviated breast MR demonstrates high sensitivity for breast carcinoma detection. • Time to perform/interpret the abbreviated exam is shorter than a standard MRI exam. • An abbreviated breast MRI could reduce costs and make MRI screening more available. - Abstract: Objective: To evaluate the ability of an abbreviated breast magnetic resonance imaging (MRI) protocol, consisting of a precontrast T1 weighted (T1W) image and single early post-contrast T1W image, to detect breast carcinoma. Materials and methods: A HIPAA compliant Institutional Review Board approved review of 100 consecutive breast MRI examinations in patients with biopsy proven unicentric breast carcinoma. 79% were invasive carcinomas and 21% were ductal carcinoma in situ. Four experienced breast radiologists, blinded to carcinoma location, history and prior examinations, assessed the abbreviated protocol evaluating only the first post-contrast T1W image, post-processed subtracted first post-contrast and subtraction maximum intensity projection images. Detection and localization of tumor were compared to the standard full diagnostic examination consisting of 13 pre-contrast, post-contrast and post-processed sequences. Results: All 100 cancers were visualized on initial reading of the abbreviated protocol by at least one reader. The mean sensitivity for each sequence was 96% for the first post-contrast sequence, 96% for the first post-contrast subtraction sequence and 93% for the subtraction MIP sequence. Within each sequence, there was no significant difference between the sensitivities among the 4 readers (p = 0.471, p = 0.656, p = 0.139). Mean interpretation time was 44 s (range 11–167 s). The abbreviated imaging protocol could be performed in approximately 10–15 min, compared to 30–40 min for the standard protocol. Conclusion: An abbreviated breast MRI protocol allows detection of breast carcinoma. One pre and post-contrast T1W sequence may be adequate for detecting
40 CFR 91.4 - Acronyms and abbreviations.
2010-07-01
....—United States Code VOC—Volatile organic compounds ZROD—zirconium dioxide sensor ...) CONTROL OF EMISSIONS FROM MARINE SPARK-IGNITION ENGINES General § 91.4 Acronyms and abbreviations. The...
Twomey, Conal; O'Connell, Helen; Lillis, Mary; Tarpey, Sarah Louise; O'Reilly, Gary
2018-03-01
The fifth edition of the Stanford-Binet Intelligence scales allows 'full scale' IQ (FSIQ) to be estimated using an abridged version of the test-the abbreviated battery IQ (ABIQ). Set within a public early intervention team service, the current cross-sectional study investigated the utility of the ABIQ in estimating FSIQ for 40 children with autism spectrum disorder (ASD) aged 3-5 years. A strong ABIQ-FSIQ association was yielded (r = 0.89; r 2 = 0.808) and the ABIQ did not over-estimate mean FSIQ above a clinically-relevant threshold; however, clinically significant over-estimation occurred in 17.5% of individual cases. While the findings provide support for the utility of the ABIQ in estimating FSIQ for young children with ASD, caution relating to the over-estimation of FSIQ is warranted. Careful clinical judgment-ideally based on examination of previous cognitive assessment results (if available), thorough interactional observations, and close multi-disciplinary consultation-is necessary to determine the applicability of the ABIQ to individual cases. Autism Res 2018, 11: 503-508. © 2017 International Society for Autism Research, Wiley Periodicals, Inc. We investigated the utility of a shortened version of the Stanford-Binet Intelligence Scales in estimating IQ for 40 young children with autism spectrum disorder (ASD). The findings provide qualified support for the instrument: acceptably accurate IQ estimation was achieved for most cases; but not so for a sizeable minority (17.5%). Careful clinical judgment is necessary to determine the applicability of the ABIQ to individual cases. © 2017 International Society for Autism Research, Wiley Periodicals, Inc.
Fasting abbreviation among patients submitted to oncologic surgery: systematic review
PINTO, Andressa dos Santos; GRIGOLETTI, Shana Souza; MARCADENTI, Aline
2015-01-01
INTRODUCTION: The abbreviation of perioperative fasting among candidates to elective surgery have been associated with shorter hospital stay and decreased postoperative complications. OBJECTIVE: To conduct a systematic review from randomized controlled trials to detect whether the abbreviation of fasting is beneficial to patients undergoing cancer surgery compared to traditional fasting protocols. METHOD: A literature search was performed in electronic databases: MEDLINE (PubMed), SciELO...
Abajas Bustillo, Rebeca; Leal Costa, César; Ortego Mate, María Del Carmen; Zonfrillo, Mark R; Seguí Gómez, María; Durá Ros, María Jesús
2018-02-01
To explore differences in severity classifications according to 2 versions of the Abbreviated Injury Scale (AIS): version 2005 (the 2008 update) and the earlier version 98. To determine whether possible differences might have an impact on identifying severe trauma patients. Descriptive study and cross-sectional analysis of a case series of patients admitted to two spanish hospitals with out-of-hospital injuries between February 2012 and February 2013. For each patient we calculated the Injury Severity Score (ISS), the New Injury Severity Score (NISS), and the AIS scores according to versions 98 and 2005. The sample included 699 cases. The mean Severity (SD) age of patients was 52.7 (29.2) years, and 388 (55.5%) were males. Version 98 of the AIS correlated more strongly with both the ISS (2.6%) and the NISS (2.9%). The 2008 update of the AIS (version 2005) classified fewer trauma patients than version 98 at the severity levels indicated by the ISS and NISS.
40 CFR 1042.905 - Symbols, acronyms, and abbreviations.
2010-07-01
... symbols, acronyms, and abbreviations apply to this part: ABTAveraging, banking, and trading. AECDauxiliary.... cylcylinder. disp.displacement. ECAEmission Control Area. EEZExclusive Economic Zone. EPAEnvironmental...
He Sapa Bloketu Woecun: Remote Sensing at the Heart of Everything That Is
Bolman, J. R.
2007-12-01
We are living in a definite time of change. Distinct changes are being experienced in our most sacred and natural environments. This is especially true on Native Tribal lands. Native people have lived for millennia in distinct and unique ways. The knowledge of balancing the needs of people with the needs of our natural environments is paramount in all tribal societies. This inherent knowledge has become the foundation on which to build a "woven" contemporary understanding of western science and geospatial technologies. The Upper Midwest Aerospace Consortium (UMAC) and the Native Tribes of South Dakota and Northern California have recognized the critical need in developing an understanding of and proficiency in the application of geospatial technologies (remote sensing). The presentation will highlight: 1) the current use of remote sensing in Native Tribal communities of the Great Plains and Northern California; 2) successful partnerships between Native communities, Tribal Colleges, public Universities and private organizations; 3) how to address balancing the needs of the people with the needs of the environment (Climate Change); and 4) the critical need for developing strong Native Leaders, experienced in remote sensing, to lead Tribal, local, state and national communities through the challenges presented by Climate Change. Humboldt State University (HSU) and the Upper Midwest Aerospace Consortium (UMAC) have been recognized nationally for their STEM partnerships with Native Tribal communities. Unique collaborations are emerging "bridging" Native Tribal people across geographic areas in developing remote sensing programs/projects which integrate the distinctive Traditional Ecological Knowledge (TEK) of Native Tribal people. Focus will be placed on the currently funded UMAC & NSF OEDG Project "He Sapa Bloketu Woecun" and the application of geospatial technologies (remote sensing) in the sacred sites of the Black Hills as well as Northern California.
40 CFR 86.203-94 - Abbreviations.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Abbreviations. 86.203-94 Section 86.203-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...
Abbreviations of nuclear power plant engineering
International Nuclear Information System (INIS)
Freyberger, G.H.
1979-01-01
The edition of this English and German list of abbreviations comprises about 5200 entries in English and about 1400 entries in German as well as the most important American, English, German and other foreign Utilities and component manufacturers frequently quoted in nuclear engineering literature and documentation. (orig./HP) [de
New Abbreviations in Colloquial French
Directory of Open Access Journals (Sweden)
Vladimir Pogačnik
2015-12-01
Full Text Available The author of the article treats the process of abbreviations, which he explored forty years ago in his master thesis. The article is based on the corpus created on the basis of Télématin broadcast on French television network TV5. According to the author, clipping is a widespread process that occurs primarily in various forms of oral communication.
Moon, Sungrim; Pakhomov, Serguei; Liu, Nathan; Ryan, James O; Melton, Genevieve B
2014-01-01
To create a sense inventory of abbreviations and acronyms from clinical texts. The most frequently occurring abbreviations and acronyms from 352,267 dictated clinical notes were used to create a clinical sense inventory. Senses of each abbreviation and acronym were manually annotated from 500 random instances and lexically matched with long forms within the Unified Medical Language System (UMLS V.2011AB), Another Database of Abbreviations in Medline (ADAM), and Stedman's Dictionary, Medical Abbreviations, Acronyms & Symbols, 4th edition (Stedman's). Redundant long forms were merged after they were lexically normalized using Lexical Variant Generation (LVG). The clinical sense inventory was found to have skewed sense distributions, practice-specific senses, and incorrect uses. Of 440 abbreviations and acronyms analyzed in this study, 949 long forms were identified in clinical notes. This set was mapped to 17,359, 5233, and 4879 long forms in UMLS, ADAM, and Stedman's, respectively. After merging long forms, only 2.3% matched across all medical resources. The UMLS, ADAM, and Stedman's covered 5.7%, 8.4%, and 11% of the merged clinical long forms, respectively. The sense inventory of clinical abbreviations and acronyms and anonymized datasets generated from this study are available for public use at http://www.bmhi.umn.edu/ihi/research/nlpie/resources/index.htm ('Sense Inventories', website). Clinical sense inventories of abbreviations and acronyms created using clinical notes and medical dictionary resources demonstrate challenges with term coverage and resource integration. Further work is needed to help with standardizing abbreviations and acronyms in clinical care and biomedicine to facilitate automated processes such as text-mining and information extraction.
Cheung, Stephanie; Hoi, Sannifer; Fernandes, Olavo; Huh, Jin; Kynicos, Sara; Murphy, Laura; Lowe, Donna
2018-04-01
Dangerous abbreviations on the Institute for Safe Medication Practices Canada's "Do Not Use" list have resulted in medication errors leading to harm. Data comparing rates of use of dangerous abbreviations in paper and electronic medication orders are limited. To compare rates of use of dangerous abbreviations from the "Do Not Use" list, in paper and electronic medication orders. Secondary objectives include determining the proportion of patients at risk for medication errors due to dangerous abbreviations and the most commonly used dangerous abbreviations. One-day cross-sectional audits of medication orders were conducted at a 6-site hospital network in Toronto, Canada, between December 2013 and January 2014. Proportions of paper and electronic medication orders containing dangerous abbreviation(s) were compared using a χ 2 test. The proportion of patients with at least 1 medication order containing dangerous abbreviation(s) and the top 5 dangerous abbreviations used were described. Overall, 255 patient charts were reviewed. The proportions of paper and electronic medication orders containing dangerous abbreviation(s) were 172/714 (24.1%) and 9/2207 (0.4%), respectively ( P < 0.001). Almost one-third of patients had medication order(s) containing dangerous abbreviation(s). The proportions of patients with at least 1 medication order during the audit period containing dangerous abbreviation(s) for patients with paper only, electronic only, or a hybrid of paper and electronic medication orders were 50.5%, 5%, and 47.2%, respectively. Those most commonly used were "D/C", drug name abbreviations, "OD," "cc," and "U." Electronic medication orders have significantly lower rates of dangerous abbreviation use compared to paper medication orders.
Moon, Sungrim; Pakhomov, Serguei; Liu, Nathan; Ryan, James O; Melton, Genevieve B
2014-01-01
Objective To create a sense inventory of abbreviations and acronyms from clinical texts. Methods The most frequently occurring abbreviations and acronyms from 352 267 dictated clinical notes were used to create a clinical sense inventory. Senses of each abbreviation and acronym were manually annotated from 500 random instances and lexically matched with long forms within the Unified Medical Language System (UMLS V.2011AB), Another Database of Abbreviations in Medline (ADAM), and Stedman's Dictionary, Medical Abbreviations, Acronyms & Symbols, 4th edition (Stedman's). Redundant long forms were merged after they were lexically normalized using Lexical Variant Generation (LVG). Results The clinical sense inventory was found to have skewed sense distributions, practice-specific senses, and incorrect uses. Of 440 abbreviations and acronyms analyzed in this study, 949 long forms were identified in clinical notes. This set was mapped to 17 359, 5233, and 4879 long forms in UMLS, ADAM, and Stedman's, respectively. After merging long forms, only 2.3% matched across all medical resources. The UMLS, ADAM, and Stedman's covered 5.7%, 8.4%, and 11% of the merged clinical long forms, respectively. The sense inventory of clinical abbreviations and acronyms and anonymized datasets generated from this study are available for public use at http://www.bmhi.umn.edu/ihi/research/nlpie/resources/index.htm (‘Sense Inventories’, website). Conclusions Clinical sense inventories of abbreviations and acronyms created using clinical notes and medical dictionary resources demonstrate challenges with term coverage and resource integration. Further work is needed to help with standardizing abbreviations and acronyms in clinical care and biomedicine to facilitate automated processes such as text-mining and information extraction. PMID:23813539
40 CFR 1060.805 - What symbols, acronyms, and abbreviations does this part use?
2010-07-01
... AND STATIONARY EQUIPMENT Definitions and Other Reference Information § 1060.805 What symbols, acronyms, and abbreviations does this part use? The following symbols, acronyms, and abbreviations apply to this part: °degree. ASTMAmerican Society for Testing and Materials. CCelsius. CFRCode of Federal Regulations...
Abbreviated Combined MR Protocol: A New Faster Strategy for Characterizing Breast Lesions.
Moschetta, Marco; Telegrafo, Michele; Rella, Leonarda; Stabile Ianora, Amato Antonio; Angelelli, Giuseppe
2016-06-01
The use of an abbreviated magnetic resonance (MR) protocol has been recently proposed for cancer screening. The aim of our study is to evaluate the diagnostic accuracy of an abbreviated MR protocol combining short TI inversion recovery (STIR), turbo-spin-echo (TSE)-T2 sequences, a pre-contrast T1, and a single intermediate (3 minutes after contrast injection) post-contrast T1 sequence for characterizing breast lesions. A total of 470 patients underwent breast MR examination for screening, problem solving, or preoperative staging. Two experienced radiologists evaluated both standard and abbreviated protocols in consensus. Sensitivity, specificity, positive predictive value (PPV), negative predictive value (NPV), and diagnostic accuracy for both protocols were calculated (with the histological findings and 6-month ultrasound follow-up as the reference standard) and compared with the McNemar test. The post-processing and interpretation times for the MR images were compared with the paired t test. In 177 of 470 (38%) patients, the MR sequences detected 185 breast lesions. Standard and abbreviated protocols obtained sensitivity, specificity, diagnostic accuracy, PPV, and NPV values respectively of 92%, 92%, 92%, 68%, and 98% and of 89%, 91%, 91%, 64%, and 98% with no statistically significant difference (P < .0001). The mean post-processing and interpretation time were, respectively, 7 ± 1 minutes and 6 ± 3.2 minutes for the standard protocol and 1 ± 1.2 minutes and 2 ± 1.2 minutes for the abbreviated protocol, with a statistically significant difference (P < .01). An abbreviated combined MR protocol represents a time-saving tool for radiologists and patients with the same diagnostic potential as the standard protocol in patients undergoing breast MRI for screening, problem solving, or preoperative staging. Copyright © 2016 Elsevier Inc. All rights reserved.
40 CFR 1051.805 - What symbols, acronyms, and abbreviations does this part use?
2010-07-01
... Definitions and Other Reference Information § 1051.805 What symbols, acronyms, and abbreviations does this part use? The following symbols, acronyms, and abbreviations apply to this part: °—degrees. ASTM—American Society for Testing and Materials. ATV—all-terrain vehicle. cc—cubic centimeters. CFR—Code of...
14 CFR 221.200 - Content and explanation of abbreviations, reference marks and symbols.
2010-01-01
..., reference marks and symbols. 221.200 Section 221.200 Aeronautics and Space OFFICE OF THE SECRETARY... § 221.200 Content and explanation of abbreviations, reference marks and symbols. (a) Content. The format..., reference marks and symbols. Abbreviations, reference marks and symbols which are used in the tariff shall...
Mengatto, Cristiane Machado; Gameiro, Gustavo Hauber; Brondani, Mario; Owen, C Peter; MacEntee, Michael I
The aim of this randomized clinical trial was to test the hypothesis that there are no statistically significant differences after 3 and 6 months in masticatory performance or chewing ability of people with new complete dentures made by an abbreviated or a conventional technique. The trial included 20 edentulous participants at a dental school in Brazil assigned randomly to receive dentures made by either a conventional technique involving six clinical sessions or by an abbreviated technique involving three clinical sessions. At baseline with old dentures and at 3 and 6 months with new dentures, masticatory performance was measured by counting the number of chewing strokes and the time before participants had an urge to swallow and by calculating the medium particle size of a silicone material after 20 chewing strokes and at the urge to swallow. On each occasion, the participants recorded on visual analog scales their ability to chew five food textures. Statistical significance (P ≤ .05) of changes in masticatory performance and chewing ability during the trial were analyzed with generalized estimating equations. Both techniques improved masticatory performance between baseline and 6 months and the ability to bite and chew all foods apart from hard apples. There were no significant differences in masticatory performance or chewing ability after 6 months between complete dentures made by a conventional or an abbreviated technique.
Directory of Open Access Journals (Sweden)
Krzysztof eCipora
2015-11-01
Full Text Available Math anxiety has an important impact on mathematical development and performance. However, although math anxiety is supposed to be a transcultural trait, assessment instruments are scarce and are validated mainly for Western cultures so far. Therefore, we aimed at examining the transcultural generality of math anxiety by a thorough investigation of the validity of math anxiety assessment in Eastern Europe. We investigated the validity and reliability of a Polish adaptation of the Abbreviated Math Anxiety Scale (AMAS, known to have very good psychometric characteristics in its original, American-English version as well as in its Italian and Iranian adaptations.We also observed high reliability, both for internal consistency and test-retest stability of the AMAS in the Polish sample. The results also show very good construct, convergent and discriminant validity: The factorial structure in Polish adult participants (n = 857 was very similar to the one previously found in other samples; AMAS scores correlated moderately in expected directions with state and trait anxiety, self-assessed math achievement and skill as well temperamental traits of emotional reactivity, briskness, endurance and perseverance. Average scores obtained by participants as well as gender differences and correlations with external measures were also similar across cultures. Beyond the cultural comparison, we used path model analyses to show that math anxiety relates to math grades and self-competence when controlling for trait anxiety.The current study shows transcultural validity of math anxiety assessment with the AMAS.
Cipora, Krzysztof; Szczygieł, Monika; Willmes, Klaus; Nuerk, Hans-Christoph
2015-01-01
Math anxiety has an important impact on mathematical development and performance. However, although math anxiety is supposed to be a transcultural trait, assessment instruments are scarce and are validated mainly for Western cultures so far. Therefore, we aimed at examining the transcultural generality of math anxiety by a thorough investigation of the validity of math anxiety assessment in Eastern Europe. We investigated the validity and reliability of a Polish adaptation of the Abbreviated Math Anxiety Scale (AMAS), known to have very good psychometric characteristics in its original, American-English version as well as in its Italian and Iranian adaptations. We also observed high reliability, both for internal consistency and test-retest stability of the AMAS in the Polish sample. The results also show very good construct, convergent and discriminant validity: The factorial structure in Polish adult participants (n = 857) was very similar to the one previously found in other samples; AMAS scores correlated moderately in expected directions with state and trait anxiety, self-assessed math achievement and skill as well temperamental traits of emotional reactivity, briskness, endurance, and perseverance. Average scores obtained by participants as well as gender differences and correlations with external measures were also similar across cultures. Beyond the cultural comparison, we used path model analyses to show that math anxiety relates to math grades and self-competence when controlling for trait anxiety. The current study shows transcultural validity of math anxiety assessment with the AMAS.
Screening for personality disorder in incarcerated adolescent boys
DEFF Research Database (Denmark)
Simonsen, Erik; Kongerslev, Mickey; Moran, Paul
2012-01-01
Background: Personality disorder (PD) is associated with significant functional impairment and an elevated risk of violent and suicidal behaviour. The prevalence of PD in populations of young offenders is likely to be high. However, because the assessment of PD is time-consuming, it is not routin......Background: Personality disorder (PD) is associated with significant functional impairment and an elevated risk of violent and suicidal behaviour. The prevalence of PD in populations of young offenders is likely to be high. However, because the assessment of PD is time...... in adults (Standardised Assessment of Personality – Abbreviated Scale; SAPAS) for use with adolescents and then carried out a study of the reliability and validity of the adapted instrument in a sample of 80 adolescent boys in secure institutions. Participants were administered the screen and shortly after......, and usefulness of the screen in secure institutions for adolescent male offenders. It can be used in juvenile offender institutions with limited resources, as a brief, acceptable, staff-administered routine screen to identify individuals in need of further assessment of PD or by researchers conducting...
Leach, R; McNally, Donal; Bashir, Mohamad; Sastry, Priya; Cuerden, Richard; Richens, David; Field, Mark
2012-10-01
The severity and location of injuries resulting from vehicular collisions are normally recorded in Abbreviated Injury Scale (AIS) code; we propose a system to link AIS code to a description of acute aortic syndrome (AAS), thus allowing the hypothesis that aortic injury is progressive with collision kinematics to be tested. Standard AIS codes were matched with a clinical description of AAS. A total of 199 collisions that resulted in aortic injury were extracted from a national automotive collision database and the outcomes mapped onto AAS descriptions. The severity of aortic injury (AIS severity score) and stage of AAS progression were compared with collision kinematics and occupant demographics. Post hoc power analyses were used to estimate maximum effect size. The general demographic distribution of the sample represented that of the UK population in regard to sex and age. No significant relationship was observed between estimated test speed, collision direction, occupant location or seat belt use and clinical progression of aortic injury (once initiated). Power analysis confirmed that a suitable sample size was used to observe a medium effect in most of the cases. Similarly, no association was observed between injury severity and collision kinematics. There is sufficient information on AIS severity and location codes to map onto the clinical AAS spectrum. It was not possible, with this data set, to consider the influence of collision kinematics on aortic injury initiation. However, it was demonstrated that after initiation, further progression along the AAS pathway was not influenced by collision kinematics. This might be because the injury is not progressive, because the vehicle kinematics studied do not fully represent the kinematics of the occupants, or because an unknown factor, such as stage of cardiac cycle, dominates. Epidemiologic/prognostic study, level IV.
Rabies vaccinations: are abbreviated intradermal schedules the future?
Wieten, R. W.; Leenstra, T.; van Thiel, P. P. A. M.; van Vugt, M.; Stijnis, C.; Goorhuis, A.; Grobusch, M. P.
2013-01-01
Rabies is a deadly disease, and current preexposure vaccination schedules are lengthy and expensive. We identified nine studies investigating abbreviated schedules. Although initial responses were lower, accelerated adequate immune responses were elicited after booster vaccinations. Lower-dose (and
7 CFR 771.2 - Abbreviations and definitions.
2010-01-01
... payment means a payment derived from the sale of property serving as security for a loan, such as real... include a modification of the interest rate and/or repayment terms of the loan. Security means assets... AGRICULTURE SPECIAL PROGRAMS BOLL WEEVIL ERADICATION LOAN PROGRAM § 771.2 Abbreviations and definitions. The...
40 CFR 97.3 - Measurements, abbreviations, and acronyms.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Measurements, abbreviations, and acronyms. 97.3 Section 97.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... electrical. NOX-nitrogen oxides. O2-oxygen. ton-2000 pounds. ...
32 CFR 516.3 - Explanation of abbreviations and terms.
2010-07-01
... Glossary contains explanations of abbreviations and terms. (b) The masculine gender has been used throughout this regulation for simplicity and consistency. Any reference to the masculine gender is intended...
40 CFR 96.3 - Measurements, abbreviations, and acronyms.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Measurements, abbreviations, and acronyms. 96.3 Section 96.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... pounds. CO2—carbon dioxide. NOX—nitrogen oxides. O2—oxygen. ...
Volcano morphometry and volume scaling on Venus
Garvin, J. B.; Williams, R. S., Jr.
1994-01-01
A broad variety of volcanic edifices have been observed on Venus. They ranged in size from the limits of resolution of the Magellan SAR (i.e., hundreds of meters) to landforms over 500 km in basal diameter. One of the key questions pertaining to volcanism on Venus concerns the volume eruption rate or VER, which is linked to crustal productivity over time. While less than 3 percent of the surface area of Venus is manifested as discrete edifices larger than 50 km in diameter, a substantial component of the total crustal volume of the planet over the past 0.5 Ga is related to isolated volcanoes, which are certainly more easily studied than the relatively diffusely defined plains volcanic flow units. Thus, we have focused our efforts on constraining the volume productivity of major volcanic edifices larger than 100 km in basal diameter. Our approach takes advantage of the topographic data returned by Magellan, as well as our database of morphometric statistics for the 20 best known lava shields of Iceland, plus Mauna Loa of Hawaii. As part of this investigation, we have quantified the detailed morphometry of nearly 50 intermediate to large scale edifices, with particular attention to their shape systematics. We found that a set of venusian edifices which include Maat, Sapas, Tepev, Sif, Gula, a feature at 46 deg S, 215 deg E, as well as the shield-like structure at 10 deg N, 275 deg E are broadly representative of the approx. 400 volcanic landforms larger than 50 km. The cross-sectional shapes of these 7 representative edifices range from flattened cones (i.e., Sif) similar to classic terrestrial lava shields such as Mauna Loa and Skjaldbreidur, to rather dome-like structures which include Maat and Sapas. The majority of these larger volcanoes surveyed as part of our study displayed cross-sectional topographies with paraboloidal shaped, in sharp contrast with the cone-like appearance of most simple terrestrial lava shields. In order to more fully explore the
Abbreviated Title of the Artwork in the System of Signs by Ch. Peirce
Directory of Open Access Journals (Sweden)
Grigoriy Valeryevich Tokarev
2015-09-01
Full Text Available The article is devoted to the semiotic aspect of the functioning of the abbreviated title of the postmodern artwork. The authors analyze the relationship of title-sign to the object which it replaces. The title is considered from the perspective of three main features peculiar of the sign in accordance with the Charles S. Peirce's theory. This fact allows us to conclude that, being a sign, the abbreviated title replaces a literary text, which is also expressed in symbolic form of the author's knowledge of reality. In this aspect the title becomes the metasign of its text. It is shown that in this connection, decoding and interpretation process take place in two stages – before reading the text and in the process of its reading and interpretation. It is alleged that the result of the interpretation of the title depends on the reader's competence which is determined by their individual literary scope, as well as by the skills of productive work with the text. On the basis of the classification of signs created by Charles Pierce, it was found that the abbreviated title has a complex semiotic nature combining the features of indexicality, conventionality, and iconicity, the latter of which may be present only in the abbreviated title.
Abbreviations [Annex to The Fukushima Daiichi Accident, Technical Volume 5/5
International Nuclear Information System (INIS)
2015-01-01
This annex is a list of abbreviations used in the publication The Fukushima Daiichi Accident, Technical Volume 5/5. The list includes the abbreviations for: • General Safety Requirements; • International Commission on Radiological Protection; • Intensive Contamination Survey Area; • International Experts Meeting; • Ministry of Education, Culture, Sports, Science and Technology; • Ministry of the Environment; • Nuclear Damage Compensation and Decommissioning Facilitation Corporation; • Nuclear Emergency Response Headquarters; • nuclear power plant; • Nuclear Safety Commission; • OECD Nuclear Energy Agency; • Special Decontamination Area; • Specific Safety Requirements; • technical cooperation; • Three Mile Island; • United Nations Scientific Committee on the Effects of Atomic Radiation
40 CFR 310.4 - What abbreviations should I know?
2010-07-01
... RESPONSE TO HAZARDOUS SUBSTANCE RELEASES General Information § 310.4 What abbreviations should I know? The.... 11000-11050). LEPC—Local Emergency Planning Committee. NCP—National Oil and Hazardous Substances... Response Center. OMB—Office of Management and Budget. PRP—Potentially Responsible Party. SARA—The Superfund...
Gontkovsky, Samuel T
2017-01-01
This case study of a 71-year-old woman illustrates the clinical utility of the Wechsler Abbreviated Scale of Intelligence-Second Edition (WASI-II) in assessing the neurocognitive sequelae of the semantic dementia variant of frontotemporal lobar degeneration. Obtained scores revealed a decline in estimated Full Scale IQ from the patient's expected premorbid level. Consistent with her initial onset of neuropathology in the left temporal lobe, the WASI-II yielded a difference of 53 standard score points between the Perceptual Reasoning and Verbal Comprehension composites, reflecting the patient's intact capabilities in visuospatial perception and construction in conjunction with marked disturbances of language. The similarities subtest was particularly sensitive to the patient's neurocognitive deficits. WASI-II scores corresponded well with the results obtained from other administered measures, in particular those from the Repeatable Battery for the Assessment of Neuropsychological Status. Findings provide support for use of the WASI-II in the clinical evaluation of semantic dementia and offer preliminary evidence that the test may be helpful in both lateralization and localization of brain lesions.
27 CFR 19.612 - Authorized abbreviations to identify marks.
2010-04-01
... T Tax Determined TD Wine Spirits Addition WSA (Sec. 201, Pub. L. 85-859, 72 Stat. 1360, as amended... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Containers and Marks... to identify certain marks: Mark Abbreviation Completely Denatured Alcohol CDA Distilled Spirits...
BUSINESS ENGLISH OUTSIDE THE BOX. BUSINESS JARGON AND ABBREVIATIONS IN BUSINESS COMMUNICATION
Directory of Open Access Journals (Sweden)
Pop Anamaria-Mirabela
2014-12-01
Full Text Available Business English is commonly understood language, yet Harvard Business Review called business jargon “The Silent Killer of Big Companies”. As we all have been taught in school, we are aware of the fact that in communication we must comply with linguistic rules so that our message gets across succinctly. Yet, there is one place where all these rules can be omitted (at least in the recent decades: the corporate office. Here, one can use euphemisms and clichés, can capitalize any word that is considered important, the passive voice is used wherever possible and abbreviations occur in every sentence. The worst part is that all of these linguistic enormities are carried out deliberately. The purpose of this paper is to analyse to what extent business jargon and abbreviations have affected business communication (which most of the time, it is filled with opaque language to mask different activities and operations and the reasons for which these linguistic phenomena have become so successful in the present. One of the reasons for the research is that in business English, jargon can be annoying because it overcomplicates. It is frequently unnecessary and it can transform a simple idea or instruction into something very confusing. It is true that every field has its jargon. Education, journalism, law, politics, medicine, urban planning – no filed is immune. Yet, it seems that business jargon has been described as “the most annoying”. Another reason is that jargon tends to be elitist. Those who do not understand the terms feel confused and uncertain. The paper starts with defining these two concepts, business jargon and abbreviations, and then it attempts to explain the “unusual” pervasion of these, both in business communication and in everyday communication. For this, the paper includes a list with the most common business jargon and abbreviations. In this view, the authors have accessed different economic blogs and specialty journals
Treuth, M G; Reyes, G A; He, Z X; Cwajg, E; Mahmarian, J J; Verani, M S
2001-01-01
The objectives of this study were 2-fold: (1) to determine the tolerance of adenosine perfusion tomography with the use of an abbreviated (3-minute) infusion in comparison to the standard (6-minute) infusion, and (2) to assess the relative diagnostic accuracy of a 3-minute adenosine infusion in patients referred for arteriography. An abbreviated adenosine infusion may decrease the frequency and duration of side effects and be a more cost-effective alternative. We prospectively randomized 599 patients undergoing adenosine myocardial perfusion tomography to either a 3-minute or 6-minute adenosine infusion at 140 microg/kg per minute. Among the 599 enrolled patients, 142 subsequently underwent coronary angiography. Patients randomized to the 3-minute adenosine infusion tolerated the procedure better than those randomized to the standard infusion (P <.01). Flushing, headache, neck pain, and atrioventricular block were all significantly less frequent (P <.01) with the abbreviated infusion. Moreover, patients receiving the abbreviated infusion had less hypotension and tachycardia (P <.05). The sensitivity of the test for detection of coronary artery disease was 88% for both the 3- and 6-minute infusions. In patients with abnormal scan results, perfusion defect size was slightly larger in those receiving a 6-minute infusion versus those receiving a 3-minute infusion (P =.05). An abbreviated 3-minute adenosine infusion, in combination with perfusion tomography, has similar sensitivity for detection of coronary artery disease and is better tolerated than the standard 6-minute infusion.
Abbreviated Pandemic Influenza Planning Template for Primary Care Offices
Energy Technology Data Exchange (ETDEWEB)
HCTT CHE
2010-01-01
The Abbreviated Pandemic Influenza Plan Template for Primary Care Provider Offices is intended to assist primary care providers and office managers with preparing their offices for quickly putting a plan in place to handle an increase in patient calls and visits, whether during the 2009-2010 influenza season or future influenza seasons.
48 CFR 302.7000 - Common HHSAR acronyms and abbreviations.
2010-10-01
... acronyms and abbreviations. (a) The HHSAR cites numerous acquisition-related and organizational acronyms...-3(b)(3). CDC Centers for Disease Control and Prevention 301.270(b). CFR Code of Federal Regulations....1300(c). PSC Program Support Center (in OS) 301.270(b). R&D research and development 301.607-72(b). RFI...
21 CFR 314.94 - Content and format of an abbreviated application.
2010-04-01
... SERVICES (CONTINUED) DRUGS FOR HUMAN USE APPLICATIONS FOR FDA APPROVAL TO MARKET A NEW DRUG Abbreviated... that FDA can process, review, and archive. FDA will periodically issue guidance on how to provide the...
International Nuclear Information System (INIS)
Brountzos, Elias N.; Vagenas, Kostantinos; Apostolopoulou, Sotiria C.; Panagiotou, Irene; Lymberopoulou, Dimitra; Kelekis, Dimitrios A.
2003-01-01
We present a patient with a splenic arterypseudoaneurysm (SAPA) treated with placement of self-expandable stent-grafts. The procedure was complicated by stent-graft migration,but successful management resulted in lasting exclusion of the SAPA,while the patency of the splenic artery was preserved. This is the first report of self-expandable stent-graft treatment of SAPA
Wassenaar, Annelies; de Reus, Jorn; Donders, A Rogier T; Schoonhoven, Lisette; Cremer, Olaf L; de Lange, Dylan W; van Dijk, Diederik; Slooter, Arjen J C; Pickkers, Peter; van den Boogaard, Mark
2018-01-01
To develop and validate an abbreviated version of the Cognitive Failure Questionnaire that can be used by patients as part of self-assessment to measure functional cognitive outcome in ICU survivors. A retrospective multicenter observational study. The ICUs of two Dutch university hospitals. Adult ICU survivors. None. Cognitive functioning was evaluated between 12 and 24 months after ICU discharge using the full 25-item Cognitive Failure Questionnaire (CFQ-25). Incomplete CFQ-25 questionnaires were excluded from analysis. Forward selection in a linear regression model was used in hospital A to assess which of the CFQ-25 items should be included to prevent a significant loss of correlation between an abbreviated and the full CFQ-25. Subsequently, the performance of an abbreviated Cognitive Failure Questionnaire was determined in hospital B using Pearson's correlation. A Bland-Altman plot was used to examine whether the reduced-item outcome scores of an abbreviated Cognitive Failure Questionnaire were a replacement for the full CFQ-25 outcome scores. Among 1,934 ICU survivors, 1,737 were included, 819 in hospital A, 918 in hospital B. The Pearson's correlation between the abbreviated 14-item Cognitive Failure Questionnaire (CFQ-14) and the CFQ-25 was 0.99. The mean of the difference scores was -0.26, and 95% of the difference scores fell within +5 and -5.5 on a 100-point maximum score. It is feasible to use the abbreviated CFQ-14 to measure self-reported cognitive failure in ICU survivors as this questionnaire has a similar performance as the full CFQ-25.
Karanci, A Nuray; Dirik, Gülay; Yorulmaz, Orçun
2007-01-01
The aim of the present study was to examine the reliability and the validity of the Turkish translation of the Eysneck Personality Questionnaire Revised-abbreviated Form (EPQR-A) (Francis et al., 1992), which consists of 24 items that assess neuroticism, extraversion, psychoticism, and lying. The questionnaire was first translated into Turkish and then back translated. Subsequently, it was administered to 756 students from 4 different universities. The Fear Survey Inventory-III (FSI-III), Rosenberg Self-Esteem Scales (RSES), and Egna Minnen Betraffande Uppfostran (EMBU-C) were also administered in order to assess the questionnaire's validity. The internal consistency, test-retest reliability, and validity were subsequently evaluated. Factor analysis, similar to the original scale, yielded 4 factors; the neuroticism, extraversion, psychoticism, and lie scales. Kuder-Richardson alpha coefficients for the extraversion, neuroticism, psychoticism, and lie scales were 0.78, 0.65, 0.42, and 0.64, respectively, and the test-retest reliability of the scales was 0.84, 0.82, 0.69, and 0.69, respectively. The relationships between EPQR-A-48, FSI-III, EMBU-C, and RSES were examined in order to evaluate the construct validity of the scale. Our findings support the construct validity of the questionnaire. To investigate gender differences in scores on the subscales, MANOVA was conducted. The results indicated that there was a gender difference only in the lie scale scores. Our findings largely supported the reliability and validity of the questionnaire in a Turkish student sample. The psychometric characteristics of the Turkish version of the EPQR-A were discussed in light of the relevant literature.
Cohan, Deborah; Gomez, Elvira; Greenberg, Mara; Washington, Sierra; Charlebois, Edwin D
2009-01-01
In the US, an unacceptably high percentage of pregnant women do not undergo prenatal HIV testing. Previous studies have found increased uptake of prenatal HIV testing with abbreviated pre-test counseling, however little is known about patient decision making, testing satisfaction and knowledge in this setting. A randomized-controlled, non-inferiority trial was conducted from October 2006 through February 2008 at San Francisco General Hospital (SFGH), the public teaching hospital of the City and County of San Francisco. A total of 278 English- and Spanish-speaking pregnant women were randomized to receive either abbreviated or standard nurse-performed HIV test counseling at the initial prenatal visit. Patient decision making experience was compared between abbreviated versus standard HIV counseling strategies among a sample of low-income, urban, ethnically diverse prenatal patients. The primary outcome was the decisional conflict score (DCS) using O'Connor low-literacy scale and secondary outcomes included satisfaction with test decision, basic HIV knowledge and HIV testing uptake. We conducted an intention-to-treat analysis of 278 women--134 (48.2%) in the abbreviated arm (AA) and 144 (51.8%) in the standard arm (SA). There was no significant difference in the proportion of women with low decisional conflict (71.6% in AA vs. 76.4% in SA, p = .37), and the observed mean difference between the groups of 3.88 (95% CI: -0.65, 8.41) did not exceed the non-inferiority margin. HIV testing uptake was very high (97. 8%) and did not differ significantly between the 2 groups (99.3% in AA vs. 96.5% in SA, p = .12). Likewise, there was no difference in satisfaction with testing decision (97.8% in AA vs. 99.3% in SA, p = .36). However, women in AA had significantly lower mean HIV knowledge scores (78.4%) compared to women in SA (83.7%, pprocess, while associated with slightly lower knowledge, does not compromise patient decision making or satisfaction regarding HIV testing
This randomized phase II trial studies how well abbreviated breast magnetic resonance imaging (MRI) and digital tomosynthesis mammography work in detecting cancer in women with dense breasts. Abbreviated breast MRI is a low cost procedure in which radio waves and a powerful magnet linked to a computer and used to create detailed pictures of the breast in less than 10 minutes.
Interactive Hangman teaches amino acid structures and abbreviations
Pennington, BO; Sears, D; Clegg, DO
2014-01-01
© 2014 by The International Union of Biochemistry and Molecular Biology, 42(6):495-500, 2014. We developed an interactive exercise to teach students how to draw the structures of the 20 standard amino acids and to identify the one-letter abbreviations by modifying the familiar game of "Hangman." Amino acid structures were used to represent single letters throughout the game. To provide additional practice in identifying structures, hints to the answers were written in "amino acid sentences" f...
Children's Text Messaging: Abbreviations, Input Methods and Links with Literacy
Kemp, N.; Bushnell, C.
2011-01-01
This study investigated the effects of mobile phone text-messaging method (predictive and multi-press) and experience (in texters and non-texters) on children's textism use and understanding. It also examined popular claims that the use of text-message abbreviations, or "textese" spelling, is associated with poor literacy skills. A sample of 86…
Effects of signal salience and noise on performance and stress in an abbreviated vigil
Helton, William Stokely
Vigilance or sustained attention tasks traditionally require observers to detect predetermined signals that occur unpredictably over periods of 30 min to several hours (Warm, 1984). These tasks are taxing and have been useful in revealing the effects of stress agents, such as infectious disease and drugs, on human performance (Alluisi, 1969; Damos & Parker, 1994; Warm, 1993). However, their long duration has been an inconvenience. Recently, Temple and his associates (Temple et al., 2000) developed an abbreviated 12-min vigilance task that duplicates many of the findings with longer duration vigils. The present study was designed to explore further the similarity of the abbreviated task to long-duration vigils by investigating the effects of signal salience and jet-aircraft engine noise on performance, operator stress, and coping strategies. Forty-eight observers (24 males and 24 females) were assigned at random to each of four conditions resulting from the factorial combination of signal salience (high and low contrast signals) and background noise (quiet and jet-aircraft noise). As is the case with long-duration vigils (Warm, 1993), signal detection in the abbreviated task was poorer for low salience than for high salience signals. In addition, stress scores, as indexed by the Dundee Stress State Questionnaire (Matthews, Joiner, Gilliland, Campbell, & Falconer, 1999), were elevated in the low as compared to the high salience condition. Unlike longer vigils, however, (Becker, Warm, Dember, & Hancock, 1996), signal detection in the abbreviated task was superior in the presence of aircraft noise than in quiet. Noise also attenuated the stress of the vigil, a result that is counter to previous findings regarding the effects of noise in a variety of other scenarios (Clark, 1984). Examination of observers' coping responses, as assessed by the Coping Inventory for Task Situations (Matthews & Campbell, 1998), indicated that problem-focused coping was the overwhelming
Abbreviated kinetic profiles in area-under-the-curve monitoring of cyclosporine therapy.
Grevel, J; Kahan, B D
1991-11-01
Abbreviated kinetic profiles can reduce the number of phlebotomies and drug assays, and thereby the cost of area-under-the-curve (AUC) monitoring. In the present investigation, we used two independent data sets: group 1, 101 AUC profiles from 77 stable renal-transplant patients, which included a 5-h sample in addition to the usual 0-, 2-, 4-, 6-, 10-, 14-, and 24-h samples; and group 2, 100 profiles from 50 stable renal-transplant patients before and after a change in their daily oral dose of cyclosporine. Group I demonstrated a fair correlation between cyclosporine trough concentrations and the AUC calculated from a complete set of seven concentrations (r2 = 0.820 and 0.758 for the 24- and 0-h samples, respectively). Stepwise multiple linear-regression analysis revealed that the abbreviated set of three time points (2, 6, and 14 h) explained 96% of the variance in AUC values calculated from the full set of seven samples; additional time points increased the accuracy only slightly. For group 2, we examined the difference between the observed and the predicted concentrations by linear extrapolation; the error in the observed AUC value, compared with the predicted value calculated from seven time points (-13.2% to -1.2%), was similar to the error from just three time points (-11.5% to 4.5%). Abbreviated AUC profiles involving three time points used with a model equation seem to provide a reliable alternative to full seven-point profiles.
An abbreviated SNP panel for ancestry assignment of honeybees (Apis mellifera)
This paper examines whether an abbreviated panel of 37 single nucleotide polymorphisms (SNPs) has the same power as a larger and more expensive panel of 95 SNPs to assign ancestry of honeybees (Apis mellifera) to three ancestral lineages. We selected 37 SNPs from the original 95 SNP panel using alle...
Reducing sedation for pediatric body MRI using accelerated and abbreviated imaging protocols
International Nuclear Information System (INIS)
Ahmad, Rizwan; Hu, Houchun Harry; Krishnamurthy, Ramkumar; Krishnamurthy, Rajesh
2018-01-01
Magnetic resonance imaging (MRI) is an established diagnostic imaging tool for investigating pediatric disease. MRI allows assessment of structure, function, and morphology in cardiovascular imaging, as well as tissue characterization in body imaging, without the use of ionizing radiation. For MRI in children, sedation and general anesthesia (GA) are often utilized to suppress patient motion, which can otherwise compromise image quality and diagnostic efficacy. However, evidence is emerging that use of sedation and GA in children might have long-term neurocognitive side effects, in addition to the short-term procedure-related risks. These concerns make risk-benefit assessment of sedation and GA more challenging. Therefore, reducing or eliminating the need for sedation and GA is an important goal of imaging innovation and research in pediatric MRI. In this review, the authors focus on technical and clinical approaches to reducing and eliminating the use of sedation in the pediatric population based on image acquisition acceleration and imaging protocols abbreviation. This paper covers important physiological and technical considerations for pediatric body MR imaging and discusses MRI techniques that offer the potential of recovering diagnostic-quality images from accelerated scans. In this review, the authors also introduce the concept of reporting elements for important indications for pediatric body MRI and use this as a basis for abbreviating the MR protocols. By employing appropriate accelerated and abbreviated approaches based on an understanding of the imaging needs and reporting elements for a given clinical indication, it is possible to reduce sedation and GA for pediatric chest, cardiovascular and abdominal MRI. (orig.)
Reducing sedation for pediatric body MRI using accelerated and abbreviated imaging protocols
Energy Technology Data Exchange (ETDEWEB)
Ahmad, Rizwan [The Ohio State University, Department of Biomedical Engineering, Columbus, OH (United States); Hu, Houchun Harry; Krishnamurthy, Ramkumar; Krishnamurthy, Rajesh [Nationwide Children' s Hospital, Department of Radiology, Columbus, OH (United States)
2018-01-15
Magnetic resonance imaging (MRI) is an established diagnostic imaging tool for investigating pediatric disease. MRI allows assessment of structure, function, and morphology in cardiovascular imaging, as well as tissue characterization in body imaging, without the use of ionizing radiation. For MRI in children, sedation and general anesthesia (GA) are often utilized to suppress patient motion, which can otherwise compromise image quality and diagnostic efficacy. However, evidence is emerging that use of sedation and GA in children might have long-term neurocognitive side effects, in addition to the short-term procedure-related risks. These concerns make risk-benefit assessment of sedation and GA more challenging. Therefore, reducing or eliminating the need for sedation and GA is an important goal of imaging innovation and research in pediatric MRI. In this review, the authors focus on technical and clinical approaches to reducing and eliminating the use of sedation in the pediatric population based on image acquisition acceleration and imaging protocols abbreviation. This paper covers important physiological and technical considerations for pediatric body MR imaging and discusses MRI techniques that offer the potential of recovering diagnostic-quality images from accelerated scans. In this review, the authors also introduce the concept of reporting elements for important indications for pediatric body MRI and use this as a basis for abbreviating the MR protocols. By employing appropriate accelerated and abbreviated approaches based on an understanding of the imaging needs and reporting elements for a given clinical indication, it is possible to reduce sedation and GA for pediatric chest, cardiovascular and abdominal MRI. (orig.)
40 CFR 1039.805 - What symbols, acronyms, and abbreviations does this part use?
2010-07-01
... abbreviations does this part use? 1039.805 Section 1039.805 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM NEW AND IN-USE NONROAD COMPRESSION... oxide. NISTNational Institute of Standards and Technology. NMHCnonmethane hydrocarbons. NOXoxides of...
No longer "if," but "when": the coming abbreviated approval pathway for follow-on biologics.
Kelly, Jeremiah J; David, Michael
2009-01-01
Abbreviated approval of follow-on biologics involves answering complex scientific, legal, and policy questions. The Food and Drug Administration (FDA or the Agency) asserts that it lacks the statutory authority to approve follow-on versions of biologics licensed under Section 351 of the Public Health Service Act (PHSA). Despite persuasive arguments to the contrary the one hundred and tenth Congress entertained four legislative proposals to give FDA this authority, each markedly different. It is no longer a question of "if," but "when" FDA will receive authority to review and license abbreviated applications for follow-on biologics. Any legislation in the one hundred and eleventh Congress must determine: (1) if FDA should be granted authority to develop an abbreviated pathway through rulemaking or guidance; (2) if human clinical trials should be mandatory or discretionary; (3) the feasibility of interchangeability determinations in light of patient safety concerns; (4) the duration of marketing exclusivity for associated products; (5) which products are eligible for follow-on approval; and (6) the degree to which uniformity is achievable between the FD&C Act and the PHSA. This paper recommends the one hundred and eleventh Congress strike a balance between patient safety, incentives for product innovation, price competition, and the need for a flexible, transparent process that capitalizes on FDA's growing expertise with follow-on biologics approvals under Section 505(b)(2) of the FD&C Act.
Text-Message Abbreviations and Language Skills in High School and University Students
De Jonge, Sarah; Kemp, Nenagh
2012-01-01
This study investigated the use of text-message abbreviations (textisms) in Australian adolescents and young adults, and relations between textism use and literacy abilities. Fifty-two high school students aged 13-15 years, and 53 undergraduates aged 18-24 years, all users of predictive texting, translated conventional English sentences into…
Relax and Try This Instead: Abbreviated Habit Reversal for Maladaptive Self-Biting.
Jones, Kevin M.; Swearer, Susan M.; Friman, Patrick C.
1997-01-01
A study evaluated the effectiveness of an abbreviated habit reversal procedure to reduce maladaptive oral self-biting in an adolescent boy in residential care. Treatment involved a combination of relaxation and two competing responses (gum chewing and tongue-lip rubbing). The intervention eliminated the biting and the tissue damage it caused.…
40 CFR 1048.805 - What symbols, acronyms, and abbreviations does this part use?
2010-07-01
... ENGINES Definitions and Other Reference Information § 1048.805 What symbols, acronyms, and abbreviations... hydrocarbons. NOXoxides of nitrogen (NO and NO2). psipounds per square inch of absolute pressure. psigpounds.... SIspark-ignition. THCtotal hydrocarbon. THCEtotal hydrocarbon equivalent. U.S.C.United States Code. [67 FR...
Directory of Open Access Journals (Sweden)
Faruk Şahin
2015-10-01
Full Text Available The present study reports the psychometric properties of a short measure of self-leadership in the Turkish context: the Abbreviated Self-Leadership Questionnaire (ASLQ. The ASLQ was examined using two samples and showed sound psychometric properties. Confirmatory factor analysis showed that nine-item ASLQ measured a single construct of self-leadership. The results supported the convergent and discriminant validity of the one-factor model of the ASLQ in relation to the 35-item Revised Self-Leadership Questionnaire and General Self-Efficacy scale, respectively. With regard to internal consistency and test-retest reliability, the ASLQ showed acceptable results. Furthermore, the results provided evidence that scores on the ASLQ positively predicted individual's self-reported task performance and self-efficacy mediated this relationship. Taken together, these findings suggest that the Turkish version of the ASLQ is a reliable and valid measure that can be used to measure self-leadership as one variable of interest in the future studies.
Dictionary of nuclear power and waste management with abbreviations and acronyms
Energy Technology Data Exchange (ETDEWEB)
Lau, Foo-Sun
1987-01-01
This dictionary of definitions, abbreviations and acronyms together with appendices containing lists of element and atomic masses, half-lives, symbols, units, physical constants and conversion tables associated with nuclear technology and waste management has been compiled to enable scientists and laymen to reach a better understanding of the technical terms associated with nuclear power, engineering and waste management. There is a bibliography for further reading.
Daly, Barry; Abboud, Samir; Ali, Zabiullah; Sliker, Clint; Fowler, David
2013-02-10
Although 3D CT imaging data are available on survivors of accidental blunt trauma, little similar data has been collected and classified on major injuries in victims of fatal injuries. This study compared the sensitivity of post mortem computed tomography (PMCT) with that of conventional autopsy for major trauma findings classified according to the trauma Abbreviated Injury Scale (AIS). Whole-body 3D PMCT imaging data and full autopsy findings were analyzed on 21 victims of accidental blunt force trauma death. All major injuries were classified on the AIS scale with ratings from 3 (serious) to 6 (unsurvivable). Agreement between sensitivity of autopsy and PMCT for major injuries was determined. A total of 195 major injuries were detected (mean per fatality, 9.3; range, 1-14). Skeletal injuries by AIS grade included 37 grade 3, 45 grade 4, 12 grade 5, and 2 grade 6 major findings. Soft tissue injuries included 10 grade 3, 68 grade 4, 16 grade 5, and 5 grade 6 major findings. Of these, PMCT detected 165 (88 skeletal, 77 soft tissue), and autopsy detected 127 (59 skeletal, 68 soft tissue). PMCT agreed with autopsy in 86% and 76% of skeletal and soft tissue injuries, respectively. PMCT detected an additional 37 skeletal and 31 soft tissue injuries that were not identified at autopsy. Autopsy detected 8 skeletal and 22 soft tissue injuries that were not detected by PMCT. PMCT was more sensitive for skeletal (P=0.05) and head and neck region injury (P=0.043) detection. PMCT showed a trend for greater sensitivity than autopsy, but this did not reach statistical significance (P=0.083). 3D PMCT detected significantly more skeletal injuries than autopsy and a similar number of soft tissue injuries to autopsy and promises to be a sensitive tool for detection and classification of skeletal injuries in fatal blunt force accidental trauma. Use of the AIS scale allows standardized categorization and quantification of injuries that contribute to death in such cases and allows more
40 CFR 59.685 - What symbols, acronyms, and abbreviations does this subpart use?
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false What symbols, acronyms, and abbreviations does this subpart use? 59.685 Section 59.685 Protection of Environment ENVIRONMENTAL PROTECTION... CONSUMER AND COMMERCIAL PRODUCTS Control of Evaporative Emissions From New and In-Use Portable Fuel...
International Nuclear Information System (INIS)
Dohan, Anthony; Eveno, Clarisse; Dautry, Raphael; Guerrache, Youcef; Camus, Marine; Boudiaf, Mourad; Gayat, Etienne; Dref, Olivier Le; Sirol, Marc; Soyer, Philippe
2015-01-01
PurposeTo assess the role and effectiveness of percutaneous arterial embolization (TAE) in patients with hemodynamic instability due to hypovolemic shock secondary to ruptured splanchnic artery pseudoaneurysms (SAPA).Materials and MethodsSeventeen patients (11 men, 6 women; mean age, 53 years) with hemodynamic instability (systolic blood pressure <90 mmHg) due to hypovolemic shock secondary to ruptured SAPA were treated by TAE. Clinical files, multidetector row computed tomography angiography, and angiographic examinations along with procedure details were reviewed.ResultsSeventeen SAPAs were present, predominantly located on gastroduodenal or pancreatic arteries (9/17; 53 %). Angiography showed extravasation of contrast medium from SAPA in 15/17 patients (88 %). Technical success rate of TAE was 100 %. TAE was performed using metallic coils in all patients (100 %), in association with gelatin sponge in 5/17 patients (29 %). TAE allowed controlling the bleeding and returning to normal hemodynamic status in 16/17 patients (94 %). In 1/17 patient (6 %), surgery was needed to definitively control the bleeding. The mortality and morbidity rate of TAE at 30 days were 0 and 12 %, respectively. Morbidity consisted in coil migration in 1/17 patient (6 %) and transient serum liver enzyme elevation in 1/17 patient (6 %).ConclusionTAE is an effective and safe treatment option for ruptured SAPA in hemodynamically unstable patients, with a success rate of 94 %. Our results suggest that TAE should be the favored option in patients with hemodynamic instability due to ruptured SAPA
Energy Technology Data Exchange (ETDEWEB)
Dohan, Anthony, E-mail: anthony.dohan@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Eveno, Clarisse, E-mail: clarisse.eveno@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Dautry, Raphael, E-mail: raphael.dautry@lrb.aphp.fr; Guerrache, Youcef, E-mail: docyoucef05@yahoo.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Camus, Marine, E-mail: marine.camus@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Boudiaf, Mourad, E-mail: mourad.boudiaf@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Gayat, Etienne, E-mail: etienne.gayat@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Dref, Olivier Le, E-mail: olivier.ledref@lrb.aphp.fr; Sirol, Marc, E-mail: marc.sirol@lrb.aphp.fr; Soyer, Philippe, E-mail: philippe.soyer@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France)
2015-08-15
PurposeTo assess the role and effectiveness of percutaneous arterial embolization (TAE) in patients with hemodynamic instability due to hypovolemic shock secondary to ruptured splanchnic artery pseudoaneurysms (SAPA).Materials and MethodsSeventeen patients (11 men, 6 women; mean age, 53 years) with hemodynamic instability (systolic blood pressure <90 mmHg) due to hypovolemic shock secondary to ruptured SAPA were treated by TAE. Clinical files, multidetector row computed tomography angiography, and angiographic examinations along with procedure details were reviewed.ResultsSeventeen SAPAs were present, predominantly located on gastroduodenal or pancreatic arteries (9/17; 53 %). Angiography showed extravasation of contrast medium from SAPA in 15/17 patients (88 %). Technical success rate of TAE was 100 %. TAE was performed using metallic coils in all patients (100 %), in association with gelatin sponge in 5/17 patients (29 %). TAE allowed controlling the bleeding and returning to normal hemodynamic status in 16/17 patients (94 %). In 1/17 patient (6 %), surgery was needed to definitively control the bleeding. The mortality and morbidity rate of TAE at 30 days were 0 and 12 %, respectively. Morbidity consisted in coil migration in 1/17 patient (6 %) and transient serum liver enzyme elevation in 1/17 patient (6 %).ConclusionTAE is an effective and safe treatment option for ruptured SAPA in hemodynamically unstable patients, with a success rate of 94 %. Our results suggest that TAE should be the favored option in patients with hemodynamic instability due to ruptured SAPA.
International Nuclear Information System (INIS)
Langner, G.H. Jr.
1987-06-01
The US Department of Energy (DOE) Office of Remedial Action and Waste Technology established the Technical Measurements Center at the DOE Grand Junction, Colorado, Projects Office to standardize, calibrate, and compare measurements made in support of DOE remedial action programs. Indoor radon-daughter concentration measurements are made to determine whether a structure is in need of remedial action. The Technical Measurements Center conducted this study to validate an abbreviated Radon Progeny Integrated Sampling Unit (RPISU) method of making indoor radon-daughter measurements to determine whether a structure has a radon-daughter concentration (RDC) below the levels specified in various program standards. The Technical Measurements Center established a criterion against which RDC measurements made using the RPISU sampling method are evaluated to determine if sampling can be terminated or whether further measurements are required. This abbreviated RPISU criterion was tested against 317 actual sets of RPISU data from measurements made over an eight-year period in Mesa County, Colorado. The data from each location were tested against a standard that was assumed to be the same as the actual annual average RDC from that location. At only two locations was the criterion found to fail. Using the abbreviated RPISU method, only 0.6% of locations sampled can be expected to be falsely indicated as having annual average RDC levels below a given standard
Temple Univ., Philadelphia, PA. Div. of Vocational Education.
This module on medical terminology (using Latin words/abbreviations; special signs and symbols) is one of 17 modules designed for individualized instruction in health occupations education programs at both the secondary and postsecondary levels. This module consists of an introduction to the module topic, a list of resources needed, and three…
Zagreb regimen, an abbreviated intramuscular schedule for rabies vaccination.
Ren, Jiangping; Yao, Linong; Sun, Jimin; Gong, Zhenyu
2015-01-01
The Zagreb regimen, an abbreviated intramuscular schedule for rabies vaccination, was developed by I. Vodopija and colleagues of the Zagreb Institute of Public Health in Croatia in the 1980s. It was recommended by WHO as one of the intramuscular (IM) schedules for rabies vaccination in 2010. We reviewed the literature on the immunogenicity, safety, economic burden, and compliance of the Zagreb 2-1-1 regimen. Compared to Essen, another IM schedule recommended by WHO, Zagreb has higher compliance, lower medical cost, and better immunogenicity at an early stage. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
A Confirmatory Factor Analysis of an Abbreviated Social Support Instrument: The MOS-SSS
Gjesfjeld, Christopher D.; Greeno, Catherine G.; Kim, Kevin H.
2008-01-01
Objective: Confirm the factor structure of the original 18-item Medical Outcome Study Social Support Survey (MOS-SSS) as well as two abbreviated versions in a sample of mothers with a child in mental health treatment. Method: The factor structure, internal consistency, and concurrent validity of the MOS-SSS were assessed using a convenience sample…
Dictionary of International Abbreviations - Environment and Natural Sciences
International Nuclear Information System (INIS)
2003-01-01
The dictionary comprises about 3000 acronyms and abbreviations, with explanations in German and English. Subjects: Chemistry, medicine, geology, air, water, soil, waste, air pollution and noise abatement, chemicals and pollutants, agriculture and food, conservation and landscaping, energy, immission protection, radiation protection and nuclear safety, industry and biotechnology, environmental pollution, waste management and recycling. It is intended as a working and communication tool for a wide range of users in industry, administration, universities, scientists and students, journalists, translators and interested laymen. There is an appendix with supplementary information, i.e. mass, volume, SI units, chemical compounds and formulas, occupational pollutant exposure, food additives, environmental disasters, environmental laws, regulations and specifications, international programmes and organisations for environmental protection, and guidelines of environmental and international law. (orig.) [de
Directory of Open Access Journals (Sweden)
Cerin Ester
2009-06-01
Full Text Available Abstract Background The Neighborhood Environment Walkability Scale (NEWS and its abbreviated form (NEWS-A assess perceived environmental attributes believed to influence physical activity. A multilevel confirmatory factor analysis (MCFA conducted on a sample from Seattle, WA showed that, at the respondent level, the factor-analyzable items of the NEWS and NEWS-A measured 11 and 10 constructs of perceived neighborhood environment, respectively. At the census blockgroup (used by the US Census Bureau as a subunit of census tracts level, the MCFA yielded five factors for both NEWS and NEWS-A. The aim of this study was to cross-validate the individual- and blockgroup-level measurement models of the NEWS and NEWS-A in a geographical location and population different from those used in the original validation study. Methods A sample of 912 adults was recruited from 16 selected neighborhoods (116 census blockgroups in the Baltimore, MD region. Neighborhoods were stratified according to their socio-economic status and transport-related walkability level measured using Geographic Information Systems. Participants self-completed the NEWS. MCFA was used to cross-validate the individual- and blockgroup-level measurement models of the NEWS and NEWS-A. Results The data provided sufficient support for the factorial validity of the original individual-level measurement models, which consisted of 11 (NEWS and 10 (NEWS-A correlated factors. The original blockgroup-level measurement model of the NEWS and NEWS-A showed poor fit to the data and required substantial modifications. These included the combining of aspects of building aesthetics with safety from crime into one factor; the separation of natural aesthetics and building aesthetics into two factors; and for the NEWS-A, the separation of presence of sidewalks/walking routes from other infrastructure for walking. Conclusion This study provided support for the generalizability of the individual
Symbolic Capital in a Virtual Heterosexual Market: Abbreviation and Insertion in Italian iTV SMS
Herring, Susan C.; Zelenkauskaite, Asta
2009-01-01
This study analyzes gender variation in nonstandard typography--specifically, abbreviations and insertions--in mobile phone text messages (SMS) posted to a public Italian interactive television (iTV) program. All broadcast SMS were collected for a period of 2 days from the Web archive for the iTV program, and the frequency and distribution of…
Abbreviated New Drug Applications (ANDAS): Future trend in radiopharmaceuticals
International Nuclear Information System (INIS)
Kishore, R.
1990-01-01
The Drug Price Competition and Patent Term Restoration Act (commonly called Waxman Hatch Amendment) of 1984, to the Federal Food, Drug, and Cosmetic Act provided for abbreviated new drug applications (ANDAs) if the conditions specified in the Code of Federal Regulations (CFR) Title 21, subsection 312.55 are met. Under this subsection, reports of nonclinical laboratory studies and clinical investigations can be omitted. New drugs approved under these regulations are so called generic drugs as opposed to listed or pioneer (innovator) drugs. As the patents on more and more radiopharmaceuticals reach their expiration, the radiopharmaceutical industry is likely to produce more of these generic versions of innovator drugs. The ANDAs are required to contain information specified under subsections 314.50(a), (b), (d)(1) and (3), (e), and (g)
Enhancing acronym/abbreviation knowledge bases with semantic information.
Torii, Manabu; Liu, Hongfang
2007-10-11
In the biomedical domain, a terminology knowledge base that associates acronyms/abbreviations (denoted as SFs) with the definitions (denoted as LFs) is highly needed. For the construction such terminology knowledge base, we investigate the feasibility to build a system automatically assigning semantic categories to LFs extracted from text. Given a collection of pairs (SF,LF) derived from text, we i) assess the coverage of LFs and pairs (SF,LF) in the UMLS and justify the need of a semantic category assignment system; and ii) automatically derive name phrases annotated with semantic category and construct a system using machine learning. Utilizing ADAM, an existing collection of (SF,LF) pairs extracted from MEDLINE, our system achieved an f-measure of 87% when assigning eight UMLS-based semantic groups to LFs. The system has been incorporated into a web interface which integrates SF knowledge from multiple SF knowledge bases. Web site: http://gauss.dbb.georgetown.edu/liblab/SFThesurus.
Cheung, Chi Yuen; van der Heijden, Jaques; Hoogtanders, Karin; Christiaans, Maarten; Liu, Yan Lun; Chan, Yiu Han; Choi, Koon Shing; van de Plas, Afke; Shek, Chi Chung; Chau, Ka Foon; Li, Chun Sang; van Hooff, Johannes; Stolk, Leo
2008-02-01
Dried blood spot (DBS) sampling and high-performance liquid chromatography tandem-mass spectrometry have been developed in monitoring tacrolimus levels. Our center favors the use of limited sampling strategy and abbreviated formula to estimate the area under concentration-time curve (AUC(0-12)). However, it is inconvenient for patients because they have to wait in the center for blood sampling. We investigated the application of DBS method in tacrolimus level monitoring using limited sampling strategy and abbreviated AUC estimation approach. Duplicate venous samples were obtained at each time point (C(0), C(2), and C(4)). To determine the stability of blood samples, one venous sample was sent to our laboratory immediately. The other duplicate venous samples, together with simultaneous fingerprick blood samples, were sent to the University of Maastricht in the Netherlands. Thirty six patients were recruited and 108 sets of blood samples were collected. There was a highly significant relationship between AUC(0-12), estimated from venous blood samples, and fingerprick blood samples (r(2) = 0.96, P AUC(0-12) strategy as drug monitoring.
Social anxiety in the general population: introducing abbreviated versions of SIAS and SPS.
Kupper, Nina; Denollet, Johan
2012-01-01
Social anxiety is characterized by the experience of stress, discomfort and fear in social situations, and is associated with substantial personal and societal burden. Two questionnaires exist that assess the aspects of social anxiety, i.e. social interaction anxiety (SIAS) and social phobia (SPS). There is no agreement in literature on the dimensionality of social anxiety. Further, the length of a questionnaire may negatively affect response rates and participation at follow-up occasions. To explore the structure of social anxiety in the general population, and to examine psychosocial and sociodemographic correlates. Our second aim was to construct abbreviated versions of SIAS and SPS that can be easily used and with minimal burden. A total of 1598 adults from the general Dutch population completed a survey asking information on social anxiety, mood and demographics. Exploratory and confirmatory factor analyses as well as reliability analysis with item-total statistics were performed. Confirmatory factor analysis revealed a 3-factor structure for social phobia, and a 2-factor structure for the SIAS, with the second factor containing both reversely scored items. The abbreviated versions of SPS (11 items) and SIAS (10 items) show excellent discriminant and construct validity (Cronbach's α=.90 and .92), while specificity analysis showed that gender, marital status and educational level (SIAS(10): pSIAS, reducing the questionnaire burden for participants in epidemiological and biobehavioral research. Copyright © 2011 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Franklyn Melanie
2011-01-01
Full Text Available Abstract Background Trauma systems should consistently monitor a given trauma population over a period of time. The Abbreviated Injury Scale (AIS and derived scores such as the Injury Severity Score (ISS are commonly used to quantify injury severities in trauma registries. To reflect contemporary trauma management and treatment, the most recent version of the AIS (AIS08 contains many codes which differ in severity from their equivalents in the earlier 1998 version (AIS98. Consequently, the adoption of AIS08 may impede comparisons between data coded using different AIS versions. It may also affect the number of patients classified as major trauma. Methods The entire AIS98-coded injury dataset of a large population based trauma registry was retrieved and mapped to AIS08 using the currently available AIS98-AIS08 dictionary map. The percentage of codes which had increased or decreased in severity, or could not be mapped, was examined in conjunction with the effect of these changes to the calculated ISS. The potential for free text information accompanying AIS coding to improve the quality of AIS mapping was explored. Results A total of 128280 AIS98-coded injuries were evaluated in 32134 patients, 15471 patients of whom were classified as major trauma. Although only 4.5% of dictionary codes decreased in severity from AIS98 to AIS08, this represented almost 13% of injuries in the registry. In 4.9% of patients, no injuries could be mapped. ISS was potentially unreliable in one-third of patients, as they had at least one AIS98 code which could not be mapped. Using AIS08, the number of patients classified as major trauma decreased by between 17.3% and 30.3%. Evaluation of free text descriptions for some injuries demonstrated the potential to improve mapping between AIS versions. Conclusions Converting AIS98-coded data to AIS08 results in a significant decrease in the number of patients classified as major trauma. Many AIS98 codes are missing from the
2012-03-19
...] Abbott Laboratories et al.; Withdrawal of Approval of 35 New Drug Applications and 64 Abbreviated New... Tablets... Abbott Laboratories, PA77/Bldg. AP30-1E, 200 Abbott Park Rd., Abbott Park, IL 60064-6157. NDA... (diphenhydramine Healthcare. HCl)) Injection Preservative Free. NDA 010021 Placidyl Abbott Laboratories...
1987-02-21
Grows, Cooperatives Under Greater Pressure (Sue Leeman; THE STAR, 5 Jun 86) 72 Nation’s Export Drive Into EC Markets Expected Xo Founder (Mick...Development (DAILY DISPATCH, 24 Jun 86) 61 Zulu King Criticizes Church Role in Black Crisis (THE STAR, 30 Jun 86) 62 Briefs New Intelligence Unit...8217 (SAPA, 21 Aug 86) 58 Buthelezi Discusses Afrikaner- Zulu Coexistence (SAPA, 22 Aug 86) 59 People’s Army Leader, ANC’s Modise Discusses
Woelk, Klaus
2009-01-01
A classroom activity is presented in which students are challenged to find matches between the United States two-letter postal abbreviations for states and chemical element symbols. The activity aims to lessen negative apprehensions students might have when the periodic table of the elements with its more than 100 combinations of letters is first…
Lochman, John E; Baden, Rachel E; Boxmeyer, Caroline L; Powell, Nicole P; Qu, Lixin; Salekin, Karen L; Windle, Michel
2014-01-01
Booster interventions have been presumed to be important methods for maintaining the effects of evidence-based programs for children with behavioral problems, but there has been remarkably little empirical attention to this assumption. The present study examines the effect of a child-oriented booster preventive intervention with children who had previously received an abbreviated version (24 child sessions, 10 parent sessions) of the Coping Power targeted prevention program. Two hundred and forty-one children (152 boys, 89 girls) were screened as having moderate to high levels of aggressive behavior in 4th grade, then half were randomly assigned to receive the abbreviated Coping Power program in 5th grade, and half of the preventive intervention children were then randomly assigned to a Booster condition in 6th grade. The Booster sessions consisted of brief monthly individual contacts, and were primarily with the children. Five assessments across 4 years were collected from teachers, providing a three-year follow-up for all children who participated in the project. Results indicated that the abbreviated Coping Power program (one-third shorter than the full intervention) had long-term effects in reducing children's externalizing problem behaviors, proactive and reactive aggression, impulsivity traits and callous-unemotional traits. The Booster intervention did not augment these prevention effects. These findings indicate that a briefer and more readily disseminated form of an evidence-based targeted preventive intervention was effective. The findings have potential implications for policy and guidelines about possible intervention length and booster interventions.
Bjorner, J. B.; Petersen, M. Aa; Groenvold, M.; Aaronson, N.; Ahlner-Elmqvist, M.; Arraras, J. I.; Brédart, A.; Fayers, P.; Jordhoy, M.; Sprangers, M.; Watson, M.; Young, T.
2004-01-01
Background: As part of a larger study whose objective is to develop an abbreviated version of the EORTC QLQ-C30 suitable for research in palliative care, analyses were conducted to determine the feasibility of generating a shorter version of the 4-item emotional functioning (EF) scale that could be
Long, Wahbie
2014-01-01
This paper revisits the 1962 splitting of the South African Psychological Association (SAPA), when disaffected Afrikaner psychologists broke away to form the whites-only Psychological Institute of the Republic of South Africa (PIRSA). It presents an analysis of the rhetorical justification for forming a new professional association on principles at odds with prevailing international norms, demonstrating how the episode involved more than the question of admitting black psychologists to the association. In particular, the paper argues that the SAPA-PIRSA separation resulted from an Afrikaner nationalist reading of the goals of psychological science. PIRSA, that is, insisted on promoting a discipline committed to the ethnic-national vision of the apartheid state. For its part, SAPA's racial integration was of a nominal order only, ostensibly to protect itself from international sanction. The paper concludes that, in a racist society, it is difficult to produce anything other than a racist psychology. © 2014 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
Miller, J.T.
1994-09-01
Guidelines are given for using abbreviations, acronyms, and initialisms (AAIs) in documents prepared by US Department of Energy facilities managed by Martin Marietta Energy Systems, Inc., in Oak Ridge, Tennessee. The more than 10,000 AAIs listed represent only a small portion of those found in recent documents prepared by contributing editors of the Information Management Services organization of Oak Ridge National Laboratory, the Oak Ridge K-25 Site, and the Oak Ridge Y-12 Plant. This document expands on AAIs listed in the Document Preparation Guide and is intended as a companion document
DEFF Research Database (Denmark)
Schnettler, Berta; Orellana, Ligia; Lobos, Germán
2015-01-01
Aim: to characterize types of university students based on satisfaction with life domains that affect eating habits, satisfaction with food-related life and subjective happiness. Materials and methods: a questionnaire was applied to a nonrandom sample of 305 students of both genders in five...... universities in Chile. The questionnaire included the abbreviated Multidimensional Student’s Life Satisfaction Scale (MSLSS), Satisfaction with Food-related Life Scale (SWFL) and the Subjective Happiness Scale (SHS). Eating habits, frequency of food consumption in and outside the place of residence...
Dakal, Tikam Chand; Solieri, Lisa; Giudici, Paolo
2018-06-01
Molecular typing techniques are key tools in surveillance of food spoilage yeasts, in investigations on intra-species population diversity, and in tracing selected starters during fermentation. Unlike previous works on strain typing of Zygosaccharomyces spoilage species, here Zygosaccharomyces mellis and the Zygosaccharoymces rouxii complex yeasts, which include Z. rouxii, Zygosaccharomyces sapae, and a mosaic lineage (ML) of putatively hybrids, were evaluated by three typing methods for intra- and inter-species resolution. Overall these yeasts are relevant for food fermentation and spoilage, but are quite difficult to discriminate at strain and species level as they evolved by reticulation. A pool of 76 strains from different sources were typed by M13 and (GTG) 5 MSP-PCR fingerprinting and PCR-RFLP of ribosomal intergenic spacer region (IGS). We demonstrated that M13 overcame (GTG) 5 fingerprinting to group Z. sapae, Z. rouxii, Z. mellis and the ML isolates in congruent distinct clusters. Even if (GTG) 5 primer yielded a number of DNA fingerprints comparable with those obtained by M13 primer, it failed to discriminate Z. sapae, Z. mellis and Z. rouxii at species level. Clustering of IGS RFLP patterns obtained with three endonucleases produced groups congruent with species assignment and highlighted intra-species diversity similar to that observed by M13 fingerprinting. However, IGS PCR amplification failed for 14 ML and 6 Z. mellis strains under the experimental conditions tested here, indicating that this marker could be less easy to use in fast typing protocol. Finally, our results posit that the genetic diversity within Z. sapae and Z. mellis could be shaped by isolation source. The information generated in this study would facilitate the monitoring of these yeasts during food processing and storage, and provides preliminary evidences about Z. sapae and Z. mellis intra-species diversity. Copyright © 2017 Elsevier Ltd. All rights reserved.
Kanwal, Jasmeen; Smith, Kenny; Culbertson, Jennifer; Kirby, Simon
2017-08-01
The linguist George Kingsley Zipf made a now classic observation about the relationship between a word's length and its frequency; the more frequent a word is, the shorter it tends to be. He claimed that this "Law of Abbreviation" is a universal structural property of language. The Law of Abbreviation has since been documented in a wide range of human languages, and extended to animal communication systems and even computer programming languages. Zipf hypothesised that this universal design feature arises as a result of individuals optimising form-meaning mappings under competing pressures to communicate accurately but also efficiently-his famous Principle of Least Effort. In this study, we use a miniature artificial language learning paradigm to provide direct experimental evidence for this explanatory hypothesis. We show that language users optimise form-meaning mappings only when pressures for accuracy and efficiency both operate during a communicative task, supporting Zipf's conjecture that the Principle of Least Effort can explain this universal feature of word length distributions. Copyright © 2017 Elsevier B.V. All rights reserved.
Gromisch, Elizabeth S; Zemon, Vance; Holtzer, Roee; Chiaravalloti, Nancy D; DeLuca, John; Beier, Meghan; Farrell, Eileen; Snyder, Stacey; Schairer, Laura C; Glukhovsky, Lisa; Botvinick, Jason; Sloan, Jessica; Picone, Mary Ann; Kim, Sonya; Foley, Frederick W
2016-10-01
Cognitive dysfunction is prevalent in multiple sclerosis. As self-reported cognitive functioning is unreliable, brief objective screening measures are needed. Utilizing widely used full-length neuropsychological tests, this study aimed to establish the criterion validity of highly abbreviated versions of the Brief Visuospatial Memory Test - Revised (BVMT-R), Symbol Digit Modalities Test (SDMT), Delis-Kaplan Executive Function System (D-KEFS) Sorting Test, and Controlled Oral Word Association Test (COWAT) in order to begin developing an MS-specific screening battery. Participants from Holy Name Medical Center and the Kessler Foundation were administered one or more of these four measures. Using test-specific criterion to identify impairment at both -1.5 and -2.0 SD, receiver-operating-characteristic (ROC) analyses of BVMT-R Trial 1, Trial 2, and Trial 1 + 2 raw data (N = 286) were run to calculate the classification accuracy of the abbreviated version, as well as the sensitivity and specificity. The same methods were used for SDMT 30-s and 60-s (N = 321), D-KEFS Sorting Free Card Sort 1 (N = 120), and COWAT letters F and A (N = 298). Using these definitions of impairment, each analysis yielded high classification accuracy (89.3 to 94.3%). BVMT-R Trial 1, SDMT 30-s, D-KEFS Free Card Sort 1, and COWAT F possess good criterion validity in detecting impairment on their respective overall measure, capturing much of the same information as the full version. Along with the first two trials of the California Verbal Learning Test - Second Edition (CVLT-II), these five highly abbreviated measures may be used to develop a brief screening battery.
Vya 10 x 20 NTMS area, Nevada data report (abbreviated)
International Nuclear Information System (INIS)
Cook, J.R.
1981-07-01
This abbreviated data reort presents results of ground water and stream/surface sediment reconnaissance in the National Topographic Map Series (NTMS) Vya 1 0 x 2 0 quadrangle. Surface sediment samples were collected at 1339 sites, at a target sampling density of one site per 13 square kilometers. Surface water samples were collected at 115 of these sites. Ground water samples were collected at 368 sites. Neutron activation analysis (NAA) results are given for uranium and 16 other elements in sediments, and for uranium and 9 other elements in ground water. Mass spectrometry results are given for helium in ground water. Field measurements and observations are reported for each site. Analyticl data and field measurements are presented in tables and maps. Uranium concentrations in the sediments which were above detection limits ranged from 0.50 to 24.3 ppM. The mean of the logarithms of the uranium concentrations was 0.47. Groups of high (>10 ppM) uranium occur in the DC and BF quadrangles
Fortney, Luke; Luchterhand, Charlene; Zakletskaia, Larissa; Zgierska, Aleksandra; Rakel, David
2013-01-01
Burnout, attrition, and low work satisfaction of primary care physicians are growing concerns and can have a negative influence on health care. Interventions for clinicians that improve work-life balance are few and poorly understood. We undertook this study as a first step in investigating whether an abbreviated mindfulness intervention could increase job satisfaction, quality of life, and compassion among primary care clinicians. A total of 30 primary care clinicians participated in an abbreviated mindfulness course. We used a single-sample, pre-post design. At 4 points in time (baseline, and 1 day, 8 weeks, and 9 months postintervention), participants completed a set of online measures assessing burnout, anxiety, stress, resilience, and compassion. We used a linear mixed-effects model analysis to assess changes in outcome measures. Participants had improvements compared with baseline at all 3 follow-up time points. At 9 months postintervention, they had significantly better scores (1) on all Maslach Burnout Inventory burnout subscales-Emotional Exhaustion (P =.009), Depersonalization (P = .005), and Personal Accomplishment (P job burnout, depression, anxiety, and stress. Modified mindfulness training may be a time-efficient tool to help support clinician health and well-being, which may have implications for patient care.
The un-making of a method: From rating scales to the study of psychological processes
DEFF Research Database (Denmark)
Rosenbaum, Philip J.; Valsiner, Jaan
2011-01-01
Rating scales are standard instruments in psychology. They force the research participant to provide a numerical estimate of an assumed “degree” of some characteristic along a linear scale. We prove that such numerical estimates are artifacts based on unknown psychological processes that are used...... in terms of the study of microgenesis of rating processes allows psychology access to the reality of the workings of the human mind....... in the making of a rating. Psychology’s current use of rating scales entails reliance upon unexplored and abbreviated introspection. It superimposes upon the rater the use of real numbers for the subjective construction of the ratings. The axiomatic superimposition of the notion of “degree” of subjective...
Augmented cross-sectional studies with abbreviated follow-up for estimating HIV incidence.
Claggett, B; Lagakos, S W; Wang, R
2012-03-01
Cross-sectional HIV incidence estimation based on a sensitive and less-sensitive test offers great advantages over the traditional cohort study. However, its use has been limited due to concerns about the false negative rate of the less-sensitive test, reflecting the phenomenon that some subjects may remain negative permanently on the less-sensitive test. Wang and Lagakos (2010, Biometrics 66, 864-874) propose an augmented cross-sectional design that provides one way to estimate the size of the infected population who remain negative permanently and subsequently incorporate this information in the cross-sectional incidence estimator. In an augmented cross-sectional study, subjects who test negative on the less-sensitive test in the cross-sectional survey are followed forward for transition into the nonrecent state, at which time they would test positive on the less-sensitive test. However, considerable uncertainty exists regarding the appropriate length of follow-up and the size of the infected population who remain nonreactive permanently to the less-sensitive test. In this article, we assess the impact of varying follow-up time on the resulting incidence estimators from an augmented cross-sectional study, evaluate the robustness of cross-sectional estimators to assumptions about the existence and the size of the subpopulation who will remain negative permanently, and propose a new estimator based on abbreviated follow-up time (AF). Compared to the original estimator from an augmented cross-sectional study, the AF estimator allows shorter follow-up time and does not require estimation of the mean window period, defined as the average time between detectability of HIV infection with the sensitive and less-sensitive tests. It is shown to perform well in a wide range of settings. We discuss when the AF estimator would be expected to perform well and offer design considerations for an augmented cross-sectional study with abbreviated follow-up. © 2011, The
Psychometric properties of the Chinese translation of the proactive personality scale.
Zhou, Le; Shi, Junqi
2009-08-01
The purpose of the present study was to examine the psychometric properties of the Chinese translation of the Proactive Personality Scale. Four samples were surveyed. In Sample 1 and Sample 2, exploratory and confirmatory factor analysis results confirmed the unidimensional structure of the 10-item abbreviated version of the scale. In Sample 2, Proactive Personality scores were found to be positively correlated with the personality factors of Extraversion, Conscientiousness, Openness, and Agreeableness, and negatively correlated with Neuroticism. In Sample 3, Proactive Personality was found to be positively related to self-efficacy and political skill. In Sample 4, demographics controlled, Proactive Personality explained significant incremental variance in the employees' self-rated career satisfaction and job performance as rated by immediate supervisors.
Kolyer, J. M.; Mann, N. R.
1977-01-01
Methods of accelerated and abbreviated testing were developed and applied to solar cell encapsulants. These encapsulants must provide protection for as long as 20 years outdoors at different locations within the United States. Consequently, encapsulants were exposed for increasing periods of time to the inherent climatic variables of temperature, humidity, and solar flux. Property changes in the encapsulants were observed. The goal was to predict long term behavior of encapsulants based upon experimental data obtained over relatively short test periods.
Abbreviated bibliography on energy development—A focus on the Rocky Mountain Region
Montag, Jessica M.; Willis, Carolyn J.; Glavin, Levi W.
2011-01-01
Energy development of all types continues to grow in the Rocky Mountain Region of the western United States. Federal resource managers increasingly need to balance energy demands, effects on the natural landscape and public perceptions towards these issues. To assist in efficient access to valuable information, this abbreviated bibliography provides citations to relevant information for myriad of issues for which resource managers must contend. The bibliography is organized by seven large topics with various sup-topics: broad energy topics (energy crisis, conservation, supply and demand, etc.); energy sources (fossil fuel, nuclear, renewable, etc.); natural landscape effects (climate change, ecosystem, mitigation, restoration, and reclamation, wildlife, water, etc.); human landscape effects (attitudes and perceptions, economics, community effects, health, Native Americans, etc.); research and technology; international research; and, methods and modeling. A large emphasis is placed on the natural and human landscape effects.
2014-12-01
intelligence including the Wechsler Adult Intelligence Scale III (WAIS III, Wechsler , 1997) and the Wechsler Abbreviated Scale of Intelligence ...is there a resolution? Chest 2011,140(1), 16-18. Wechsler , D. (1997). Wechsler Adult Intelligence Scale , Third Edition. San Antonio, TX...Psychological Corporation. Wechsler , D. (1999). Wechsler Abbreviated Scale of Intelligence . San Antonio, TX: Psychological
Fortney, Luke; Luchterhand, Charlene; Zakletskaia, Larissa; Zgierska, Aleksandra; Rakel, David
2013-01-01
Focus Area: Integrative Algorithms of Care Purpose: Burnout, attrition, and low work satisfaction of primary care physicians are growing concerns and can have a negative influencee on health care. Interventions for clinicians that improve work-life balance are few and poorly understood. We undertook this study as a first step in investigating whether an abbreviated mindfulness intervention could increase job satisfaction, quality of life, and compassion among primary care clinicians. Methods:...
Schnettler, Berta; Orellana, Ligia; Lobos, Germán; Miranda, Horacio; Sepúlveda, José; Etchebarne, Soledad; Mora, Marcos; Adasme-Berríos, Cristian; Grunert, Klaus G
2015-06-01
To characterize types of university students based on satisfaction with life domains that affect eating habits, satisfaction with food-related life and subjective happiness. A questionnaire was applied to a nonrandom sample of 305 students of both genders in five universities in Chile. The questionnaire included the abbreviated Multidimensional Student's Life Satisfaction Scale (MSLSS), Satisfaction with Food-related Life Scale (SWFL) and the Subjective Happiness Scale (SHS). Eating habits, frequency of food consumption in and outside the place of residence, approximate height and weight and sociodemographic variables were measured. Using factor analysis, the five-domain structure of the MSLSS was confirmed with 26 of the 30 items of the abbreviated version: Family, Friends, Self, Environment and University. Using cluster analysis four types of students were distinguished that differ significantly in the MSLSS global and domain scores, SWFL and SHS scores, gender, ownership of a food allowance card funded by the Chilean government, importance attributed to food for well-being and socioeconomic status. Higher levels of life satisfaction and happiness are associated with greater satisfaction with food-related life. Other major life domains that affect students' subjective well-being are Family, Friends, University and Self. Greater satisfaction in some domains may counterbalance the lower satisfaction in others. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.
Comparing short forms of the Social Interaction Anxiety Scale and the Social Phobia Scale.
Carleton, R Nicholas; Thibodeau, Michel A; Weeks, Justin W; Teale Sapach, Michelle J N; McEvoy, Peter M; Horswill, Samantha C; Heimberg, Richard G
2014-12-01
The Social Interaction Anxiety Scale (SIAS) and the Social Phobia Scale (SPS; Mattick & Clarke, 1998) are companion scales developed to measure anxiety in social interaction and performance situations, respectively. The measures have strong discriminant and convergent validity; however, their factor structures remain debated, and furthermore, the combined administration length (i.e., 39 items) can be prohibitive for some settings. There have been 4 attempts to assess the factor structures of the scales and reduce the item content: the 14-item Social Interaction Phobia Scale (SIPS; Carleton et al., 2009), the 12-item SIAS-6/SPS-6 (Peters, Sunderland, Andrews, Rapee, & Mattick, 2012), the 21-item abbreviated SIAS/SPS (ASIAS/ASPS; Kupper & Denollet, 2012), and the 12-item Readability SIAS and SPS (RSIAS/RSPS; Fergus, Valentiner, McGrath, Gier-Lonsway, & Kim, 2012). The current study compared the short forms on (a) factor structure, (b) ability to distinguish between clinical and non-clinical populations, (c) sensitivity to change following therapy, and (d) convergent validity with related measures. Participants included 3,607 undergraduate students (55% women) and 283 patients with social anxiety disorder (43% women). Results of confirmatory factor analyses, sensitivity analyses, and correlation analyses support the robust utility of items in the SIPS and the SPS-6 and SIAS-6 relative to the other short forms; furthermore, the SIPS and the SPS-6 and SIAS-6 were also supported by convergent validity analyses within the undergraduate sample. The RSIAS/RSPS and the ASIAS/ASPS were least supported, based on the current results and the principle of parsimony. Accordingly, researchers and clinicians should consider carefully which of the short forms will best suit their needs. (c) 2014 APA, all rights reserved.
Structure of human saposin A at lysosomal pH
International Nuclear Information System (INIS)
Hill, Chris H.; Read, Randy J.; Deane, Janet E.
2015-01-01
A 1.8 Å resolution structure of the sphingolipid activator protein saposin A has been determined at pH 4.8, the physiologically relevant lysosomal pH for hydrolase enzyme activation and lipid-transfer activity. The saposins are essential cofactors for the normal lysosomal degradation of complex glycosphingolipids by acid hydrolase enzymes; defects in either saposin or hydrolase function lead to severe metabolic diseases. Saposin A (SapA) activates the enzyme β-galactocerebrosidase (GALC), which catalyzes the breakdown of β-d-galactocerebroside, the principal lipid component of myelin. SapA is known to bind lipids and detergents in a pH-dependent manner; this is accompanied by a striking transition from a ‘closed’ to an ‘open’ conformation. However, previous structures were determined at non-lysosomal pH. This work describes a 1.8 Å resolution X-ray crystal structure determined at the physiologically relevant lysosomal pH 4.8. In the absence of lipid or detergent at pH 4.8, SapA is observeed to adopt a conformation closely resembling the previously determined ‘closed’ conformation, showing that pH alone is not sufficient for the transition to the ‘open’ conformation. Structural alignments reveal small conformational changes, highlighting regions of flexibility
Structure of human saposin A at lysosomal pH
Energy Technology Data Exchange (ETDEWEB)
Hill, Chris H.; Read, Randy J.; Deane, Janet E., E-mail: jed55@cam.ac.uk [University of Cambridge, Wellcome Trust/MRC Building, Cambridge Biomedical Campus, Hills Road, Cambridge CB2 0XY (United Kingdom)
2015-06-27
A 1.8 Å resolution structure of the sphingolipid activator protein saposin A has been determined at pH 4.8, the physiologically relevant lysosomal pH for hydrolase enzyme activation and lipid-transfer activity. The saposins are essential cofactors for the normal lysosomal degradation of complex glycosphingolipids by acid hydrolase enzymes; defects in either saposin or hydrolase function lead to severe metabolic diseases. Saposin A (SapA) activates the enzyme β-galactocerebrosidase (GALC), which catalyzes the breakdown of β-d-galactocerebroside, the principal lipid component of myelin. SapA is known to bind lipids and detergents in a pH-dependent manner; this is accompanied by a striking transition from a ‘closed’ to an ‘open’ conformation. However, previous structures were determined at non-lysosomal pH. This work describes a 1.8 Å resolution X-ray crystal structure determined at the physiologically relevant lysosomal pH 4.8. In the absence of lipid or detergent at pH 4.8, SapA is observeed to adopt a conformation closely resembling the previously determined ‘closed’ conformation, showing that pH alone is not sufficient for the transition to the ‘open’ conformation. Structural alignments reveal small conformational changes, highlighting regions of flexibility.
International Nuclear Information System (INIS)
Pham Van Cuong; Hoang Viet Cuong; Nguyen Duc Doan; Duong Thi Thu Hang; Nguyen Thi Thanh Thuy; Cao Huong Giang
2009-01-01
Foxtail millet a plant with high nutrient and high heavy metal content in the grain, is suitable to grow under drought conditions. Using millet grain to produce food for man is necessary and will bring higher economic impacts for farmers in the mountainous regions. In this study, a total of four varieties of foxtail millet (CM1, CM9, CM10 and CM11), collected in Vietnam, are described and their botanical characters characterized. Correlations were made between photosynthetic characters and dry matter accumulation under irrigated, drought and recovering conditions in a pot experiment. A field experiment was also conducted to estimate the effect of three ecological regions such as Gialam (Red River Delta with an altitude of 5-20 meters), Bacha (northern mountainous region with an altitude of 800-1000 meters) and Sapa (northern mountainous region with an altitude of 1500-1800 meters) on several agronomic characters viz., growth duration, dry matter accumulation, grain yield and grain quality of four cultivars. The average grain yield of all millet varieties were the highest in Sapa (2.7 ton/ha), followed by Bacha (2.0 ton/ha) and Gialam (1.1 ton/ha), mainly because of the large number spikelets per panicle and the higher 1000-grain weight. The highest grain yield was observed for CM1 in Gialam, whereas it was CM9 in Bacha and Sapa. This was due to the different varietal response to temperature, water supply and/or radiation. Protein content was highest for CM1 in Hanoi (14.44%) and Sapa (12.66%) but it was CM11 in Bacha (11.69%). CM11 showed the highest starch content in all three ecological regions. In Hanoi and Sapa, CM9 manifested the highest lipid content but in Bacha, it was CM10. Four levels of N fertilizer (0, 30, 45 and 60 kg N per ha) were applied in Gialam, resulting in highest grain yield for CM1 at 60 kg N level (2.78 ton per ha), but the highest for CM10 was at 45 kg N level (3.02 ton per ha). This was due to the higher chlorophyll content at the
Phenix City 10 x 20 NTMS area, Alabama and Georgia: data report (abbreviated)
International Nuclear Information System (INIS)
Bennett, C.B.
1981-08-01
This abbreviated data report presents results of ground water, surface water, and stream sediment reconnaissance in the National Topographic Map Series (NTMS) Phenix City 1 0 x 2 0 quadrangle. Surface sediment samples were collected at 1153 sites. Ground water samples were collected at 949 sites. Neutron activation analysis (NAA) results are given for uranium and 16 other elements in sediments, for uranium and 8 other elements in ground water, and for uranium and 9 other elements in surface water. Field measurements and observations are reported for each site. Analytical data and field measurments are presented in tables and maps. Uranium concentrations above detection limits in the sediment samples ranged from 1.0 to 171, with a mean of 10.6 ppM. Uranium concentrations detected in the ground water samples ranged from 0.006 to 23.1 ppB, with a mean of 0.28 ppB
Directory of Open Access Journals (Sweden)
Desrosiers Marie-Pierre
2009-04-01
Full Text Available Abstract Background The 14-item Treatment Satisfaction Questionnaire for Medication (TSQM Version 1.4 is a reliable and valid instrument to assess patients' satisfaction with medication, providing scores on four scales – side effects, effectiveness, convenience and global satisfaction. In naturalistic studies, administering the TSQM with the side effects domain could provoke the physician to assess the presence or absence of adverse events in a way that is clinically atypical, carrying the potential to interfere with routine medical care. As a result, an abbreviated 9-item TSQM (TSQM-9, derived from the TSQM Version 1.4 but without the five items of the side effects domain was created. In this study, an interactive voice response system (IVRS-administered TSQM-9 was psychometrically evaluated among patients taking antihypertensive medication. Methods A total of 3,387 subjects were invited to participate in the study from an online panel who self-reported taking a prescribed antihypertensive medication. The subjects were asked to complete the IVRS-administered TSQM-9 at the start of the study, along with the modified Morisky scale, and again within 7 to 14 days. Standard psychometric analyses were conducted; including Cronbach's alpha, intraclass correlation coefficients, structural equation modeling, Spearman correlation coefficients and analysis of covariance (ANCOVA. Results A total of 396 subjects completed all the study procedures. Approximately 50% subjects were male with a good racial/ethnic mix: 58.3% white, 18.9% black, 17.7% Hispanic and 5.1% either Asian or other. There was evidence of construct validity of the TSQM-9 based on the structural equation modeling findings of the observed data fitting the Decisional Balance Model of Treatment Satisfaction even without the side effects domain. TSQM-9 domains had high internal consistency as evident from Cronbach's alpha values of 0.84 and greater. TSQM-9 domains also demonstrated good test
2014-05-15
States, J.D., and Mango , N.K. (1999). Abbreviated injury scale unification: the case for a unified injury system for global use . J. Trauma 47, 309...Andrew Reisner,1,2 Xiaoxiao Chen,1 Kamal Kumar,1 and Jaques Reifman1 Abstract We hypothesized that vital signs could be used to improve the...logistic regression models and, using DeLong’s test, compared their area under receiver operating characteristic curves (ROC AUCs) for three outcomes
International Nuclear Information System (INIS)
Costa Neto, Sebastiao Benicio da
1995-01-01
The essay on the pertinence of Luscher's abbreviate test in psychological evaluation of the radioactive accident victims of Goiania - Brazilian city - occurred in 1987 is consequence of confront of data obtained in two distinct situations having for criterion: time, efficiency and pertinence. Besides of this, they are introduced palografic and the house-tree-person - HTP - tests. These tests aimed at the common psychological characteristics verification to radioactive accident victims' personality of Goiania and to the data existential moment for those people. Among the three tests, the one of Luscher was what obtained the best interviewees acceptance index
Evaluation of the small-scale hydro-energetic potential in micro-basins in Colombia
International Nuclear Information System (INIS)
Torres Q, E.; Castillo C, J.J.
1995-01-01
A definition of the small-scale hydroelectric power plants (PCHs, abbreviations in Spanish), its classification according to potency and fall and its classification as utilization form is present. The general parameters to PCHs design in aspects as topography studies, geology and geotechnical studies and hydrologic studies are described. The primary elements of a PCH, as dam (little dam), conduction, tank of charge, sand trap (water re claimer), floodgate, grating (network), pressure's pipe, fall, principal valve and turbine are shown. In the study of potential of micro-basins, general points as topography, draining, population, supply and demand of electric energy, morphology, hydrology, geology and hydraulic potential are consider
Long term socio-ecological research across temporal and spatial scales
Singh, S. J.; Haberl, H.
2012-04-01
Long term socio-ecological research across temporal and spatial scales Simron Jit Singh and Helmut Haberl Institute of Social Ecology, Vienna, Austria Understanding trajectories of change in coupled socio-ecological (or human-environment) systems requires monitoring and analysis at several spatial and temporal scales. Long-term ecosystem research (LTER) is a strand of research coupled with observation systems and infrastructures (LTER sites) aimed at understanding how global change affects ecosystems around the world. In recent years it has been increasingly recognized that sustainability concerns require extending this approach to long-term socio-ecological research, i.e. a more integrated perspective that focuses on interaction processes between society and ecosystems over longer time periods. Thus, Long-Term Socio-Ecological Research, abbreviated LTSER, aims at observing, analyzing, understanding and modelling of changes in coupled socio-ecological systems over long periods of time. Indeed, the magnitude of the problems we now face is an outcome of a much longer process, accelerated by industrialisation since the nineteenth century. The paper will provide an overview of a book (in press) on LTSER with particular emphasis on 'socio-ecological transitions' in terms of material, energy and land use dynamics across temporal and spatial scales.
Marshall, Leisa L; Nykamp, Diane L; Momary, Kathryn M
2014-12-15
To compare the impact of 2 different teaching and learning methods on student mastery of learning objectives in a pharmacotherapy module in the large classroom setting. Two teaching and learning methods were implemented and compared in a required pharmacotherapy module for 2 years. The first year, multiple interactive mini-cases with inclass individual assessment and an abbreviated lecture were used to teach osteoarthritis; a traditional lecture with 1 inclass case discussion was used to teach gout. In the second year, the same topics were used but the methods were flipped. Student performance on pre/post individual readiness assessment tests (iRATs), case questions, and subsequent examinations were compared each year by the teaching and learning method and then between years by topic for each method. Students also voluntarily completed a 20-item evaluation of the teaching and learning methods. Postpresentation iRATs were significantly higher than prepresentation iRATs for each topic each year with the interactive mini-cases; there was no significant difference in iRATs before and after traditional lecture. For osteoarthritis, postpresentation iRATs after interactive mini-cases in year 1 were significantly higher than postpresentation iRATs after traditional lecture in year 2; the difference in iRATs for gout per learning method was not significant. The difference between examination performance for osteoarthritis and gout was not significant when the teaching and learning methods were compared. On the student evaluations, 2 items were significant both years when answers were compared by teaching and learning method. Each year, students ranked their class participation higher with interactive cases than with traditional lecture, but both years they reported enjoying the traditional lecture format more. Multiple interactive mini-cases with an abbreviated lecture improved immediate mastery of learning objectives compared to a traditional lecture format, regardless of
Sjonnesen, Kirsten; Bulloch, Andrew G M; Williams, Jeanne; Lavorato, Dina; B Patten, Scott
2016-04-01
The World Health Organization Disability Assessment Schedule 2.0 (WHODAS 2.0) is a disability scale included in Section 3 of the fifth edition of the Diagnostic and Statistical Manual of Mental Disorders (DSM-5) as a possible replacement for the Global Assessment of Functioning Scale (GAF). To assist Canadian psychiatrists with interpretation of the scale, we have conducted a descriptive analysis using data from the 2012 Canadian Community Health Survey-Mental Health component (CCHS-MH). The 2012 CCHS-MH was a cross-sectional survey of the Canadian community (n = 23,757). The survey included an abbreviated 12-item version of the WHODAS 2.0. Mental disorder diagnoses were assessed for schizophrenia, other psychosis, major depressive episode (MDE), generalized anxiety disorder (GAD), bipolar I disorder, substance abuse/dependence, and alcohol abuse/dependence. Mean scores ranged from 14.2 (95% CI, 14.1 to 14.3) for the overall community population to 23.1 (95% CI, 19.5 to 26.7) for those with schizophrenia, with higher scores indicating greater disability. Furthermore, the difference in scores between those with lifetime and past-month episodes suggests that the scale is sensitive to changes occurring during the course of these disorders; for example, scores varied from 23.6 (95% CI, 22.2 to 25.1) for past-month MDE to 14.4 (95% CI, 14.2 to 14.7) in the lifetime MDE group without a past-year episode. This analysis suggests that the WHODAS 2.0 may be a suitable replacement for the GAF. As a disability measure, even though it is not a mental health-specific instrument, the 12-item WHODAS 2.0 appears to be sensitive to the impact of mental disorders and to changes over the time course of a mental disorder. However, the clinical utility of this measure requires additional assessment. © The Author(s) 2016.
Khang, Dongwoo; Rim, Hyo-Deog; Woo, Jungmin
2013-03-01
The Body Image Scale (BIS) developed in collaboration with the European Organization for Research and Treatment of Cancer (EORTC) Quality of Life Study Group is a brief questionnaire for measuring body image concerns in patients with cancer. This study sought to assess the reliability and validity of the Korean version of the Body Image Scale (K-BIS). The participants consisted of 155 postoperative breast cancer patients (56 breast conserving surgery, 56 mastectomy, and 43 oncoplastic surgery). Subjects were evaluated using the K-BIS, the Body-Esteem Scale for Adolescents and Adults (BESAA), the Rosenberg Self-Esteem Scale (RSES), the Hospital Anxiety and Depression Scale (HADS), and the World Health Organization Quality of Life Scale Abbreviated Version (WHOQOL-BREF). Test-retest reliability and internal consistency were examined as a measure of reliability and validity was evaluated by convergent validity, discriminant validity and factor analysis. Cronbach's α value was 0.943. The total score of the K-BIS was negatively correlated with the BESAA (r=0.301, p59% variance. The K-BIS showed good reliability and validity for assessment of body image in Korean breast cancer patients.
Directory of Open Access Journals (Sweden)
Roy Fox
2008-12-01
Full Text Available Roy Fox1, Tara Sampalli1, Jonathan Fox11Nova Scotia Environmental Health Centre, Fall River, NS, CanadaAbstract: The Nova Scotia Environmental Health Centre is a treatment facility for individuals with chronic environmental conditions such as multiple chemical sensitivity, chronic fatigue syndrome, fibromyalgia, chronic respiratory conditions and in some cases chronic pain. The premise of care is to provide a patient-centred multidisciplinary care approach leading to self-management strategies. In order to measure the outcome of the treatment in these complex problems, with overlapping diagnoses, symptoms in many body systems and suspected environmental triggers, a detailed symptoms questionnaire was developed specifically for this patient population and validated. Results from a pilot study in which an abbreviated symptoms questionnaire based on the top reported symptoms captured in previous research was used to measure the efficacy of a multidisciplinary care approach in individuals with multiple chemical sensitivity are presented in this paper. The purpose of this study was to examine the extent, type and patterns of changes over time in the top reported symptoms with treatment measured using the abbreviated symptoms questionnaire. A total of 183 active and 109 discharged patients participated in the study where the health status was measured at different time periods of follow up since the commencement of treatment at the Centre. The findings from this study were successful in generating an initial picture of the nature and type of changes in these symptoms. For instance, symptoms such as difficulty concentrating, sinus conditions and tiredness showed early improvement, within the first 6 months of being in treatment, while others, such as fatigue, hoarseness or loss of voice, took longer while others showed inconsistent changes warranting further enquiry. A controlled longitudinal study is planned to confirm the findings of the pilot study
Yoon, Dok Hyun; Sohn, Byeong Seok; Oh, Sung Yong; Lee, Won-Sik; Lee, Sang Min; Yang, Deok-Hwan; Huh, Jooryung; Suh, Cheolwon
2017-02-21
The appropriate number of chemotherapy cycles for limited stage diffuse large B-cell lymphoma (DLBCL) patients without gross residual lesions after complete resection, has not been specifically questioned. We performed a multicenter, single-arm, phase 2 study to investigate the feasibility of 3 cycles of abbreviated R-CHOP chemotherapy in low-risk patients with completely resected localized CD20+ DLBCL. Between December 2010 and May 2013, we recruited 23 patients. One was excluded due to ineligibility, and hence, 22 were included in the final analysis. The primary sites comprised the intestine (n = 15), cervical lymph nodes (n = 4), stomach (n = 1), tonsil (n = 1), and spleen (n = 1). All patients successfully completed the 3 cycles of planned R-CHOP chemotherapy. Over a median follow-up of 39.5 months (95% confidence interval, 29.9-47.1 months), both the estimated 2-year disease-free survival and overall survival rates was 95% confidence interval, 85.9-104.1%. Only one patient with an international prognostic index of 2 experienced relapse and died. The most common grade 3 or 4 toxicity condition included neutropenia (n = 8, 36.4%). Three patients experienced grade 3 febrile neutropenia, but no grade 3 or 4 non-hematologic toxicity was observed. DLBCL patients without residual lesions after resection were enrolled and R-CHOP chemotherapy was repeated at 3-week-intervals over 3 cycles. The primary endpoint was 2-year disease-free survival. Three cycles of abbreviated R-CHOP immunochemotherapy is feasible for completely resected low risk localized DLBCL.
Directory of Open Access Journals (Sweden)
Berta Schnettler
2017-07-01
Full Text Available The Multidimensional Students’ Life Satisfaction Scale is an instrument to assess life satisfaction in children and adolescents in five life domains. However, research on multidimensional life satisfaction in older students, such as those attending university, is still scarce. This paper undertook to evaluate the psychometric properties of the Multidimensional Students’ Life Satisfaction Scale in a sample of university students from five state universities in Chile. The Multidimensional Students’ Life Satisfaction Scale and Satisfaction with Life Scale were applied to 369 participants. Confirmatory factor analysis was used to evaluate the expected correlated five-factor model of the long version (40 items and the abbreviated version (30 items of the Multidimensional Students’ Life Satisfaction Scale. The goodness-of-fit values obtained from confirmatory factor analysis revealed that the data fit better to the 30-items and five-factor structure than to the 40-item structure. The convergent, concurrent and discriminant validity of the 30-item version was demonstrated. The 30-item version of the Multidimensional Students’ Life Satisfaction Scale may be a promising alternative to measure satisfaction in different life domains in university students, and a valuable tool for differential assessments that guide research and intervention on this population.
Mallimaci, María Cristina; Sosa-Estani, Sergio; Russomando, Graciela; Sanchez, Zunilda; Sijvarger, Carina; Alvarez, Isabel Marcela; Barrionuevo, Lola; Lopez, Carlos; Segura, Elsa Leonor
2010-01-01
Chagas' disease, or American trypanosomiasis, is caused by the protozoan parasite Trypanasoma cruzi. It is estimated that 15,000 new cases of congenital T. cruzi transmission occur in the Americas each year. The aim of this study was to estimate the rate of congenital T. cruzi infection in infants born to infected women living in Ushuaia, Argentina, as well to assess a serologic test using Shed Acute Phase Antigen (SAPA) for a timely diagnosis of congenital infection. The rate of congenital infection among children in the study was 4.4% (3/68). Our results show that for infants younger than 30 days of age, matched blood samples from mother and infant were capable of identifying congenital transmission of infection using an enzyme-linked immunosorbent assay with SAPA. For infants older than 3 months, congenital infection could be ruled out using the same procedure. PMID:20064996
DEFF Research Database (Denmark)
Massumi, Mohammad; Pourasgari, Farzaneh; Nalla, Amarnadh
2016-01-01
developed an abbreviated five-stage protocol (25-30 days) to generate human Embryonic Stem Cell-Derived Beta-like Cells (ES-DBCs). We showed that Geltrex, as an extracellular matrix, could support the generation of ES-DBCs more efficiently than that of the previously described culture systems......The ability to yield glucose-responsive pancreatic beta-cells from human pluripotent stem cells in vitro will facilitate the development of the cell replacement therapies for the treatment of Type 1 Diabetes. Here, through the sequential in vitro targeting of selected signaling pathways, we have...... positive cells, 1% insulin and glucagon positive cells and 30% insulin and NKX6.1 co-expressing cells. Functionally, ES-DBCs were responsive to high glucose in static incubation and perifusion studies, and could secrete insulin in response to successive glucose stimulations. Mitochondrial metabolic flux...
Meta-Heuristics in Short Scale Construction: Ant Colony Optimization and Genetic Algorithm.
Schroeders, Ulrich; Wilhelm, Oliver; Olaru, Gabriel
2016-01-01
The advent of large-scale assessment, but also the more frequent use of longitudinal and multivariate approaches to measurement in psychological, educational, and sociological research, caused an increased demand for psychometrically sound short scales. Shortening scales economizes on valuable administration time, but might result in inadequate measures because reducing an item set could: a) change the internal structure of the measure, b) result in poorer reliability and measurement precision, c) deliver measures that cannot effectively discriminate between persons on the intended ability spectrum, and d) reduce test-criterion relations. Different approaches to abbreviate measures fare differently with respect to the above-mentioned problems. Therefore, we compare the quality and efficiency of three item selection strategies to derive short scales from an existing long version: a Stepwise COnfirmatory Factor Analytical approach (SCOFA) that maximizes factor loadings and two metaheuristics, specifically an Ant Colony Optimization (ACO) with a tailored user-defined optimization function and a Genetic Algorithm (GA) with an unspecific cost-reduction function. SCOFA compiled short versions were highly reliable, but had poor validity. In contrast, both metaheuristics outperformed SCOFA and produced efficient and psychometrically sound short versions (unidimensional, reliable, sensitive, and valid). We discuss under which circumstances ACO and GA produce equivalent results and provide recommendations for conditions in which it is advisable to use a metaheuristic with an unspecific out-of-the-box optimization function.
Campbell, Justin S; Pulos, Steven; Haran, F Jay; Tsao, Jack W; Alphonso, Aimee L
2015-01-01
This study describes the psychometric investigation of an 11-item symptom checklist, the Abbreviated Concussion Symptom Inventory (ACSI). The ACSI is a dichotomously scored list of postconcussive symptoms associated with mild traumatic brain injury. The ACSI was administered to Marines (N = 1,435) within the 1st month of their return from combat deployments to Afghanistan. Psychometric analyses based upon nonparametric item response theory supported scoring the ACSI via simple summation of symptom endorsements; doing so produced a total score with good reliability (α = .802). Total scores were also found to significantly differentiate between different levels of head injury complexity during deployment, F(3, 1,431) = 100.75, p < .001. The findings support the use of the ASCI in research settings requiring a psychometrically reliable measure of postconcussion symptoms.
GWOT Vascular Injury Study 2 Supplemental Project: Impact of Prophylactic Fasciotomy
2016-10-01
1Injury Severity Score 2005: The Injury Severity Score (ISS) is an anatomical scoring system that...iss.html 2Abbreviated Injury Score (Affected Extremity): The Abbreviated Injury Scale (AIS) is an anatomical scoring system first introduced in...documented diagnosis or treatment for one or more of the following: Rhabdomyolysis, Renal Failure, Paralysis, or Pulmonary Embolism 7Extremity
Diagnostic Accuracy of Rating Scales for Attention-Deficit/Hyperactivity Disorder: A Meta-analysis.
Chang, Ling-Yin; Wang, Mei-Yeh; Tsai, Pei-Shan
2016-03-01
The Child Behavior Checklist-Attention Problem (CBCL-AP) scale and Conners Rating Scale-Revised (CRS-R) are commonly used behavioral rating scales for diagnosing attention-deficit/hyperactivity disorder (ADHD) in children and adolescents. To evaluate and compare the diagnostic performance of CBCL-AP and CRS-R in diagnosing ADHD in children and adolescents. PubMed, Ovid Medline, and other relevant electronic databases were searched for articles published up to May 2015. We included studies evaluating the diagnostic performance of either CBCL-AP scale or CRS-R for diagnosing ADHD in pediatric populations in comparison with a defined reference standard. Bivariate random effects models were used for pooling and comparing diagnostic performance. We identified and evaluated 14 and 11 articles on CBCL-AP and CRS-R, respectively. The results revealed pooled sensitivities of 0.77, 0.75, 0.72, and 0.83 and pooled specificities of 0.73, 0.75, 0.84, and 0.84 for CBCL-AP, Conners Parent Rating Scale-Revised, Conners Teacher Rating Scale-Revised, and Conners Abbreviated Symptom Questionnaire (ASQ), respectively. No difference was observed in the diagnostic performance of the various scales. Study location, age of participants, and percentage of female participants explained the heterogeneity in the specificity of the CBCL-AP. CBCL-AP and CRS-R both yielded moderate sensitivity and specificity in diagnosing ADHD. According to the comparable diagnostic performance of all examined scales, ASQ may be the most effective diagnostic tool in assessing ADHD because of its brevity and high diagnostic accuracy. CBCL is recommended for more comprehensive assessments. Copyright © 2016 by the American Academy of Pediatrics.
Systemic Arterial-to-Pulmonary Artery Shunt Utilization
African Journals Online (AJOL)
multiruka1
In certain circumstances, such as cyanotic neonates with tetralogy of Fallot (4) or cyanotic patients with. Tetralogy of Fallot and hypoplastic pulmonary arteries. (5), better outcomes are obtained if definitive surgery. (total correction or palliation) is preceded by creation of a systemic arterial-to-pulmonary artery shunt (SAPAS).
What's in a name? Word inflation, punctuation, abbreviation and cloud formation.
Schofield, Susie J; Schofield, Pieta G
2016-12-01
The title of a journal paper offers a crucial portal into any scientific field. It determines whether interested readers locate the paper and whether others have enough interest sparked to lead them to read the abstract. This article looks at authored journal paper titles in Medical Education over its first 50 years (n = 6357) of publication and Medical Teacher over its first 35 years of publication, revealing both trends in areas of interest and how those interests are worded. Word clouds per decade showed a shift from teaching to learning and from examination to assessment, and new foci on learning, patients, research and feedback in both journals. The average length of title in Medical Education peeked in the 2000s, dropping to 70 characters in the 2010s, with no titles being longer than 140 characters (the length of a tweet) in this last decade. Abbreviations were used sparingly. The use of humorous titles, although not common, has increased in recent years. The use of the colon showed a marked increase in the 1980s, dropping a little in the 2000s but resurging in the 2010s. Titles posed as a question increased steadily, appearing to plateau in the 2000s at 11%. The use of humour and questions suggests that the authors of these articles are submitting papers to be selected by the human rather than just the virtual eye. We also hypothesise that the use of humour may indicate a maturation of medical education as a subject. © 2016 John Wiley & Sons Ltd and The Association for the Study of Medical Education.
Perceived HIV-associated stigma among HIV-seropositive men: psychometric study of HIV stigma scale
Directory of Open Access Journals (Sweden)
Adrian eValle
2015-07-01
Full Text Available Objectives: To assess the internal consistency and factor structure of the abridged Spanish version of the Berger HIV Stigma Scale (HSS-21, provide evidence for its convergent and discriminant validity, and describe perceived stigma in an urban population from northeast Mexico. Methods: Seventy five HIV-positive men who have sex with men (MSM were recruited. Participants answered the Spanish versions of three Likert-type scales: HSS-21, Robsenberg’s self-esteem scale, and the abbreviated version of the Zung’s Depression Scale.Results: HSS-21 showed high reliability and validity; its factor structure included four components: concern with public attitudes; negative self-image; disclosure concerns; and enacted stigma. The level of stigma was high in 27 out of 75 (36% participants; nevertheless, the score found in the component related to disclosure concerns indicated high level of stigma in 68% of participants. The score of HSS-21 was positively correlated with the score of depression and negatively correlated with the score of self-esteem. Conclusion: Results demonstrated high reliability for the HSS-21; correlations with other scales supported its validity. This scale demonstrated to be a practical tool for assessing stigma among Mexican HIV-positive MSM. High level of stigma was found only in the factor related to disclosure concerns. Policy Implications: Identifying HIV-associated stigma through a short, reliable and validated instrument will allow the development of interventions that cope and manage stigma in HIV-positive MSM. HSS-21 distinguishes between different dimensions of stigma and will contribute to a better understanding of this phenomenon.
Validity and reliability of Abbreviated Mental Test Score (AMTS) among older Iranian.
Foroughan, Mahshid; Wahlund, Lars-Olof; Jafari, Zahra; Rahgozar, Mehdi; Farahani, Ida G; Rashedi, Vahid
2017-11-01
Cognitive impairment is common among older people and is associated with increased morbidity and mortality. The main aim of this study was to evaluate the validity of the Persian version of the Abbreviated Mental Test Score (AMTS) as a screening tool for dementia. Data were obtained from a cross-sectional study. One hundred and one older adults who were members of Iranian Alzheimer Association and 101 of their siblings were entered into this study by convenient sampling. The Diagnostic and Statistical Manual of Mental Disorders, 4th edition, criteria for diagnosing dementia and the Mini-Mental State Examination were used as the study tools. The gathered data were analyzed by the Mann-Whitney U-test, the Kruskal-Wallis test, Spearman's rank correlation coefficient, and the receiver-operating characteristic. The AMTS could successfully differentiate the dementia group from the non-dementia group. Scores were significantly correlated with Diagnostic and Statistical Manual of Mental Disorders diagnosis for dementia and Mini-Mental State Examination scores (P < 0.001). Educational level (P < 0.001) and male sex (P = 0.015) were positively associated with AMTS, whereas (P < 0.001) was negatively associated with AMTS. Total Cronbach's α coefficient was 0.90. The scores 6 and 7 showed the optimum balance between sensitivity (99% and 94%, respectively) and specificity (85% and 86%, respectively). The Persian version of the AMTS is a valid cognitive assessment tool for older Iranian adults and can be used for dementia screening in Iran. © 2017 Japanese Psychogeriatric Society.
Ewalt, Darla R.; Bricker, Betsy J.
2000-01-01
The Brucella AMOS PCR assay was previously developed to identify and differentiate specific Brucella species. In this study, an abbreviated Brucella AMOS PCR test was evaluated to determine its accuracy in differentiating Brucella abortus into three categories: field strains, vaccine strain 19 (S19), and vaccine strain RB51/parent strain 2308 (S2308). Two hundred thirty-one isolates were identified and tested by the conventional biochemical tests and Brucella AMOS PCR. This included 120 isola...
Johnson, Eboneé T.; Yaghmaian, Rana A.; Best, Andrew; Chan, Fong; Burrell, Reginald, Jr.
2016-01-01
Purpose: The purpose of this study was to validate the 10-item version of the HIV Stigma Scale (HSS-10) in a sample of African Americans with HIV/AIDS. Method: One hundred and ten African Americans living with HIV/AIDS were recruited from 3 case management agencies in Baton Rouge, Louisiana. Measurement structure of the HSS-10 was evaluated using…
Directory of Open Access Journals (Sweden)
Xijuan Zhang
Full Text Available Reverse worded (RW items are often used to reduce or eliminate acquiescence bias, but there is a rising concern about their harmful effects on the covariance structure of the scale. Therefore, results obtained via traditional covariance analyses may be distorted. This study examined the effect of the RW items on the factor structure of the abbreviated 18-item Need for Cognition (NFC scale using confirmatory factor analysis. We modified the scale to create three revised versions, varying from no RW items to all RW items. We also manipulated the type of the RW items (polar opposite vs. negated. To each of the four scales, we fit four previously developed models. The four models included a 1-factor model, a 2-factor model distinguishing between positively worded (PW items and RW items, and two 2-factor models, each with one substantive factor and one method factor. Results showed that the number and type of the RW items affected the factor structure of the NFC scale. Consistent with previous research findings, for the original NFC scale, which contains both PW and RW items, the 1-factor model did not have good fit. In contrast, for the revised scales that had no RW items or all RW items, the 1-factor model had reasonably good fit. In addition, for the scale with polar opposite and negated RW items, the factor model with a method factor among the polar opposite items had considerably better fit than the 1-factor model.
Green, Samuel B; Pennar, Amy L; Bradley, Robert H
2018-05-01
The Home Observation for Measurement of the Environment (HOME) Inventory is designed to assess the quality and quantity of support, stimulation, and structure provided to children in the home environment. HOME has been widely used for research and applied purposes. We focused on an abbreviated version of the Early Adolescent HOME (EA-HOME-A) that was administered to 15-year-old adolescents and their parents ( N = 958) as part of the NICHD (National Institute of Child Health and Human Development) Study of Early Child Care and Youth Development. Our study had two objectives. First, we hypothesized and tested a bifactor model that specified a general factor in support of the use of the HOME total score and group factors for subsets of items in support of the content domain scores. Second, we applied structural equation modeling to relate the EA-HOME-A factors to outcome factors assessing maladaptive behaviors, autonomy, self-control, and cognitive-academic performance. The results supported the construct validity of the EA-HOME-A with respect to its internal structure as well as its correlates.
Injury severity assessment for car occupants in frontal impacts, using disability scaling.
Norin, H; Krafft, M; Korner, J; Nygren, A; Tingvall, C
1997-01-01
Injury classification and assessment is one of the most important fields of injury prevention. At present, injury assessment focuses primarily on the risk of fatalities, in spite of the fact that most people who are injured survive the trauma. The net result of a fatality-based approach is that safety and vehicle engineers must make decisions with an incomplete, and sometimes misleading, picture of the traffic safety problem. By applying disability scaling reflecting long-term consequences to injury data, the most significant disabling injuries can be identified. The priorities change with the level of disability used in the scaling. In this study, the risk of permanent medical disability due to different injuries was derived and linked to abbreviated injury scale (AIS) values for 24,087 different injured body regions. This material is based on insurance data. To study how the importance of different bodily injuries changes with different severity assessments in a realistic real-world injury distribution, Swedish insurance industry disability scaling was applied to 3066 cases of belted Volvo drivers involved in frontal collisions. Crash severity was included in the study by using equivalent barrier speed (EBS). When lower levels of disability are included, injuries to the neck and the extremities become the most important, while brain and skull injuries become the most prominent at higher levels of disability. The results presented in this article should be regarded as a contribution to the development of a suitable disability scaling method. The results can also be utilized to further injury research and vehicle design aimed at reducing injuries which have the most important long-term disability consequences.
Linn, S
One of the more often used measures of multiple injuries is the injury severity score (ISS). Determination of the ISS is based on the abbreviated injury scale (AIS). This paper suggests a new algorithm to sort the AISs for each case and calculate ISS. The program uses unsorted abbreviated injury scale (AIS) levels for each case and rearranges them in descending order. The first three sorted AISs representing the three most severe injuries of a person are then used to calculate injury severity score (ISS). This algorithm should be useful for analyses of clusters of injuries especially when more patients have multiple injuries.
Scott, Wayne C.; Austin, David W.; Reid, David S.
2007-01-01
To promote efficient clinical practice, interest has been growing in brief assessment scales to replace full-scale versions in some circumstances. In nonclinical populations, the Wechsler Abbreviated Scale of Intelligence (WASI) has substituted for the Wechsler Intelligence Scale for Children--Third Edition (WISC-III). Agreement between these…
Selected personality data from the SAPA-Project: On the structure of phrased self-report items
Directory of Open Access Journals (Sweden)
David M Condon
2015-08-01
Full Text Available These data were collected to evaluate the structure of personality constructs in the temperament domain. In the context of modern personality theory, these constructs are typically construed in terms of the Big Five (Conscientiousness, Agreeableness, Neuroticism, Openness, and Extraversion though several additional constructs were included here. Approximately 24,000 individuals were administered random subsets of 696 items from 92 public-domain personality scales using the Synthetic Aperture Personality Assessment method between December 8, 2013 and July 26, 2014. The data are available in rdata format and are accompanied by documentation stored as a text file. Re-use potential include many types of structural and correlational analyses of personality.
Abbreviated MRI protocols for detecting breast cancer in women with dense breasts
Energy Technology Data Exchange (ETDEWEB)
Chen, Shung Qing; Huang, Min; Shen, Yu Ying; Liu, Chen Lu; Xu, Chuan Xiao [The Affiliated Suzhou Hospital, Nanjing Medical University, Suzhou (China)
2017-06-15
To evaluate the validity of two abbreviated protocols (AP) of MRI in breast cancer screening of dense breast tissue. This was a retrospective study in 356 participants with dense breast tissue and negative mammography results. The study was approved by the Nanjing Medical University Ethics Committee. Patients were imaged with a full diagnostic protocol (FDP) of MRI. Two APs (AP-1 consisting of the first post-contrast subtracted [FAST] and maximum-intensity projection [MIP] images, and AP-2 consisting of AP-1 combined with diffusion-weighted imaging [DWI]) and FDP images were analyzed separately, and the sensitivities and specificities of breast cancer detection were calculated. Of the 356 women, 67 lesions were detected in 67 women (18.8%) by standard MR protocol, and histological examination revealed 14 malignant lesions and 53 benign lesions. The average interpretation time of AP-1 and AP-2 were 37 seconds and 54 seconds, respectively, while the average interpretation time of the FDP was 3 minutes and 25 seconds. The sensitivities of the AP-1, AP-2, and FDP were 92.9, 100, and 100%, respectively, and the specificities of the three MR protocols were 86.5, 95.0, and 96.8%, respectively. There was no significant difference among the three MR protocols in the diagnosis of breast cancer (p > 0.05). However, the specificity of AP-1 was significantly lower than that of AP-2 (p = 0.031) and FDP (p = 0.035), while there was no difference between AP-2 and FDP (p > 0.05). The AP may be efficient in the breast cancer screening of dense breast tissue. FAST and MIP images combined with DWI of MRI are helpful to improve the specificity of breast cancer detection.
Economic scale of utilization of radiation (2): agriculture. Comparison between Japan and the U.S.A.
Energy Technology Data Exchange (ETDEWEB)
Kume, Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Amano, Etsuo [Fukui Prefectural Univ., Research Center for Bioresources Dept., Awara, Fukui (Japan); Nakanishi, Tomoko M. [Tokyo Univ., Graduate School of Agriculture and Life Sciences, Tokyo (Japan); Chino, Mitsuo [Akita Prefectural Univ., Faculty of Bioresource Sciences, Akita (Japan)
2002-10-01
The economic scale of the application of radiation in the field of agriculture in Japan was estimated from public documents to be about 964M$ (million dollars) in 1997. In the food irradiation, an amount of 15,000t of potatoes irradiated per year in Hokkaido was estimated to be worth 16M$. Sterile Insect Technique (SIT) used for combating losses due to the melon fly in the mainly Okinawa region produced as much as 70M$ in benefits. Production of rice using varieties developed by mutation breeding was about 3% of overall production in Japan and the economic scale was 774M$. Radioisotope (RI) utilized in laboratory work, environmental analysis and chronology was accounted to be as high as 24M$. The relative ratios of radiation processing (136M$), mutation breeding (804M$) and RI utilization (24M$) were 14%, 83%, and 3%, respectively. The economic scale surveys in food irradiation and mutation breeding were extended to the United Sates of America (hereinafter abbreviated as U.S.A. or U.S.) for a direct comparison to the situation in Japan. As to maximum estimation, it amounted to be 3.2b$ (billion dollars) for food irradiation and 11.2b$ for mutation breeding. The economic scale for agriculture products within our scope was 14.5b$ for the U.S. and about 0.8b$ for Japan, implying that the former is larger in magnitude by a factor of about 18. (author)
Economic scale of utilization of radiation (2): agriculture. Comparison between Japan and the U.S.A
International Nuclear Information System (INIS)
Kume, Tamikazu; Nakanishi, Tomoko M.; Chino, Mitsuo
2002-01-01
The economic scale of the application of radiation in the field of agriculture in Japan was estimated from public documents to be about 964M$ (million dollars) in 1997. In the food irradiation, an amount of 15,000t of potatoes irradiated per year in Hokkaido was estimated to be worth 16M$. Sterile Insect Technique (SIT) used for combating losses due to the melon fly in the mainly Okinawa region produced as much as 70M$ in benefits. Production of rice using varieties developed by mutation breeding was about 3% of overall production in Japan and the economic scale was 774M$. Radioisotope (RI) utilized in laboratory work, environmental analysis and chronology was accounted to be as high as 24M$. The relative ratios of radiation processing (136M$), mutation breeding (804M$) and RI utilization (24M$) were 14%, 83%, and 3%, respectively. The economic scale surveys in food irradiation and mutation breeding were extended to the United Sates of America (hereinafter abbreviated as U.S.A. or U.S.) for a direct comparison to the situation in Japan. As to maximum estimation, it amounted to be 3.2b$ (billion dollars) for food irradiation and 11.2b$ for mutation breeding. The economic scale for agriculture products within our scope was 14.5b$ for the U.S. and about 0.8b$ for Japan, implying that the former is larger in magnitude by a factor of about 18. (author)
Delmotte, Sylvestre; Lopez-Ridaura, Santiago; Barbier, Jean-Marc; Wery, Jacques
2013-11-15
Evaluating the impacts of the development of alternative agricultural systems, such as organic or low-input cropping systems, in the context of an agricultural region requires the use of specific tools and methodologies. They should allow a prospective (using scenarios), multi-scale (taking into account the field, farm and regional level), integrated (notably multicriteria) and participatory assessment, abbreviated PIAAS (for Participatory Integrated Assessment of Agricultural System). In this paper, we compare the possible contribution to PIAAS of three modeling approaches i.e. Bio-Economic Modeling (BEM), Agent-Based Modeling (ABM) and statistical Land-Use/Land Cover Change (LUCC) models. After a presentation of each approach, we analyze their advantages and drawbacks, and identify their possible complementarities for PIAAS. Statistical LUCC modeling is a suitable approach for multi-scale analysis of past changes and can be used to start discussion about the futures with stakeholders. BEM and ABM approaches have complementary features for scenarios assessment at different scales. While ABM has been widely used for participatory assessment, BEM has been rarely used satisfactorily in a participatory manner. On the basis of these results, we propose to combine these three approaches in a framework targeted to PIAAS. Copyright © 2013 Elsevier Ltd. All rights reserved.
[Performance of an abbreviated mini mental examination to detect dementia in older people].
Jiménez, Daniel; Lavados, Manuel; Rojas, Paula; Henríquez, Claudio; Silva, Fernando; Guillón, Marta
2017-07-01
The usefulness of the abbreviated Mini-Mental State Examination included in the Chilean Functional assessment of elderly people (MM-SE-EFAM) to detect Dementia has not been determined. To assess the performance of the MMSE-EFAM to detect dementia. We studied a non-probabilistic sample of subjects older than 65 years who had been assessed by the MMSE-EFAM in a Chilean primary care center during a period of 6 months. Patients underwent clinical evaluation by a neurologist blinded to MMSE-EFAM score, to establish the diagnosis of dementia using DSM-IV-TR criteria. Besides, the full Mini-Mental State Examination (MMSE) was applied. The clinical diagnosis of Dementia was established in 13 of the 54 peoples evaluated. MMSE-EFAM had a sensitivity of 30.8% (95% confidence intervals (CI); 9-61.4) and a specificity of 90.2% (95% CI; 76.9%-97.3%), while MMSE had a sensitivity of 84.6% (95% CI; 54.6-98.1) and a specificity of 58.5% (95% CI; 42.1-73.7). In a receiver operating characteristic (ROC) curve analysis, the areas under the curve (AUC) were 0.77 (95% CI; 0.61-0.93) and 0.82 (95% CI; 0.70-0.95) for MMSE-EFAM and MMSE, respectively. Socio-demographic variables did not influence test performance in both cases. MMSE-EFAM has a low sensitivity to detect patients with Dementia and it is not an effective screening tool. These results are in agreement with the evidence and international guidelines that do not support the use of cognitive screening tools to detect dementia in the older general population.
2011-01-01
Background Nonparametric item response theory (IRT) was used to examine (a) the performance of the 30 Positive and Negative Syndrome Scale (PANSS) items and their options ((levels of severity), (b) the effectiveness of various subscales to discriminate among differences in symptom severity, and (c) the development of an abbreviated PANSS (Mini-PANSS) based on IRT and a method to link scores to the original PANSS. Methods Baseline PANSS scores from 7,187 patients with Schizophrenia or Schizoaffective disorder who were enrolled between 1995 and 2005 in psychopharmacology trials were obtained. Option characteristic curves (OCCs) and Item Characteristic Curves (ICCs) were constructed to examine the probability of rating each of seven options within each of 30 PANSS items as a function of subscale severity, and summed-score linking was applied to items selected for the Mini-PANSS. Results The majority of items forming the Positive and Negative subscales (i.e. 19 items) performed very well and discriminate better along symptom severity compared to the General Psychopathology subscale. Six of the seven Positive Symptom items, six of the seven Negative Symptom items, and seven out of the 16 General Psychopathology items were retained for inclusion in the Mini-PANSS. Summed score linking and linear interpolation was able to produce a translation table for comparing total subscale scores of the Mini-PANSS to total subscale scores on the original PANSS. Results show scores on the subscales of the Mini-PANSS can be linked to scores on the original PANSS subscales, with very little bias. Conclusions The study demonstrated the utility of non-parametric IRT in examining the item properties of the PANSS and to allow selection of items for an abbreviated PANSS scale. The comparisons between the 30-item PANSS and the Mini-PANSS revealed that the shorter version is comparable to the 30-item PANSS, but when applying IRT, the Mini-PANSS is also a good indicator of illness severity
Khan, Anzalee; Lewis, Charles; Lindenmayer, Jean-Pierre
2011-11-16
Nonparametric item response theory (IRT) was used to examine (a) the performance of the 30 Positive and Negative Syndrome Scale (PANSS) items and their options ((levels of severity), (b) the effectiveness of various subscales to discriminate among differences in symptom severity, and (c) the development of an abbreviated PANSS (Mini-PANSS) based on IRT and a method to link scores to the original PANSS. Baseline PANSS scores from 7,187 patients with Schizophrenia or Schizoaffective disorder who were enrolled between 1995 and 2005 in psychopharmacology trials were obtained. Option characteristic curves (OCCs) and Item Characteristic Curves (ICCs) were constructed to examine the probability of rating each of seven options within each of 30 PANSS items as a function of subscale severity, and summed-score linking was applied to items selected for the Mini-PANSS. The majority of items forming the Positive and Negative subscales (i.e. 19 items) performed very well and discriminate better along symptom severity compared to the General Psychopathology subscale. Six of the seven Positive Symptom items, six of the seven Negative Symptom items, and seven out of the 16 General Psychopathology items were retained for inclusion in the Mini-PANSS. Summed score linking and linear interpolation was able to produce a translation table for comparing total subscale scores of the Mini-PANSS to total subscale scores on the original PANSS. Results show scores on the subscales of the Mini-PANSS can be linked to scores on the original PANSS subscales, with very little bias. The study demonstrated the utility of non-parametric IRT in examining the item properties of the PANSS and to allow selection of items for an abbreviated PANSS scale. The comparisons between the 30-item PANSS and the Mini-PANSS revealed that the shorter version is comparable to the 30-item PANSS, but when applying IRT, the Mini-PANSS is also a good indicator of illness severity.
Energy Technology Data Exchange (ETDEWEB)
Woicik, P.A.; Stewart, S.H.; Pihl, R.O.; Conrod, P.J.
2009-12-01
The Substance Use Risk Profile Scale (SURPS) is based on a model of personality risk for substance abuse in which four personality dimensions (hopelessness, anxiety sensitivity, impulsivity, and sensation seeking) are hypothesized to differentially relate to specific patterns of substance use. The current series of studies is a preliminary exploration of the psychometric properties of the SURPS in two populations (undergraduate and high school students). In study 1, an analysis of the internal structure of two versions of the SURPS shows that the abbreviated version best reflects the 4-factor structure. Concurrent, discriminant, and incremental validity of the SURPS is supported by convergent/divergent relationships between the SURPS subscales and other theoretically relevant personality and drug use criterion measures. In Study 2, the factorial structure of the SURPS is confirmed and evidence is provided for its test-retest reliability and validity with respect to measuring personality vulnerability to reinforcement-specific substance use patterns. In Study 3, the SURPS was administered in a more youthful population to test its sensitivity in identifying younger problematic drinkers. The results from the current series of studies demonstrate support for the reliability and construct validity of the SURPS, and suggest that four personality dimensions may be linked to substance-related behavior through different reinforcement processes. This brief assessment tool may have important implications for clinicians and future research.
Troncoso, P; Ortiz, A M; Jara, A; Vilches, S
2009-01-01
Monitoring of cyclosporine (CsA) is critical during the induction of immunosuppressive therapy. Although most centers have incorporated C2 levels, our unit still uses an abbreviated AUC model which includes concentrations at C1, C2, and C6 post-dose (AUC(1-6)). The objective of this study was to compare both strategies of CsA monitoring during the first 30 days after kidney transplantation. The study included 89 recipients induced with CsA microemulsion and steroids. AUC(1-6) profiles were performed around days 3, 10, and 30 after transplantation with a target of 5500 to 6000 ng*h/mL considered therapeutic. For comparison purposes, a value of C2 >/= 1500 ng/mL was also considered therapeutic. Mean C2 and AUC(1-6) values were low dated with biopsy-proven acute rejection episodes (BPAR) during the study period. Twenty patients received living donor kidneys and overall there were 46 females. During this period, 253 AUC(1-6) were performed including 44 (17.4%) below the therapeutic range. When the analysis included only C2, 171 (67.6%) were below the therapeutic target (P AUC(1-6) at day 10 discriminated rejectors versus nonrejectors (5645 +/- 1390 and 8221 +/- 2502, respectively; P = .008). C2 was not significantly different at any time in either group. In this study, abbreviated AUC monitoring more adequately identified patients at risk for acute rejection than C2. Recommended C2 concentration levels need to be redefined in our patients.
Exploring the Poverty Reduction Potential of Social Marketing in Tourism Development
Directory of Open Access Journals (Sweden)
Dao V. Truong
2015-12-01
Full Text Available Although social marketing has been demonstrated to be an effective tool of behavior change in a variety of contexts, its poverty reduction potential in tourism development has captured limited research attention. This paper explores the potential contribution of social marketing to tourism-related poverty alleviation in Sapa, Vietnam. It does so by creating an understanding of how local residents perceive poverty, then exploring whether social marketing could be a potential solution in the case of Sapa. Through participant observations and semi-structured interviews, this study reveals that local people perceive poverty as a lack of rice and/or income and ascribe it to both internal and external factors. Local women often follow tourists to sell handicrafts, causing discomfort for tourists and driving them away from certain destinations. Insufficient capital and farming land are also identified as a critical barrier to poverty reduction. This study argues that by understanding the poor people’s perspectives on poverty, we can identify meaningful approaches to poverty alleviation. Thereby, social marketing can be one of the tools to bring the marginalized voice of poor people to the attention of decision-makers.
Wild, Marcus G; Ostini, Remo; Harrington, Magdalena; Cavanaugh, Kerri L; Wallston, Kenneth A
2018-05-21
Self-efficacy, or perceived competence, has been identified as an important factor in self-management behaviors and health outcomes in patients with chronic disease. Measures of self-management self-efficacy are currently available for multiple forms of chronic disease. One established measure is the 8-item Perceived Medical Condition Self-Management Scale (PMCSMS). This study investigated the use of the PMCSMS in samples of patients with a chronic disease to develop an abbreviated version of the scale that could be more readily used in clinical contexts or in large population health cohort studies. The PMCSMS was administered as either a generic scale or as a disease-specific scale. The results of analyses using item response theory and classical test theory methods indicated that using 4 items of the scale resulted in similar internal consistency (α = .70-0.90) and temporal stability (test-retest r = .75 after 2 to 4 weeks) to the 8-item PMCSMS (r = .81 after 2 to 4 weeks). The 4 items selected had the greatest discriminability among participants (α parameters = 2.49-3.47). Scores from both versions also demonstrated similar correlations with related constructs such as health literacy (r = .13-0.29 vs. 0.14-0.27), self-rated health (r = .17-0.48 vs. 0.26-0.50), social support (r = .21-0.32 vs. 0.25-0.34), and medication adherence (r = .20-0.24 vs. 0.20-0.25). The results of this study indicate that 4-item PMCSMS scores are equally valid but more efficient, and have the potential to be beneficial for both research and clinical applications. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Self-Esteem and Attitudes toward Love in Abused and Non-Abused Women.
Chambliss, Catherine; And Others
This study sought to identify personality differences in abused versus non-abused women. Abused women (N=25) were from several centers for abused women and non-abused women (N=39) were students in evening psychology classes. All subjects completed Rubin's Love Scale, the abbreviated Dominance and Romanticism Scale, Rosenberg's Self-Esteem Scale,…
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB595 (Link to dictyBase) - - - Contig-U09552-1 VFB595E (Link...) Clone ID VFB595 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Ori...KLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEENKTL EDIIKVVDDFCKILPAAYKTDCVA...A: VEGSGECLVCEFISEKIVTYLEANQTETQILQYLDNDCKLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT... Sequences producing significant alignments: (bits) Value N U66367 |U66367.1 Dictyostelium discoideum SapA (
Contrasting Patterns of rDNA Homogenization within the Zygosaccharomyces rouxii Species Complex
Chand Dakal, Tikam; Giudici, Paolo; Solieri, Lisa
2016-01-01
Arrays of repetitive ribosomal DNA (rDNA) sequences are generally expected to evolve as a coherent family, where repeats within such a family are more similar to each other than to orthologs in related species. The continuous homogenization of repeats within individual genomes is a recombination process termed concerted evolution. Here, we investigated the extent and the direction of concerted evolution in 43 yeast strains of the Zygosaccharomyces rouxii species complex (Z. rouxii, Z. sapae, Z. mellis), by analyzing two portions of the 35S rDNA cistron, namely the D1/D2 domains at the 5’ end of the 26S rRNA gene and the segment including the internal transcribed spacers (ITS) 1 and 2 (ITS regions). We demonstrate that intra-genomic rDNA sequence variation is unusually frequent in this clade and that rDNA arrays in single genomes consist of an intermixing of Z. rouxii, Z. sapae and Z. mellis-like sequences, putatively evolved by reticulate evolutionary events that involved repeated hybridization between lineages. The levels and distribution of sequence polymorphisms vary across rDNA repeats in different individuals, reflecting four patterns of rDNA evolution: I) rDNA repeats that are homogeneous within a genome but are chimeras derived from two parental lineages via recombination: Z. rouxii in the ITS region and Z. sapae in the D1/D2 region; II) intra-genomic rDNA repeats that retain polymorphisms only in ITS regions; III) rDNA repeats that vary only in their D1/D2 domains; IV) heterogeneous rDNA arrays that have both polymorphic ITS and D1/D2 regions. We argue that an ongoing process of homogenization following allodiplodization or incomplete lineage sorting gave rise to divergent evolutionary trajectories in different strains, depending upon temporal, structural and functional constraints. We discuss the consequences of these findings for Zygosaccharomyces species delineation and, more in general, for yeast barcoding. PMID:27501051
Park, Seon-Cheol; Jang, Eun Young; Kim, Daeho; Jun, Tae-Youn; Lee, Min-Soo; Kim, Jae-Min; Kim, Jung-Bum; Jo, Sun-Jin; Park, Yong Chon
2015-01-01
Although major depressive disorder (MDD) has a variety of symptoms beyond the affective dimensions, the factor structure and contents of comprehensive psychiatric symptoms of this disorder have rarely been explored using the 18-item Brief Psychiatric Rating Scale (BPRS). We aimed to identify the factor structure of the 18-item BPRS in Korean MDD patients. A total of 258 MDD patients were recruited from a multicenter sample of the Clinical Research Center for Depression of South Korea study. Psychometric scales were used to assess overall psychiatric symptoms (BPRS), depression (Hamilton Depression Rating Scale), anxiety (Hamilton Anxiety Rating Scale), global severity (Clinical Global Impression of Severity Scale), suicidal ideation (Scale for Suicide Ideation), functioning (Social and Occupational Functioning Assessment Scale), and quality of life (World Health Organization Quality of Life Assessment-abbreviated version). Common factor analysis with oblique rotation was used to yield factor structure. A four-factor structure was designed and interpreted by the symptom dimensions to reflect mood disturbance, positive symptoms/apathy, bipolarity, and thought distortion/mannerism. These individual factors were also significantly correlated with clinical variables. The findings of this study support the view that the BPRS may be a promising measuring tool for the initial assessment of MDD patients. In addition, the four-factor structure of the BPRS may be useful in understanding the mood and psychotic characteristics of these patients. Copyright © 2014. Published by Elsevier Taiwan.
Directory of Open Access Journals (Sweden)
Seon-Cheol Park
2015-01-01
Full Text Available Although major depressive disorder (MDD has a variety of symptoms beyond the affective dimensions, the factor structure and contents of comprehensive psychiatric symptoms of this disorder have rarely been explored using the 18-item Brief Psychiatric Rating Scale (BPRS. We aimed to identify the factor structure of the 18-item BPRS in Korean MDD patients. A total of 258 MDD patients were recruited from a multicenter sample of the Clinical Research Center for Depression of South Korea study. Psychometric scales were used to assess overall psychiatric symptoms (BPRS, depression (Hamilton Depression Rating Scale, anxiety (Hamilton Anxiety Rating Scale, global severity (Clinical Global Impression of Severity Scale, suicidal ideation (Scale for Suicide Ideation, functioning (Social and Occupational Functioning Assessment Scale, and quality of life (World Health Organization Quality of Life Assessment-abbreviated version. Common factor analysis with oblique rotation was used to yield factor structure. A four-factor structure was designed and interpreted by the symptom dimensions to reflect mood disturbance, positive symptoms/apathy, bipolarity, and thought distortion/mannerism. These individual factors were also significantly correlated with clinical variables. The findings of this study support the view that the BPRS may be a promising measuring tool for the initial assessment of MDD patients. In addition, the four-factor structure of the BPRS may be useful in understanding the mood and psychotic characteristics of these patients.
Maddock, Simon T; Wilkinson, Mark; Nussbaum, Ronald A; Gower, David J
2017-10-06
A new species of indotyphlid caecilian amphibian, Hypogeophis pti sp. nov., is described based on a series of specimens from the Seychelles island of Praslin. The type series was collected in 2013 and 2014, and a referred specimen previously identified as H. brevis Boulenger, 1911 was collected from an unspecified Seychelles locality in 1957. The new species most closely resembles the Seychelles endemic Hypogeophis brevis in being short (maximum known total length in life ca. 120 mm) and long snouted, but differs by having a less anteriorly positioned tentacular aperture and fewer primary annuli and vertebrae. In having only 67-69 vertebrae, H. pti sp. nov. is the most abbreviated extant species of caecilian reported to date.
International Nuclear Information System (INIS)
Cook, J.R.
1981-07-01
This abbreviated data report presents results of ground water and stream/surface sediment reconnaissance in the National Topographic Map Series (NTMS) Santa Cruz 1 0 x 2 0 quadrangle. Surface sediment samples were collected at 1270 sites, at a target sampling density of one site per 13 square kilometers (five square miles). Ground water samples were collected at 636 sites. Neutron activation analysis (NAA) results are given for uranium and 16 other elements in sediments, and for uranium and 9 other elements in ground water. Mass spectrometry results are given for helium in ground water. Field measurements and observations are reported for each site. Analytical data and field measurements are presented in tables and maps. Uranium concentrations in the sediments which were above detection limits ranged from 0.10 t 51.2 ppM. The mean of the logarithms of the uranium concentrations was 0.53. A group of high uranium concentrations occurs near the junctions of quadrangles AB, AC, and BB
Duijvenbode, N. van; Didden, H.C.M.; Hazel, T. van den; Engels, R.C.M.E.
2016-01-01
Objective: To investigate the reliability and validity of a Wechsler Abbreviated Scale of Intelligence-based Wechsler Adult Intelligence Scale - third edition (WAIS-III) short form (SF) in a sample of individuals with mild to borderline intellectual disability (MBID) (N=117; M-IQ=71.34; SDIQ=8.00,
Assessing motivation orientations in schizophrenia: Scale development and validation.
Cooper, Shanna; Lavaysse, Lindsey M; Gard, David E
2015-01-30
Motivation deficits are common in several disorders including schizophrenia, and are an important factor in both functioning and treatment adherence. Self-Determination Theory (SDT), a leading macro-theory of motivation, has contributed a number of insights into how motivation is impaired in schizophrenia. Nonetheless, self-report measures of motivation appropriate for people with severe mental illness (including those that emphasize SDT) are generally lacking in the literature. To fill this gap, we adapted and abbreviated the well-validated General Causality Orientation Scale for use with people with schizophrenia and with other severe mental disorders (GCOS-clinical populations; GCOS-CP). In Study 1, we tested the similarity of our measure to the existing GCOS (using a college sample) and then validated this new measure in a schizophrenia and healthy control sample (Study 2). Results from Study 1 (N=360) indicated that the GCOS-CP was psychometrically similar to the original GCOS and provided good convergent and discriminant validity. In Study 2, the GCOS-CP was given to individuals with (N=44) and without schizophrenia (N=42). In line with both laboratory-based and observer-based research, people with schizophrenia showed lower motivational autonomy and higher impersonal/amotivated orientations. Additional applications of the GCOS-CP are discussed. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Sub-Saharan Africa Report, No. 2826
1983-07-27
Begins Housing Sales to Blacks (Johannesburg Domestic Service, 1 Jul 83) 79 Roles of Black Farmers, U.S. Firms Discussed (SAPA, 7 Jul 83...advanced technology and superpowers. Yet how many in Africa will share his sentiment if only because it is a necessary subject about which to talk and...some of the shocks, and prevent a dangerous internationalisation . Col. Mengistu, the new OAU Chairman, who has entered the fray to criticise Zaire’s
Hurks, Petra; Hendriksen, Jos; Dek, Joelle; Kooij, Andress
2016-04-01
This article investigated the accuracy of six short forms of the Dutch Wechsler Preschool and Primary Scale of Intelligence-Third edition (WPPSI-III-NL) in estimating intelligent quotient (IQ) scores in healthy children aged 4 to 7 years (N = 1,037). Overall, accuracy for each short form was studied, comparing IQ equivalences based on the short forms with the original WPPSI-III-NL Full Scale IQ (FSIQ) scores. Next, our sample was divided into three groups: children performing below average, average, or above average, based on the WPPSI-III-NL FSIQ estimates of the original long form, to study the accuracy of WPPSI-III-NL short forms at the tails of the FSIQ distribution. While studying the entire sample, all IQ estimates of the WPPSI-III-NL short forms correlated highly with the FSIQ estimates of the original long form (all rs ≥ .83). Correlations decreased significantly while studying only the tails of the IQ distribution (rs varied between .55 and .83). Furthermore, IQ estimates of the short forms deviated significantly from the FSIQ score of the original long form, when the IQ estimates were based on short forms containing only two subtests. In contrast, unlike the short forms that contained two to four subtests, the Wechsler Abbreviated Scale of Intelligence short form (containing the subtests Vocabulary, Similarities, Block Design, and Matrix Reasoning) and the General Ability Index short form (containing the subtests Vocabulary, Similarities, Comprehension, Block Design, Matrix Reasoning, and Picture Concepts) produced less variations when compared with the original FSIQ score. © The Author(s) 2015.
Psychometric properties of the Brunel Mood Scale in Chinese adolescents and adults.
Zhang, Chun-Qing; Si, Gangyan; Chung, Pak-Kwong; Du, Mengmeng; Terry, Peter C
2014-01-01
Building on the work of Terry and colleagues (Terry, P. C., Lane, A. M., Lane, H. J., & Keohane, L. (1999). Development and validation of a mood measure for adolescents. Journal of Sports Sciences, 17, 861-872; Terry, P. C., Lane, A. M., & Fogarty, G. J. (2003). Construct validity of the Profile of Mood States-Adolescents for use with adults. Psychology of Sport & Exercise, 4, 125-139.), the present study examined the validity and internal consistency reliability of the Chinese version of the Brunel Mood Scale (BRUMS-C) among 2,548 participants, comprising adolescent athletes (n = 520), adult athletes (n = 434), adolescent students (n = 673), and adult students (n = 921). Both adolescent and adult athletes completed the BRUMS-C before, during, or after regular training and both adolescent and adult students completed the BRUMS-C in a classroom setting. Confirmatory factor analyses (CFAs) provided support for the factorial validity of a 23-item six-factor model, with one item removed from the hypothesised measurement model. Internal consistency reliabilities were satisfactory for all subscales across each of the four samples. Criterion validity was supported with strong relationships between the BRUMS-C, abbreviated POMS, and Chinese Affect Scale consistent with theoretical predictions. Multi-sample CFAs showed the BRUMS-C to be invariant at the configural, metric, strong, and structural levels for all samples. Furthermore, latent mean difference analyses showed that athletes reported significantly higher levels of fatigue than students while maintaining almost the same levels of vigour, and adolescent students reported significantly higher levels of depressed mood than the other three samples.
International Nuclear Information System (INIS)
Fay, W.M.
1981-07-01
This abbreviated data report presents results of ground water, surface water, and stream sediment reconnaissance in the National Topographic Map Series (NTMS) Baltimore 1 0 x 2 0 NTMS quadrangle. Surface sediment samples were collected at 993 sites. Ground water samples were collected at 777 sites. Neutron activation analysis (NAA) results are given for uranium and 16 other elements in sediments, for uranium and 8 other elements in ground water, and for uranium and 9 other elements in surface water. Field measurements and observations are reported for each site. Analytical data and field measurements are presented. Data from ground water sites include: (1) water chemistry measurements (pH, conductivity, and alkalinity), (2) physical measurements, where applicable (water temperature, well description, etc.), and (3) elemental analyses (U, Al, Br, Cl, Dy, F, Mn, Na, and V). Data from sediment sites include: (1) stream water chemistry measurements (pH, conductivity and alkalinity), and (2) elemental analyses for sediment samples (U, Th, Hf, Al, Ce, Dy, Eu, Fe, La, Lu, Mn, Sc, Sm, Na, Ti, V, and Yb). Sample site descriptors (stream characteristics, vegetation, etc.) are also tabulated. Areal distribution maps, histograms, and cumulative frequency plots for most elements and for U/Th and U/Hf ratios are included on the microfiche. Key data from stream water sites include: (1) water quality measurements (pH, conductivity and alkalinity) and (2) elemental analyses (U, Al, Br, Cl, Dy, F, Mg, Mn, Na, and V). Uranium concentrations in the sediments that were above detection limits ranged from up to 38.7 ppM. The samples with high uranium values also have high thorium values, suggesting that most of the uranium is held within resistate minerals. The north-northeast trend of the geologic units is clearly reflected in the data
Airaksinen, N; Nurmi-Lüthje, I; Lüthje, P
2016-03-01
The coverage of the official statistics is poor in motorcycle and moped accidents. The aim of this study was to analyze the severity of motorcycle and moped crashes, and to define the degree of under-reporting in official statistics. All first attendances due to an acute motorcyclist or moped driver injury registered in the emergency department between June 2004 and May 2006 were analyzed. The severity of the injuries was classified using the Abbreviated Injury Scale score and the New Injury Severity Score. The hospital injury data were compared to the traffic accident statistics reported by the police and compiled and maintained by Statistics Finland. A total of 49 motorcyclists and 61 moped drivers were involved in crashes, leading to a total of 94 and 109 injuries, respectively. There were slightly more vertebral and midfoot fractures among motorcyclists than among moped drivers (p = 0.038 and 0.016, respectively). No significant differences were found between the severity (maximum Abbreviated Injury Scale and median New Injury Severity Scores) of the motorcycle and moped crashes. There was no in-hospital mortality. The degree of agreement (overlap) between the hospital dataset and the official statistics was 32%. The rate of under-reporting was 68%. According to the maximum Abbreviated Injury Scale and New Injury Severity Scores, the injury severity was equal for motorcycle and moped crashes. The degree of agreement between the hospital dataset and the official statistics was 32%. © The Finnish Surgical Society 2015.
Greening of taxes and energy. Effects of increased energy levies and specific exemptions
International Nuclear Information System (INIS)
1997-06-01
The study on the title subject is part of a new long-term outlook for the period 1990-2020, focusing on the environment, mobility, space (physical planning) and energy. The environmental, employment and economic impacts of two levy variants have been analyzed. The first is the so-called Regulating Energy Levy (REB, abbreviated in Dutch), and the second is the Environment-Based Tax Law (WBM, abbreviated in Dutch). Tax rebates to households and businesses are in the form of a lower income tax and lower employer contributions. It is concluded that it is possible to double existing energy levies or to triple them for small-scale consumers without large economic impacts, provided that (1) large-scale consumers are spared; (2) the levies are rebated totally or partly; and (3) levy and rebate will be accepted by the Dutch society
Irwanto; Rehatta, Nancy Margarita; Hartini, Sri; Takada, Satoshi
2016-07-04
Sleep problems are associated with problems of cognitive functioning, learning, attention and school performance. It has been found that sleep problems are highly prevalent in children with Autistic spectrum disorders (ASD), with rates ranging from 40% to 80%. We aimed to identify the prevalence of sleep problems on children with ASD in Indonesia and Japan. A cross-sectional study was conducted in Surabaya, Indonesia and Kobe, Japan. Children aged 4 -10 years old were enrolled using stratified cluster sampling. Children's Sleep Habits Questionnaire-Abbreviated (CSHQ-A) was used in this research to assess the sleep problems, consisted of 22 questions (NICHD SECCYD-Wisconsin). Data were analyzed with Mann-Whitney U test to compare the CSHQ-A scores between Indonesian and Japanese children, while the proportion of sleep problems was evaluated by chi-square test with 95% confidence interval. Fifty children with ASD were included in this study, 25 children from Kobe, Japan and 25 children from Surabaya, Indonesia. The prevalence of sleep problems on children with ASD was 60% (15 children) in Indonesia and 16% (4 children) in Japan respectively. There were significant differences in total waking during the night and in morning wake for the CSHQ-A between children from Indonesia and Japan (psleep problems on children with ASD was higher in children from Indonesia than from Japan.
Solving large scale unit dilemma in electricity system by applying commutative law
Legino, Supriadi; Arianto, Rakhmat
2018-03-01
The conventional system, pooling resources with large centralized power plant interconnected as a network. provides a lot of advantages compare to the isolated one include optimizing efficiency and reliability. However, such a large plant need a huge capital. In addition, more problems emerged to hinder the construction of big power plant as well as its associated transmission lines. By applying commutative law of math, ab = ba, for all a,b €-R, the problem associated with conventional system as depicted above, can be reduced. The idea of having small unit but many power plants, namely “Listrik Kerakyatan,” abbreviated as LK provides both social and environmental benefit that could be capitalized by using proper assumption. This study compares the cost and benefit of LK to those of conventional system, using simulation method to prove that LK offers alternative solution to answer many problems associated with the large system. Commutative Law of Algebra can be used as a simple mathematical model to analyze whether the LK system as an eco-friendly distributed generation can be applied to solve various problems associated with a large scale conventional system. The result of simulation shows that LK provides more value if its plants operate in less than 11 hours as peaker power plant or load follower power plant to improve load curve balance of the power system. The result of simulation indicates that the investment cost of LK plant should be optimized in order to minimize the plant investment cost. This study indicates that the benefit of economies of scale principle does not always apply to every condition, particularly if the portion of intangible cost and benefit is relatively high.
Selective Neurocognitive Impairments in Adolescents with Major Depressive Disorder
Han, Georges; Klimes-Dougan, Bonnie; Jepsen, Susie; Ballard, Kristin; Nelson, Megan; Houri, Alaa; Kumra, Sanjiv; Cullen, Kathryn
2012-01-01
This study investigated whether major depression in adolescence is characterized by neurocognitive deficits in attention, affective decision making, and cognitive control of emotion processing. Neuropsychological tests including the Wechsler Abbreviated Scale of Intelligence, the Continuous Performance Test-Identical Pairs, the Attention Network…
Standardized evaluation of accident victims: demands on diagnostic trauma
International Nuclear Information System (INIS)
Kanz, K.G.; Mutschler, W.; Linsenmaier, U.; Pfeifer, K.J.
2002-01-01
Introduction. Evaluation of trauma systems requires a complete and exact injury classification. The purpose of this study was the introduction of the Abbreviated injury scale (AIS) for radiological trauma scoring. The development of these easy to use coding tools is essential for prompt quality management of trauma.Material and methods. Standardized radiological injury description using a modified Abbreviated injury scale in combination with a Microsoft Excel trademark spreadsheet allows an immediate calculation of the probability of survival according to TRISS methodology.Results. Computed tomography is the main instrument for injury scoring in trauma care. Postmortem scanning provides a direct feedback for trauma teams especially in cases when autopsy is not possible.Conclusion. Computed tomography enables in combination with a standardized injury description exact trauma scoring. Quality management of trauma care depends on a valid and reliable calculation of the probability of survival using TRISS. (orig.) [de
International Nuclear Information System (INIS)
Cook, J.R.
1981-06-01
This abbreviated data report presents results of ground water and stream sediment reconnaissance in the National Topographic Map Series (NTMS) Norfolk 1 0 x 2 0 quadrangle and the southern one-half of the Eastville 1 0 x 2 0 quadrangle. Surface sediment samples were collected at 840 sites. Ground water samples were collected at 1008 sites. Neutron activation analysis (NAA) results are given for uranium and 16 other elements in sediments, and for uranium and 8 other elements in ground water. Field measurements and observations are reported for each site. Analytical data and field measurements are presented in tables and maps. Data from ground water sites include: (1) water chemistry measurements (pH, conductivity, and alkalinity); (2) physical measurements, where applicable (water temperature, well description, etc.); and (3) elemental analyses (U, Al, Br, Cl, Dy, F, Mn, Na, and V). Data from sediment sites include: (1) stream water chemistry measurements (pH, conductivity, and alkalinity); and (2) elemental analyses for sediment samples (U, Th, Hf, Al, Ce, Dy, Eu, Fe, La, Lu, Mn, Sc, Sm, Na, Ti, V, and Yb). Sample site descriptors (stream characteristics, vegetation, etc.) are also tabulated. Areal distribution maps, histograms, and cumulative frequency plots for most elements and for U/Th and U/Hf ratios are included. Uranium concentrations in the sediments that were above detection limits ranged from 0.60 to 40.2 ppM. The mean of the logarithms of the uranium concentrations was 0.61. A large area of high uranium concentrations occurs in the southwestern part of the Norfolk quadrangle. High concentrations of thorium and hafnium in the same area indicate that the uranium is associated with the resistate minerals monazite and zircon
Abbreviated psychologic questionnaires are valid in patients with hand conditions
Bot, Arjan G. J.; Becker, Stéphanie J. E.; van Dijk, C. Niek; Ring, David; Vranceanu, Ana-Maria
2013-01-01
The Pain Catastrophizing Scale (PCS) and Short Health Anxiety Inventory (SHAI) can help hand surgeons identify opportunities for psychologic support, but they are time consuming. If easier-to-use tools were available and valid, they might be widely adopted. We tested the validity of shorter versions
Directory of Open Access Journals (Sweden)
Mohammad Massumi
Full Text Available The ability to yield glucose-responsive pancreatic beta-cells from human pluripotent stem cells in vitro will facilitate the development of the cell replacement therapies for the treatment of Type 1 Diabetes. Here, through the sequential in vitro targeting of selected signaling pathways, we have developed an abbreviated five-stage protocol (25-30 days to generate human Embryonic Stem Cell-Derived Beta-like Cells (ES-DBCs. We showed that Geltrex, as an extracellular matrix, could support the generation of ES-DBCs more efficiently than that of the previously described culture systems. The activation of FGF and Retinoic Acid along with the inhibition of BMP, SHH and TGF-beta led to the generation of 75% NKX6.1+/NGN3+ Endocrine Progenitors. The inhibition of Notch and tyrosine kinase receptor AXL, and the treatment with Exendin-4 and T3 in the final stage resulted in 35% mono-hormonal insulin positive cells, 1% insulin and glucagon positive cells and 30% insulin and NKX6.1 co-expressing cells. Functionally, ES-DBCs were responsive to high glucose in static incubation and perifusion studies, and could secrete insulin in response to successive glucose stimulations. Mitochondrial metabolic flux analyses using Seahorse demonstrated that the ES-DBCs could efficiently metabolize glucose and generate intracellular signals to trigger insulin secretion. In conclusion, targeting selected signaling pathways for 25-30 days was sufficient to generate ES-DBCs in vitro. The ability of ES-DBCs to secrete insulin in response to glucose renders them a promising model for the in vitro screening of drugs, small molecules or genes that may have potential to influence beta-cell function.
Source-Message-Receiver in Integrated Marketing Communication
Broussard, Sharee LeBlanc
2011-01-01
This is an abbreviation of the author's dissertation. Because integrated marketing communication (IMC) research has traditionally been problematic, this study used an existing scale to determine that higher educational institutional advancement (alumni, marketing-communications, development) is an appropriate venue to study the process model of…
Gaete, Jorge; Montero-Marin, Jesus; Rojas-Barahona, Cristian A.; Olivares, Esterbina; Araya, Ricardo
2016-01-01
School membership appears to be an important factor in explaining the relationship between students and schools, including school staff. School membership is associated with several school-related outcomes, such as academic performance and expectations. Most studies on school membership have been conducted in developed countries. The Psychological Sense of School Membership (PSSM) scale (18 items: 13 positively worded items, 5 negatively worded items) has been widely used to measure this construct, but no studies regarding its validity and reliability have been conducted in Spanish-speaking Latin American countries. This study investigates the psychometric properties, factor structure and reliability of this scale in a sample of 1250 early adolescents in Chile. Both exploratory and confirmatory factor analyses provide evidence of an excellent fit for a one-factor solution after removing the negatively worded items. The internal consistency of this new abbreviated version was 0.92. The association analyses demonstrated that high school membership was associated with better academic performance, stronger school bonding, a reduced likelihood of school misbehavior, and reduced likelihood of substance use. Analyses showed support for the reliability and validity of the PSSM among Chilean adolescents. PMID:27999554
Directory of Open Access Journals (Sweden)
Jorge Gaete
2016-12-01
Full Text Available School membership appears to be an important factor in explaining the relationship between students and schools, including school staff. School membership is associated with several school-related outcomes, such as academic performance and expectations. Most studies on school membership have been conducted in developed countries. The Psychological Sense of School Membership (PSSM scale (18 items: 13 positively worded items, 5 negatively worded items has been widely used to measure this construct, but no studies regarding its validity and reliability have been conducted in Spanish-speaking Latin American countries. This study investigates the psychometric properties, factor structure and reliability of this scale in a sample of 1250 early adolescents in Chile. Both exploratory and confirmatory factor analyses provide evidence of an excellent fit for a one-factor solution after removing the negatively worded items. The internal consistency of this new abbreviated version was 0.92. The association analyses demonstrated that high school membership was associated with better academic performance, stronger school bonding, a reduced likelihood of school misbehavior and reduced likelihood of substance use. Analyses showed support for the reliability and validity of the PSSM among Chilean adolescents.
He Sapa Bloketu Waecun: 2008 Summer Science and Cultural Camps
Kliche, D. V.; Sanovia, J.; Decker, R.; Bolman, J.
2008-12-01
The South Dakota School of Mines, Humboldt State University and Sinte Gleska University with support from the National Science Foundation, sponsored four camps for South Dakota Lakota youth to nurture a geosciences learning community linked to culturally significant sites in the Black Hills. These camps utilized outdoor, experiential learning to integrate indigenous knowledge with contemporary western science. The project resulted in increased awareness among Native and non-Native Americans, young and adult, about the importance of geosciences in their connection and interpretation of nature. The project also motivated participants in learning and becoming active in land and resources protection and the importance of becoming knowledgeable and active in regulatory policies (both Tribal and State). The four camps were scheduled during the month of June, 2008, which is the month of the summer solstice, a sacred time for the Lakota people which signal the Lakota Sundance Ceremony. The timing of the camps was chosen to give the Native American participants the framework to express their connection to Native lands through the understanding of their oral history. For the first time in such camps, middle and high school students were encouraged to have a parent or relative attending with them. The camps proved to be a great success among students and their families. The curriculum and activities helped participants immerse themselves mentally, physically and spiritually into an experience of a life time. We plan to show our results from these camps and emphasize the usefulness of this new approach in teaching science and encouraging the new generation to pursue careers in geosciences.
Multi-institutional MicroCT image comparison of image-guided small animal irradiators
Johnstone, Chris D.; Lindsay, Patricia; E Graves, Edward; Wong, Eugene; Perez, Jessica R.; Poirier, Yannick; Ben-Bouchta, Youssef; Kanesalingam, Thilakshan; Chen, Haijian; E Rubinstein, Ashley; Sheng, Ke; Bazalova-Carter, Magdalena
2017-07-01
To recommend imaging protocols and establish tolerance levels for microCT image quality assurance (QA) performed on conformal image-guided small animal irradiators. A fully automated QA software SAPA (small animal phantom analyzer) for image analysis of the commercial Shelley micro-CT MCTP 610 phantom was developed, in which quantitative analyses of CT number linearity, signal-to-noise ratio (SNR), uniformity and noise, geometric accuracy, spatial resolution by means of modulation transfer function (MTF), and CT contrast were performed. Phantom microCT scans from eleven institutions acquired with four image-guided small animal irradiator units (including the commercial PXi X-RAD SmART and Xstrahl SARRP systems) with varying parameters used for routine small animal imaging were analyzed. Multi-institutional data sets were compared using SAPA, based on which tolerance levels for each QA test were established and imaging protocols for QA were recommended. By analyzing microCT data from 11 institutions, we established image QA tolerance levels for all image quality tests. CT number linearity set to R 2 > 0.990 was acceptable in microCT data acquired at all but three institutions. Acceptable SNR > 36 and noise levels 1.5 lp mm-1 for MTF = 0.2) was obtained at all but four institutions due to their large image voxel size used (>0.275 mm). Ten of the eleven institutions passed the set QA tolerance for geometric accuracy (2000 HU for 30 mgI ml-1). We recommend performing imaging QA with 70 kVp, 1.5 mA, 120 s imaging time, 0.20 mm voxel size, and a frame rate of 5 fps for the PXi X-RAD SmART. For the Xstrahl SARRP, we recommend using 60 kVp, 1.0 mA, 240 s imaging time, 0.20 mm voxel size, and 6 fps. These imaging protocols should result in high quality images that pass the set tolerance levels on all systems. Average SAPA computation time for complete QA analysis for a 0.20 mm voxel, 400 slice Shelley phantom microCT data set
Leeth, Elizabeth M.
1995-01-01
There is an identified need for spirituality to be taught in mental health therapy programs. Spirituality is about the connectedness we feel and the relationships we establish with self, others, and the universe. This study examined the relationship of spiritual well being, loneliness, and relationship satisfaction to life contentment. Each of the eighty-one respondents enrolled at VPI completed the "Spiritual Well being Scale" and "Abbreviated Loneliness Scale" (Paloutzian & E...
International Nuclear Information System (INIS)
De Groot, H.H.
2001-01-01
A vision is presented of the MKB-Nederland (Dutch association for small and medium-sized enterprises or MKB, abbreviated in Dutch) on the consequences of the liberalization of the electricity sector in the Netherlands for the MKB and other small-scale users of energy. Attention is paid to the so-called reversed California effect: small-scale energy consumers will pay the price for the privatization of the E-sector [nl
2015-10-01
art research aims to test ways to modulate the functions of the emotion circuit implicated in PTSD. We utilize the recent advances in real-time...Toronto Alexithymia Scale, ECS=Emotional Contagion Scale, BIS/BAS=Behavioral Inhibition System/Behavior Avoidance System, WASI= Wechsler Abbreviated...fMRI percent signal change maps were spatially smoothed using a Gaussian kernel with full width at half maximum (FWHM) of 5 mm. One-sample t- tests
Zimmerman, Whitney Alicia; Johnson, Glenn
2017-01-01
Data were collected from 353 online undergraduate introductory statistics students at the beginning of a semester using the Goals and Outcomes Associated with Learning Statistics (GOALS) instrument and an abbreviated form of the Statistics Anxiety Rating Scale (STARS). Data included a survey of expected grade, expected time commitment, and the…
Aspects of the reproductive biology of Sarpa sa/pa (Pisces: Sparidae ...
African Journals Online (AJOL)
fork length, while the adult sex ratio in the shore-based catch was 1 :1.6 in favour of males. Frequency distribu- ... 1978; Lasiak 1983; Whitfield 1989; Whitfield & Kok 1992). In order to obtain a full .... cated at Sea World, Durban. The fish were ...
Searching for Organisational Identity : - a case study at Sapa Heat Transfer
Eklind, Martin; Hallgren, Linda
2009-01-01
Organisational Identity (i.e. OI) could be described as an employee theory of who the organisation is. The concept is seen as one of the most problematic concepts to define. One of the main reasons for that is its close relation to the concepts of culture and image, as they are seen as defining each other. As expressed in previous research there is a need for theoretical clarification and investigations in practice in this area. We aim to contribute to an OI concept clarification and theoreti...
International Nuclear Information System (INIS)
Steel, K.F.; Cook, J.R.
1981-07-01
This abbreviated data report presents results of ground water and stream sediment reconnaissance in the National Topographic Map Series Little Rock 1 0 x 2 0 quadrangle (Cleveland, Dallas, and Howard Counties do not have stream sediment analyses); the El Dorado 1 0 x 2 0 quadrangle (only Clark County has stream sediment analyses); the western part (Lonoke and Jefferson Counties) of Helena 1 0 x 2 0 quadrangle; the southern part (Franklin, Logan, Yell, Perry, Faulkner, and Lonoke Counties) of Russellville 1 0 x 2 0 quadrangle; and the southwestern corner (Ashley County) of the Greenwood 1 0 x 2 0 quadrangle. Stream samples were collected at 943 sites in the Little Rock quadrangle, 806 sites in the El Dorado quadrangle, 121 sites in the Helena area, 292 sites in the Russellville area, and 77 in the Greenwood area. Ground water samples were collected at 1211 sites in the Little Rock quadrangle, 1369 sites in the El Dorado quadrangle, 186 sites in the Helena area, 470 sites in the Russellville area, and 138 sites in the Greenwood area. Stream sediment and stream water samples were collected from small streams at nominal density of one site per 21 square kilometers in rural areas. Ground water samples were collected at a nominal density of one site per 13 square kilometers. Neutron activation analysis results are given for uranium and 16 other elements in sediments, and for uranium and 8 other elements in ground water. Field measurements and observations are reported for each site. Uranium concentrations in the sediments ranged from less than 0.1 ppM to 23.5 ppM with a mean of 1.7 ppM. The ground water uranium mean concentration is 0.113 ppB, and the uranium concentrations range from less than 0.002 ppB to 15.875 ppB. High ground water uranium values in the Ouachita Mountain region of the Little Rock quadrangle appear to be associated with Ordovician black shale units
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp
Directory of Open Access Journals (Sweden)
Narges Dialami
2017-11-01
Full Text Available This work adopts a fast and accurate two-stage computational strategy for the analysis of FSW (Friction stir welding processes using threaded cylindrical pin tools. The coupled thermo-mechanical problem is equipped with an enhanced friction model to include the effect of non-uniform pressure distribution under the pin shoulder. The overall numerical strategy is successfully validated by the experimental measurements provided by the industrial partner (Sapa. The verification of the numerical model using the experimental evidence is not only accomplished in terms of temperature evolution but also in terms of torque, longitudinal, transversal and vertical forces.
Lateral automobile impacts and the risk of traumatic brain injury.
Bazarian, Jeffrey J; Fisher, Susan Gross; Flesher, William; Lillis, Robert; Knox, Kerry L; Pearson, Thomas A
2004-08-01
We determine the relative risk and severity of traumatic brain injury among occupants of lateral impacts compared with occupants of nonlateral impacts. This was a secondary analysis of the National Highway Traffic Safety Administration's National Automotive Sampling System, Crashworthiness Data Systems for 2000. Analysis was restricted to occupants of vehicles in which at least 1 person experienced an injury with Abbreviated Injury Scale score greater than 2. Traumatic brain injury was defined as an injury to the head or skull with an Abbreviated Injury Scale score greater than 2. Outcomes were analyzed using the chi2 test and multivariate logistic regression, with adjustment of variance to account for weighted probability sampling. Of the 1,115 occupants available for analysis, impact direction was lateral for 230 (18.42%) occupants and nonlateral for 885 (81.58%) occupants. One hundred eighty-seven (16.07%) occupants experienced a traumatic brain injury, 14.63% after lateral and 16.39% after nonlateral impact. The unadjusted relative risk of traumatic brain injury after lateral impact was 0.89 (95% confidence interval [CI] 0.51 to 1.56). After adjusting for several important crash-related variables, the relative risk of traumatic brain injury was 2.60 (95% CI 1.1 to 6.0). Traumatic brain injuries were more severe after lateral impact according to Abbreviated Injury Scale and Glasgow Coma Scale scores. The proportion of fatal or critical crash-related traumatic brain injuries attributable to lateral impact was 23.5%. Lateral impact is an important independent risk factor for the development of traumatic brain injury after a serious motor vehicle crash. Traumatic brain injuries incurred after lateral impact are more severe than those resulting from nonlateral impact. Vehicle modifications that increase head protection could reduce crash-related severe traumatic brain injuries by up to 61% and prevent up to 2,230 fatal or critical traumatic brain injuries each year
International Nuclear Information System (INIS)
Cook, J.R.
1980-12-01
This abbreviated data report presents results of ground water and stream sediment reconnaissance in the National Topographic Map Series Roanoke 1 0 x 2 0 quadrangle. Surface sediment samples were collected at 1235 sites. Ground water samples were collected at 767 sites. Neutron activation analysis results are given for uranium and 16 other elements in sediments, and for uranium and 8 other elements in ground water. Field measurements and observations are reported for each site. Analytical data and field measurements are presented. Data from ground water sites include (1) water chemistry measurements (pH, conductivity, and alkalinity), (2) physical measurements where applicable (water temperature, well description, etc.), and (3) elemental analyses (U, Al, Br, Cl, Dy, F, Mn, Na, and V). Data from sediment sites include (1) stream water chemistry measurements (pH, conductivity, and alkalinity), and (2) elemental analyses for sediment samples (U, Th, Hf, Al, Ce, Dy, Eu, Fe, La, Lu, Mn, Sc, Sm, Na, Ti, V, and Yb). Sample site descriptors (stream characteristics, vegetation, etc.) are tabulated. Areal distribution maps, histograms, and cumulative frequency plots for most elements and for U/Th and U/Hf ratios are included. Key data from stream water sites include (1) water quality measurements (pH, conductivity, and alkalinity) and (2) elemental analyses (U, Al, Br, Cl, Dy, F, Mg, Mn, Na, and V). Uranium concentrations in the sediments range from 0.50 to 83.50 ppM with a mean of 6.67 ppM. A cluster of high log (U/Th + Hf) ratios appear in the southeastern portion of the quadrangle. Uranium, thorium, and the rare earth elements show a striking correlation with the geology of the area
Lin, Ching-Hua; Yang, Wei-Cheng
2017-07-01
We aimed to compare the degree of symptom relief to psychosocial functional (abbreviated as "functional") improvement and explore the relationships between symptom relief and functional improvement during acute electroconvulsive therapy for patients with major depressive disorder. Major depressive disorder inpatients (n=130) requiring electroconvulsive therapy were recruited. Electroconvulsive therapy was generally performed for a maximum of 12 treatments. Symptom severity, using the 17-item Hamilton Depression Rating Scale, and psychosocial functioning (abbreviated as "functioning"), using the Modified Work and Social Adjustment Scale, were assessed before electroconvulsive therapy, after every 3 electroconvulsive therapy treatments, and after the final electroconvulsive therapy. Both 17-item Hamilton Depression Rating Scale and Modified Work and Social Adjustment Scale scores were converted to T-score units to compare the degrees of changes between depressive symptoms and functioning after electroconvulsive therapy. Structural equation modeling was used to test the relationships between 17-item Hamilton Depression Rating Scale and Modified Work and Social Adjustment Scale during acute electroconvulsive therapy. One hundred sixteen patients who completed at least the first 3 electroconvulsive therapy treatments entered the analysis. Reduction of 17-item Hamilton Depression Rating Scale T-scores was significantly greater than that of Modified Work and Social Adjustment Scale T-scores at assessments 2, 3, 4, and 5. The model analyzed by structural equation modeling satisfied all indices of goodness-of-fit (chi-square = 32.882, P =.107, TLI = 0.92, CFI = 0.984, RMSEA = 0.057). The 17-item Hamilton Depression Rating Scale change did not predict subsequent Modified Work and Social Adjustment Scale change. Functioning improved less than depressive symptoms during acute electroconvulsive therapy. Symptom reduction did not predict subsequent functional improvement
Sizoo, Bram B; van der Gaag, Rutger Jan; van den Brink, Wim
2015-05-01
Autism spectrum disorder and attention deficit/hyperactivity disorder overlap in several ways, raising questions about the nature of this comorbidity. Rommelse et al. published an innovative review of candidate endophenotypes for autism spectrum disorder and attention deficit/hyperactivity disorder in cognitive and brain domains. They found that all the endophenotypic impairments that were reviewed in attention deficit/hyperactivity disorder were also present in autism spectrum disorder, suggesting a continuity model with attention deficit/hyperactivity disorder as "a light form of autism spectrum disorder." Using existing data, 75 adults with autism spectrum disorder and 53 with attention deficit/hyperactivity disorder were directly compared on autistic symptoms with the autism spectrum quotient, and on the endophenotypic measure of temperament and character, using the Abbreviated (Dutch: Verkorte) Temperament and Character Inventory. Based on the hypothesis that attention deficit/hyperactivity disorder and autism spectrum disorder are disorders on a continuous spectrum, autism spectrum quotient scores and abbreviated Temperament and Character Inventory scores were expected to be different from normal controls in both disorders in a similar direction. In addition, the autism spectrum quotient and abbreviated Temperament and Character Inventory scores were expected to be closely correlated. These conditions applied to only two of the seven Abbreviated Temperament and Character Inventory scales (harm avoidance and self-directedness), suggesting that temperament and character as an endophenotype of autism spectrum disorder and attention deficit/hyperactivity disorder provides only partial support for the continuity hypothesis of autism spectrum disorder and attention deficit/hyperactivity disorder. © The Author(s) 2014.
Schott, Nadja
2014-01-01
The Activities specific Balance Confidence (ABC) is a questionnaire which was developed to assess falls-associated self-efficacy. The aim of this study was to evaluate reliability and validity of the German abbreviated 6-item version of the ABC scores in community-dwelling older people. The study sample included 384 subjects (age 71.1 ± 9.7). In order to determine the psychometric properties, reliability and validity were assessed through administration of the German adaptation of the ABC-D16 to participants twice, 10 days apart, and comparison of the ABC-D16 and the ABC-D6 with functional measures of balance and mobility (one-leg stance; 10 m walk; TUG; Fullerton Advanced Balance Scale (FAB)), physical activity (Physical Activity Scale for the Elderly (PASE)), physical fitness (30s arm curl, 30s chair stand, 6 min walk), cognition (Trail-Making-Test (TMT)), falls status, and quality of life (SF36). Factor analyses suggested a 1-factor solution for the ABC-D6 scale (explained variance 79.8%). Internal consistency (.95) and test-retest reliability (.98) for the ABC-D6 scores were excellent. Scores on the ABC-D6 were significantly lower than on the ABC-D16, but ABC-D16 and ABC-D6 scores were highly correlated (.94). There was an increasing difference in the ABC-scores between men and women with increasing age. Fallers reported lower balance confidence than non-fallers. The ABC-D6 score significantly correlated with functional measures of balance and mobility, physical activity, physical fitness, cognition, and quality of life (-.698valid instrument to asses falls-associated self-efficacy and may be used in future research projects and clinical trials. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Célio Magalhães
Full Text Available Abstract This paper brings the description and illustrations of the abbreviated larval development of the Amazonian freshwater palaemonid shrimp, Macrobrachium inpa Kensley and Walker, 1982. The study was based on ovigerous females (mean total body length of 27.0 ± 1.64 mm collected in a small forest stream in the Reserva Florestal Ducke, near Manaus, Brazil, of which four released their larvae in the laboratory. The females carried 8 to 19 eliptical (2.39 ± 0.10 X 1.67 ± 0.08 mm, yolk-rich eggs. The larval period consists of three benthic, lecithotrophic larval stages, and lasts 10-11 days. The newly-hatched larvae bear very advanced morphological features such as antenna with several marginal plumose seta on scaphocerite and long, multi-articulated flagellum; fully developed, functional uniramous pereiopods 3-5 (walking legs and biramous pleopods. The morphology of the carapace, all appendages of the cephalothorax and pleon, and the tail fan are described in detail and illustrated. The larval form was considered to be a decapodid because of the benthic behavior and due to the fact that functional walking legs and pleopods are the main structures for displacement and propulsion. The larval development of M. inpa is compared with those of the so-called "continental" group of the caridean shrimps from the Amazon River basin.
Personality and attitude toward Christianity among churchgoers: a replication.
Williams, Emyr; Francis, Leslie J
2006-08-01
A sample of 158 churchgoers attending eight Anglican churches in the United Kingdom completed the abbreviated Revised Eysenck Personality Questionnaire together with the Francis Scale of Attitude toward Christianity to replicate a 1996 study by Carter, Kay, and Francis. Data confirm that scores on Attitude toward Christianity were significantly negatively related to Psychoticism, but to neither Extraversion nor Neuroticism scores.
New rate structure of the Dutch natural gas trading company Gasunie
International Nuclear Information System (INIS)
Koevoet, H.
1999-01-01
Starting January 1, 2000, many of Gasunie's large-scale consumers will have to deal with a new rate structure: the CDS (Dutch abbreviation for Commodity Services System). Unlike in the old zone system, the consumption profile is of great importance in the CDS. Those who must heat large spaces have a particular interest in sizing up the consequences of the CDS
Abreviasi dalam Bahasa Inggris
Directory of Open Access Journals (Sweden)
Arie Andrasyah Isa
2006-04-01
Full Text Available This study is concerned with a productive word-form process in the morphologicallevel, such as abbreviation. Through the process of the word form, I intend to find out how tomake new words in using the abbreviation in English. Besides, I intend to review the conceptof abbreviation. The aim of this study is also to observe how the abbreviation can form newwords. The data employed in this study are from newspaper Jakarta Post and Kompas, andexamples provided by the related linguists. With the data exemplified by the linguists andbased on their discussion on abbreviation, I think there are some mistakes on information anddefinitions provided by them about the abbreviation. Hence, I try to present and find out newinformation about the abbreviation and its types morphologically. As the result of this study,there are 16 types of abbreviation. They are (1 acronyms, (2 part acronyms, (3 amalgam,(4 blends, (5 loan blends, (6 element blends, (7 part-whole blends, (8 lexical blends, (9separated blends, (10 contraction, (11 letter symbol, (12 clippings, (13 alphabetism, (14sycronyms, (15 acronym coinages, and (16 analogical forms.
[Identification, evaluation and treatment of dementia patients in society].
Capildeo, R; Wallace, M G; Clifford Rose, F
1983-12-29
Patients with "mild to moderate" dementia might improve with appropriate drug therapy whereas patients with "severe" dementia are generally considered to have an irreversible condition, providing acute metabolic disorders have been excluded and appropriate investigations have been performed to exclude neurological conditions that might be amenable to neurosurgery. Since it is unlikely that this type of patient will be referred to the hospital outpatient clinics, it is necessary to identify these patients in the community. For this purpose, authors have used the Abbreviated Mental Test. A comparison between two observers (nurse and doctor) has been made. Subsequently, a 6 symptoms check-list, as abbreviated form of the Crichton Royal Rating Scale for geriatric patients, was used in an open pilot study on 260 patients completing a 12 weeks treatment by dihydroergotoxine mesylate (codergocrine mesylate, Hydergine) 4.5 mg once a day. Although this was an open pilot study, it does show that it is possible to identify and treat patients with "mild to moderate" dementia in the community. A single dose formulation in the elderly has obvious advantages. In this study, compliance was excellent and 88% of the patients showed significant improvement using the suggested rating scales.
Prayer, personality and happiness: a study among undergraduate students in Wales
Robbins, Mandy; Francis, Leslie J.; Edwards, Bethan
2008-01-01
In order to examine the association between prayer and happiness, a sample of 131 undergraduate students attending a university in Wales completed three measures: the Oxford Happiness Questionnaire, the abbreviated Eysenck Personality Questionnaire Revised, and prayer frequency assessed on a 5-point scale. The data demonstrated a significant positive correlation between prayer frequency and happiness before controlling for individual differences in personality. After controlling for personali...
Graef, Julia E; Rief, Winfried; French, Douglas J; Nilges, Paul; Nestoriuc, Yvonne
2015-01-01
This study aims to develop and validate a German version of French and colleagues' Headache Management Self-efficacy Scale and to construct an abbreviated form for use in behavioral headache research. Furthermore, the contribution of headache-specific self-efficacy to pain-related disability in German chronic headache sufferers was examined. Headache-specific self-efficacy refers to an individuals' confidence that they can engage in behaviors to either prevent headache episodes or to manage headache-related pain and disability. Self-efficacy beliefs have been shown repeatedly to be positively associated with psychological well-being, effective coping, and enhanced treatment outcomes. A cross-sectional sample of 304 individuals diagnosed with either migraine, chronic tension-type headache, or a combination of 2 or more headache disorders completed the German Headache Management Self-efficacy Scale and questionnaires assessing headache activity, pain-related coping, general self-efficacy, depression, and anxiety. Responsiveness of the scale was analyzed in a longitudinal subsample of 32 inpatients undergoing headache treatment. Finally, a short form was constructed and evaluated regarding psychometric properties. The German Headache Management Self-efficacy Scale showed good reliability (Cronbach's α = 0.87) as did the 6-item short form (Cronbach's α = 0.72). In the longitudinal sample, both versions showed a good ability to change over time (SRM= 0.52-1.16). Chronic headache patients with higher levels of self-efficacy reported lower levels of disability (r = -0.26 to -0.31). Multiple regression analyses revealed headache intensity and headache-specific self-efficacy as strongest predictors of headache-related disability (βself-efficacy = -0.21, βintensity = 0.26). Both the 25-item version and the 6-item version appear to be valid, reliable measures of self-efficacy beliefs. These scales will allow clinicians to identify headache sufferers
African Journals Online (AJOL)
four
2013-02-20
Feb 20, 2013 ... 3Jacob School of Biotechnology and Bioengineering, SHIATS, Allahabad, Uttar Pradesh, India. Accepted 31 ... 2012) and salinity tolerance cultivars (Kanawapee et al., ..... Primers showing polymorphisms with their PIC value.
Directory of Open Access Journals (Sweden)
Neubert Jennifer
2013-01-01
Full Text Available Abstract Background Antiretroviral drugs including zidovudine (ZDV are effective in reducing HIV mother to child transmission (MTCT, however safety concern remains. The optimal duration of postnatal ZDV has not been established in clinical studies and there is a lack of consensus regarding optimal management. The objective of this study was to investigate the effectiveness and safety of a risk adapted two week course of oral postnatal ZDV as part of a combined intervention to reduce MTCT. Methods 118 mother infant pairs were treated according to the German-Austrian recommendations for HIV therapy in pregnancy and in HIV exposed newborns between 2000–2010. In the absence of factors associated with an increased HIV–1 transmission risk, children were assigned to the low risk group and treated with an abbreviated postnatal regimen with oral ZDV for 2 weeks. In the presence of risk factors, postnatal ZDV was escalated accordingly. Results Of 118 mother-infant pairs 79 were stratified to the low risk group, 27 to the high risk group and 11 to the very high risk group for HIV–1 MTCT. 4 children were lost to follow up. Overall Transmission risk in the group regardless of risk factors and completion of prophylaxis was 1.8% (95% confidence interval (CI 0.09–6.6. If transmission prophylaxis was complete, transmission risk was 0.9% (95% CI 0.01-5.7. In the low risk group receiving two week oral ZDV transmission risk was 1.4% (95% CI 0.01–8.4 Conclusion These data demonstrate the effectiveness of a short neonatal ZDV regimen in infants of women on stable ART and effective HIV–1 suppression. Further evaluation is needed in larger studies.
SINGKATAN DAN AKRONIM DALAM SURAT KABAR: KAJIAN BENTUK DAN PROSES
Directory of Open Access Journals (Sweden)
Noviatri Noviatri
2015-04-01
Full Text Available The reason for choosing abbreviation as the object of research is motivated by the phenomenon of widespread and high usage of abbreviation in the community, especially in the newspaper. In addition, based on the process of formation, the abbreviation used in many newspapers are not consistent with the general process of abraviation. In terms formation the abreviation in newspaper are not follow the rules of abreviation formation which violated the grammar of Bahasa Indonesia. The theory used in this research is the theory of abbreviation and formation process proposed by Kridalaksana (2010 which divides abreviation into five types, 1 abreviation, 2 acronym, 3 beheading, 4 contraction, and 5 symbol of letter. Results of the data analysis whows there are 1562 (one thousand five hundred and sixty-two abbreviation in the newspaper with 9 (nine processes, including three of them are new process (research findings and 896 (eight hundred and ninety-six acronymy used in newspapers with 31 (thirty-one process and 19 pieces are employed new process. Thus, based on formation process of abbreviations and acronyms there are 22 (twenty-two new processes. Keyword: Language, form, abbreviation, acronymy, process
International Nuclear Information System (INIS)
Kuprianov, Vladimir I.; Kaewklum, Rachadaporn; Chakritthakul, Songpol
2011-01-01
This work reports an experimental study on firing 80 kg/h rice husk in a swirling fluidized-bed combustor (SFBC) using an annular air distributor as the swirl generator. Two NO x emission control techniques were investigated in this work: (1) air staging of the combustion process, and (2) firing rice husk as moisturized fuel. In the first test series for the air-staged combustion, CO, NO and C x H y emissions and combustion efficiency were determined for burning 'as-received' rice husk at fixed excess air of 40%, while secondary-to-primary air ratio (SA/PA) was ranged from 0.26 to 0.75. The effects of SA/PA on CO and NO emissions from the combustor were found to be quite weak, whereas C x H y emissions exhibited an apparent influence of air staging. In the second test series, rice husks with the fuel-moisture content of 8.4% to 35% were fired at excess air varied from 20% to 80%, while the flow rate of secondary air was fixed. Radial and axial temperature and gas concentration (O 2 , CO, NO) profiles in the reactor, as well as CO and NO emissions, are discussed for the selected operating conditions. The temperature and gas concentration profiles for variable fuel quality exhibited significant effects of both fuel-moisture and excess air. As revealed by experimental results, the emission of NO from this SFBC can be substantially reduced through moisturizing rice husk, while CO is effectively mitigated by injection of secondary air into the bed splash zone, resulting in a rather low emission of CO and high (over 99%) combustion efficiency of the combustor for the ranges of operating conditions and fuel properties.
Active Transportation on a Complete Street: Perceived and Audited Walkability Correlates
Jensen, Wyatt A.; Brown, Barbara B.; Smith, Ken R.; Brewer, Simon C.; Amburgey, Jonathan W.; McIff, Brett
2017-01-01
Few studies of walkability include both perceived and audited walkability measures. We examined perceived walkability (Neighborhood Environment Walkability Scale—Abbreviated, NEWS-A) and audited walkability (Irvine–Minnesota Inventory, IMI) measures for residents living within 2 km of a “complete street”—one renovated with light rail, bike lanes, and sidewalks. For perceived walkability, we found some differences but substantial similarity between our final scales and those in a prior publish...
2010-09-01
penetrating spine injury • bioethics Abbreviations used in this paper: EMDG = Expeditionary Medical Group; GCS = Glasgow Coma Scale; GOS...select group of high-acuity patients capable of consuming significant medical resources in a deployed environment. This information has the potential to...impact medical planning, logistics, and policy. 25 256 Care of pediatric neurosurgical patients in Iraq in 2007: clinical and ethical experience of
Actual state and perspectives of the small hydroelectric plants in Colombia
International Nuclear Information System (INIS)
Torres Q, E.; Castillo C, J.J.
1995-01-01
In this article, the actual state of the small-scale hydroelectric power plants (PCHs, abbreviations in Spanish) in Colombia in aspects as: Statistic of the water in Colombia, a brief historical review and the characteristics of the PCHs in Colombia, is present. The development PCHs, the executing projects and the actions that has been develop by the INEA (Institute of Nuclear Sciences and the Alternative Energies) is described
Oncel, Didem; Malinoski, Darren; Brown, Carlos; Demetriades, Demetrios; Salim, Ali
2007-09-01
Gastric rupture after blunt abdominal trauma is a rare injury with few reports in the literature. The purpose of this study was to review our experience with blunt gastric injuries and compare outcomes with small bowel or colon injuries. All patients with hollow viscus perforations after blunt abdominal trauma from 1992 to 2005 at our level I trauma center were reviewed. Of 35,033 blunt trauma admissions, there were 268 (0.7%) patients with a total of 319 perforating hollow viscus injuries, 25 (0.07%) of which were blunt gastric injuries. When compared with the small bowel or colon injuries, the blunt gastric injury group had a higher Injury Severity Score (22 versus 17, P = 0.04), more patients with a chest Abbreviated Injury Score greater than 2 (36% versus 12%, P < 0.01), and a shorter interval from injury to laparotomy (221 versus 366 minutes, P = 0.017). Multivariate analysis identified five independent risk factors for mortality: age older than 55 years, head Abbreviated Injury Score greater than 2, chest Abbreviated Injury Score greater than 2, the presence of hypotension on admission, and Glasgow Coma Scale 8 or less. The results of this study suggest that mortality in patients with blunt hollow viscus injuries can be attributed to concurrent head and chest injuries, but not the specific hollow viscus organ that is injured.
Scale and scaling in agronomy and environmental sciences
Scale is of paramount importance in environmental studies, engineering, and design. The unique course covers the following topics: scale and scaling, methods and theories, scaling in soils and other porous media, scaling in plants and crops; scaling in landscapes and watersheds, and scaling in agro...
Forde, Arnell S.; Miselis, Jennifer L.; Flocks, James G.; Bernier, Julie C.; Wiese, Dana S.
2014-01-01
On July 5–19 (cruise 13BIM02) and August 22–September 1 (cruise 13BIM07), 2013, the U.S. Geological Survey (USGS) conducted geophysical surveys to investigate the geologic controls on barrier island evolution and medium-term and interannual sediment transport along the oil spill mitigation sand berm constructed at the north end and offshore of the Chandeleur Islands, Louisiana. This investigation is part of a broader USGS study, which seeks to understand barrier island evolution better over medium time scales (months to years). This report serves as an archive of unprocessed digital chirp subbottom data, trackline maps, navigation files, Geographic Information System (GIS) files, Field Activity Collection System (FACS) logs, and formal Federal Geographic Data Committee (FGDC) metadata. Gained–showing a relative increase in signal amplitude–digital images of the seismic profiles are provided. Refer to the Abbreviations page for explanations of acronyms and abbreviations used in this report.
Gravo-Aeroelastic Scaling for Extreme-Scale Wind Turbines
Energy Technology Data Exchange (ETDEWEB)
Fingersh, Lee J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Loth, Eric [University of Virginia; Kaminski, Meghan [University of Virginia; Qin, Chao [University of Virginia; Griffith, D. Todd [Sandia National Laboratories
2017-06-09
A scaling methodology is described in the present paper for extreme-scale wind turbines (rated at 10 MW or more) that allow their sub-scale turbines to capture their key blade dynamics and aeroelastic deflections. For extreme-scale turbines, such deflections and dynamics can be substantial and are primarily driven by centrifugal, thrust and gravity forces as well as the net torque. Each of these are in turn a function of various wind conditions, including turbulence levels that cause shear, veer, and gust loads. The 13.2 MW rated SNL100-03 rotor design, having a blade length of 100-meters, is herein scaled to the CART3 wind turbine at NREL using 25% geometric scaling and blade mass and wind speed scaled by gravo-aeroelastic constraints. In order to mimic the ultralight structure on the advanced concept extreme-scale design the scaling results indicate that the gravo-aeroelastically scaled blades for the CART3 are be three times lighter and 25% longer than the current CART3 blades. A benefit of this scaling approach is that the scaled wind speeds needed for testing are reduced (in this case by a factor of two), allowing testing under extreme gust conditions to be much more easily achieved. Most importantly, this scaling approach can investigate extreme-scale concepts including dynamic behaviors and aeroelastic deflections (including flutter) at an extremely small fraction of the full-scale cost.
Directory of Open Access Journals (Sweden)
Regina Márcia Cardoso de Sousa
2005-12-01
Full Text Available OBJETIVO: identificar entre as características das vítimas de trauma crânio-encefálico contuso (idade, sexo, escolaridade, antecedentes, tempo de internação, complicações pós-traumáticas e indicadores da gravidade do trauma e lesão craniana fatores de risco para prognóstico desfavorável. MÉTODOS: análise de 63 vítimas, com idade entre 12 e 65 anos, em seguimento ambulatorial em centro para atendimento de trauma, entre 6 meses e 3 anos após evento traumático. Utilizando-se a regressão logística múltipla foi construído um modelo para condição funcional. RESULTADOS: indivíduos que alcançaram pontuação 5 no máximo Abbreviated Injury Scale da região cabeça tiveram 4,89 vezes mais chance de dependência quando comparados com os que apresentaram escore menor. Vítimas internadas durante 12 dias ou mais mostraram 5,76 vezes mais chance para se tornarem dependentes em relação às demais. CONCLUSÃO: os fatores de risco para dependência foram o máximo Abbreviated Injury Scale da região cabeça e o tempo de internação.OBJETIVO: identificar entre las características de las víctimas con trauma encéfalo craneano (edad, sexo, escolaridad, antecedentes, tiempo de internamiento, complicaciones post traumáticas e indicadores de gravedad del trauma y lesión craneana factores de riesgo para pronóstico desfavorable. METODOS: análisis de 63 víctimas, con edades entre 12 y 65 años, con seguimiento ambulatorio en un centro de atención de trauma, entre 6 meses a 3 años posteriores al evento traumático. Se utilizó la regresión logística múltiple y fue construido un modelo para condición funcional. RESULTADOS: los individuos que alcanzaron puntuación de 5 como máximo en la Abbreviated Injury Scale de la región de la cabeza tuvieron 4,89 veces más oportunidad de dependencia que los que presentaron menor escore. Las víctimas internadas durante 12 días o más mostraron 5,76 veces más oportunidad de tornarse
VizieR Online Data Catalog: Are infrared dark clouds really quiescent? (Feng+, 2016)
Feng, S.; Beuther, H.; Zhang, Q.; Henning, T.; Linz, H.; Ragan, S.; Smith, R.
2016-05-01
All fits files are molecular line integrated intensity maps in G28.34S, IRDC18530, IRDC18306, and IRDC 18308 (Fig.3 in the paper). The maps unit is the intensity integrations (Kkm/s) over the velocity dispersion of each line. For the lines with <4σ detections, we only integrate a total of three channels around the system Vlsr at their rest frequencies. Files are named as "source"+"species"+".fits". G28.34S is abbreviated as "28", IRDC18306 is abbreviated as "06", IRDC18308 is abbreviated as "08", and IRDC18530 is abbreviated as "30". (2 data files).
Scaling of Metabolic Scaling within Physical Limits
Directory of Open Access Journals (Sweden)
Douglas S. Glazier
2014-10-01
Full Text Available Both the slope and elevation of scaling relationships between log metabolic rate and log body size vary taxonomically and in relation to physiological or developmental state, ecological lifestyle and environmental conditions. Here I discuss how the recently proposed metabolic-level boundaries hypothesis (MLBH provides a useful conceptual framework for explaining and predicting much, but not all of this variation. This hypothesis is based on three major assumptions: (1 various processes related to body volume and surface area exert state-dependent effects on the scaling slope for metabolic rate in relation to body mass; (2 the elevation and slope of metabolic scaling relationships are linked; and (3 both intrinsic (anatomical, biochemical and physiological and extrinsic (ecological factors can affect metabolic scaling. According to the MLBH, the diversity of metabolic scaling relationships occurs within physical boundary limits related to body volume and surface area. Within these limits, specific metabolic scaling slopes can be predicted from the metabolic level (or scaling elevation of a species or group of species. In essence, metabolic scaling itself scales with metabolic level, which is in turn contingent on various intrinsic and extrinsic conditions operating in physiological or evolutionary time. The MLBH represents a “meta-mechanism” or collection of multiple, specific mechanisms that have contingent, state-dependent effects. As such, the MLBH is Darwinian in approach (the theory of natural selection is also meta-mechanistic, in contrast to currently influential metabolic scaling theory that is Newtonian in approach (i.e., based on unitary deterministic laws. Furthermore, the MLBH can be viewed as part of a more general theory that includes other mechanisms that may also affect metabolic scaling.
A novel tool for evaluating children's musical abilities across age and culture
Peretz, Isabelle; Gosselin, Nathalie; Nan, Yun; Caron-Caplette, Emilie; Trehub, Sandra E.; B?land, Ren?e
2013-01-01
The present study introduces a novel tool for assessing musical abilities in children: The Montreal Battery of Evaluation of Musical Abilities (MBEMA). The battery, which comprises tests of memory, scale, contour, interval, and rhythm, was administered to 245 children in Montreal and 91 in Beijing (Experiment 1), and an abbreviated version was administered to an additional 85 children in Montreal (in less than 20 min; Experiment 2). All children were 6–8 years of age. Their performance indica...
The prevalence and nature of intellectual disability in Norwegian prisons.
Søndenaa, E; Rasmussen, K; Palmstierna, T; Nøttestad, J
2008-12-01
The objective of the study was to calculate the prevalence of inmates with intellectual disabilities (ID), and identify historical, medical and criminological characteristics of a certain impact. A random sample of 143 inmates from a Norwegian prison cross sectional sample was studied. The Hayes Ability Screening Index (HASI) was validated with the Wechsler Abbreviated Scale of Intelligence (WASI). The prevalence of inmates with ID, IQ intellectual handicap, are mostly absent in the Norwegian criminal justice system.
Fiability and construct validity of MUNSH test to measure happiness, in older Chilean population
Directory of Open Access Journals (Sweden)
Emilio Edmundo Moyano Díaz
2011-05-01
Full Text Available The goal was to adapt and to conduct the preliminary validation of the Scale of Happiness of the Memorial University of Newfounland (MUNSH. Three hundred elderly of more than 65 years answered the MUNSH, the Life Satisfaction Scale of Diener (ESV, and the Abbreviated Geriatric Depression Scale of Yesavage (EGADY. The MUNSH reached a Cronbach's alpha consistency of 0.90, and correlated positively with the ESV (r = 0.623 and negatively with the EGADY (r = -0.746, demonstrating appropriate convergent validity. A factor analysis revealed a multifactorial structure for the MUNSH with a single factor explaining 35% of the variance. The data collected with the MUNSH are analyzed in terms of age and sex differences and separate normative scores are provided
Lysosomal degradation of membrane lipids.
Kolter, Thomas; Sandhoff, Konrad
2010-05-03
The constitutive degradation of membrane components takes place in the acidic compartments of a cell, the endosomes and lysosomes. Sites of lipid degradation are intralysosomal membranes that are formed in endosomes, where the lipid composition is adjusted for degradation. Cholesterol is sorted out of the inner membranes, their content in bis(monoacylglycero)phosphate increases, and, most likely, sphingomyelin is degraded to ceramide. Together with endosomal and lysosomal lipid-binding proteins, the Niemann-Pick disease, type C2-protein, the GM2-activator, and the saposins sap-A, -B, -C, and -D, a suitable membrane lipid composition is required for degradation of complex lipids by hydrolytic enzymes. Copyright 2009 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.
Mowery, Danielle L; South, Brett R; Christensen, Lee; Leng, Jianwei; Peltonen, Laura-Maria; Salanterä, Sanna; Suominen, Hanna; Martinez, David; Velupillai, Sumithra; Elhadad, Noémie; Savova, Guergana; Pradhan, Sameer; Chapman, Wendy W
2016-07-01
The ShARe/CLEF eHealth challenge lab aims to stimulate development of natural language processing and information retrieval technologies to aid patients in understanding their clinical reports. In clinical text, acronyms and abbreviations, also referenced as short forms, can be difficult for patients to understand. For one of three shared tasks in 2013 (Task 2), we generated a reference standard of clinical short forms normalized to the Unified Medical Language System. This reference standard can be used to improve patient understanding by linking to web sources with lay descriptions of annotated short forms or by substituting short forms with a more simplified, lay term. In this study, we evaluate 1) accuracy of participating systems' normalizing short forms compared to a majority sense baseline approach, 2) performance of participants' systems for short forms with variable majority sense distributions, and 3) report the accuracy of participating systems' normalizing shared normalized concepts between the test set and the Consumer Health Vocabulary, a vocabulary of lay medical terms. The best systems submitted by the five participating teams performed with accuracies ranging from 43 to 72 %. A majority sense baseline approach achieved the second best performance. The performance of participating systems for normalizing short forms with two or more senses with low ambiguity (majority sense greater than 80 %) ranged from 52 to 78 % accuracy, with two or more senses with moderate ambiguity (majority sense between 50 and 80 %) ranged from 23 to 57 % accuracy, and with two or more senses with high ambiguity (majority sense less than 50 %) ranged from 2 to 45 % accuracy. With respect to the ShARe test set, 69 % of short form annotations contained common concept unique identifiers with the Consumer Health Vocabulary. For these 2594 possible annotations, the performance of participating systems ranged from 50 to 75 % accuracy. Short form normalization continues
Selected Topics from LVCSR Research for Asian Languages at Tokyo Tech
Furui, Sadaoki
This paper presents our recent work in regard to building Large Vocabulary Continuous Speech Recognition (LVCSR) systems for the Thai, Indonesian, and Chinese languages. For Thai, since there is no word boundary in the written form, we have proposed a new method for automatically creating word-like units from a text corpus, and applied topic and speaking style adaptation to the language model to recognize spoken-style utterances. For Indonesian, we have applied proper noun-specific adaptation to acoustic modeling, and rule-based English-to-Indonesian phoneme mapping to solve the problem of large variation in proper noun and English word pronunciation in a spoken-query information retrieval system. In spoken Chinese, long organization names are frequently abbreviated, and abbreviated utterances cannot be recognized if the abbreviations are not included in the dictionary. We have proposed a new method for automatically generating Chinese abbreviations, and by expanding the vocabulary using the generated abbreviations, we have significantly improved the performance of spoken query-based search.
Framing scales and scaling frames
van Lieshout, M.; Dewulf, A.; Aarts, N.; Termeer, K.
2009-01-01
Policy problems are not just out there. Actors highlight different aspects of a situation as problematic and situate the problem on different scales. In this study we will analyse the way actors apply scales in their talk (or texts) to frame the complex decision-making process of the establishment
Brenes, Francisco J; Angulo, Javier C; Ochayta, David; Rejas, Javier; Arumí, Daniel; Cañadas, Ana; Lizarraga, Isabel
2014-12-23
To perform the psychometric validation in the Spanish population of the Overactive Bladder Awareness Tool (OAB-V8) scale and its abbreviated version OAB-V3 for screening patients with probable overactive bladder (OAB). A cross-sectional study was conducted in a population aged over 18 years, which was representative of the prevalence of OAB in Spain using an online methodology (Internet survey). Psychometric properties included feasibility, reliability, and validity. Subjects were classified according to the likelihood of OAB, using an automated algorithm validated previously. ROC curve analysis was performed, and the sensitivity, specificity, and positive and negative predictive values were also assessed. A total of 2,035 subjects with a mean+SD age of 52.7+12.1 years were included (50.8%) men. In total 13.7% were classified as «Probable», 27.9% «Possible», and 58.3% «No» OAB. The internal consistency of both OAB-V8 and OAB-V3 scales was high (0.894 and 0.851, respectively). The item-total correlation coefficients were high; 0.87-0.88 and 0.71-0.83, respectively. Intraclass correlation coefficient for OAB-V8 was 0.826 (confidence interval 95% 0.695-0.901) and it was 0.828 (confidence interval 0.623-0.922) for OAB-V3. The optimum cut-off value of OAB-V8 for detecting probable OAB was≥8 points (AUC=0.895, sensitivity 0.875, specificity 0.735), while for the OAB-V3 it was ≥ 3 (AUC=0.910, sensitivity 0.828, specificity 0.825). Both OAB-V8 and OAB-V3 scales were considered useful online self-administered screening tools, which were also feasible, reliable and valid for the detection of patients with probable OAB in the general population in Spain. Copyright © 2013 Elsevier España, S.L.U. All rights reserved.
Valsangkar, Sameer; Bodhare, Trupti; Bele, Samir; Sai, Surendranath
2011-05-01
The effect of infertility on marital and sexual functioning, health-related quality of life (QoL) and the acceptability of the treatment modalities is a poorly researched area in India. To measure and compare the impact of infertility on marital adjustment, sexual functioning, QoL and the acceptability of various treatment modalities in infertility. Hospital-based cross-sectional controlled study. Data regarding infertility, socio-demographic characteristics and treatment acceptability was obtained via a semi-structured questionnaire. validated, standardized scales were used to measure marital adjustment (abbreviated dyadic adjustment scale), sexual functioning (abbreviated sexual functioning questionnaire) in cases and controls, and quality of life (FertiQol) in cases. Data from 106 women attending tertiary infertility centers who met the definition of primary infertility and 212 controls attending the medical outpatient department in the same centers was obtained. Body mass index and socioeconomic status were significant (P < 0.006 and < 0.0001 respectively) for infertility. Fertility-enhancing regimens and adoption had the highest acceptability with a wide dispersion of range for adoption and least acceptance for sperm, egg, embryo donation and surrogate motherhood. Logistic regression analysis revealed a significant effect size of infertility on marital adjustment (Nagelkerke R(2) 0.725, Cohen's D 0.86) and sexual functioning (Nagelkerke R(2) 0.73, Cohen's D 0.815). QoL showed a decrease in mean scores on the FertiQol scale similar to normative data. Effective counseling, reassurance and measures to reduce the impact of the condition on marital and sexual life, overall QoL are needed to impart a holistic treatment in infertility.
Scaling up: Assessing social impacts at the macro-scale
International Nuclear Information System (INIS)
Schirmer, Jacki
2011-01-01
Social impacts occur at various scales, from the micro-scale of the individual to the macro-scale of the community. Identifying the macro-scale social changes that results from an impacting event is a common goal of social impact assessment (SIA), but is challenging as multiple factors simultaneously influence social trends at any given time, and there are usually only a small number of cases available for examination. While some methods have been proposed for establishing the contribution of an impacting event to macro-scale social change, they remain relatively untested. This paper critically reviews methods recommended to assess macro-scale social impacts, and proposes and demonstrates a new approach. The 'scaling up' method involves developing a chain of logic linking change at the individual/site scale to the community scale. It enables a more problematised assessment of the likely contribution of an impacting event to macro-scale social change than previous approaches. The use of this approach in a recent study of change in dairy farming in south east Australia is described.
Directory of Open Access Journals (Sweden)
Gibran Roder Feguri
2012-03-01
Full Text Available INTRODUÇÃO: Existe pouca informação sobre abreviação do jejum pré-operatório com oferta de líquidos ricos em carboidratos (CHO nas operações cardiovasculares. OBJETIVOS: Avaliar variáveis clínicas, segurança do método e efeitos no metabolismo de pacientes submetidos à abreviação do jejum na cirurgia de revascularização do miocárdio (CRVM. MÉTODOS: Quarenta pacientes submetidos à CRVM foram randomizados para receberem 400 ml (6 horas antes e 200 mL (2 horas antes de maltodextrina a 12,5% (Grupo I, n=20 ou apenas água (Grupo II, n=20 antes da indução anestésica. Foram avaliadas diversas variáveis clínicas no perioperatório e também a resistência insulínica (RI pelo índice de Homa-IR e pela necessidade de insulina exógena; além da função excretora da célula beta pancreática pelo Homa-Beta e controle glicêmico por exames de glicemia capilar. RESULTADOS: Não ocorreram óbitos, broncoaspiração, mediastinite, infarto agudo do miocárdio ou acidente vascular encefálico perioperatórios. Fibrilação atrial ocorreu em dois pacientes de cada grupo e complicações infecciosas não diferiram entre os grupos (P=0,611. Pacientes do Grupo I apresentaram dois dias a menos de internação hospitalar (P=0,025 e um dia a menos na UTI (P0,05. Declínio da produção endógena de insulina ocorreu em ambos os grupos (PINTRODUCTION: Limited information is available about preoperative fasting abbreviation with administration of liquid enriched with carbohydrates (CHO in cardiovascular surgeries. OBJECTIVES: To evaluate clinical variables, security of the method and effects on the metabolism of patients undergoing fasting abbreviation in coronary artery bypass graft (CABG surgery. METHODS: Forty patients undergoing CABG were randomized to receive 400 ml (6 hours before and 200 ml (2 hours before of maltodextrin at 12.5% (Group I, n=20 or just water (Group II, n=20 before anesthetic induction. Perioperative clinical variables
Scales and scaling in turbulent ocean sciences; physics-biology coupling
Schmitt, Francois
2015-04-01
Geophysical fields possess huge fluctuations over many spatial and temporal scales. In the ocean, such property at smaller scales is closely linked to marine turbulence. The velocity field is varying from large scales to the Kolmogorov scale (mm) and scalar fields from large scales to the Batchelor scale, which is often much smaller. As a consequence, it is not always simple to determine at which scale a process should be considered. The scale question is hence fundamental in marine sciences, especially when dealing with physics-biology coupling. For example, marine dynamical models have typically a grid size of hundred meters or more, which is more than 105 times larger than the smallest turbulence scales (Kolmogorov scale). Such scale is fine for the dynamics of a whale (around 100 m) but for a fish larvae (1 cm) or a copepod (1 mm) a description at smaller scales is needed, due to the nonlinear nature of turbulence. The same is verified also for biogeochemical fields such as passive and actives tracers (oxygen, fluorescence, nutrients, pH, turbidity, temperature, salinity...) In this framework, we will discuss the scale problem in turbulence modeling in the ocean, and the relation of Kolmogorov's and Batchelor's scales of turbulence in the ocean, with the size of marine animals. We will also consider scaling laws for organism-particle Reynolds numbers (from whales to bacteria), and possible scaling laws for organism's accelerations.
MO-E-18C-03: Incorporating Active Learning Into A Traditional Graduate Medical Physics Course
Energy Technology Data Exchange (ETDEWEB)
Burmeister, J [Wayne State University School of Medicine / Karmanos Cancer Center, Detroit, MI (United States)
2014-06-15
Purpose: To improve the ability of graduate students to learn medical physics concepts through the incorporation of active learning techniques. Methods: A traditional lecture-based radiological physics course was modified such that: (1) traditional (two-hour) lectures were provided online for students to watch prior to class, (2) a student was chosen randomly at the start of each class to give a two minute synopsis of the material and its relevance (two-minute drill), (3) lectures were significantly abbreviated and remaining classroom time used for group problem solving, and (4) videos of the abbreviated lectures were made available online for review. In the transition year, students were surveyed about the perceived effects of these changes on learning. Student performance was evaluated for 3 years prior to and 4 years after modification. Results: The survey tool used a five point scale from 1=Not True to 5=Very True. While nearly all students reviewed written materials prior to class (4.3±0.9), a minority watched the lectures (2.1±1.5). A larger number watched the abbreviated lectures for further clarification (3.6±1.6) and found it helpful in learning the content (4.2±1.0). Most felt that the two-minute drill helped them get more out of the lecture (3.9±0.8) and the problem solving contributed to their understanding of the content (4.1±0.8). However, no significant improvement in exam scores resulted from the modifications (mean scores well within 1 SD during study period). Conclusion: Students felt that active learning techniques improved their ability to learn the material in what is considered the most difficult course in the program. They valued the ability to review the abbreviated class lecture more than the opportunity to watch traditional lectures prior to class. While no significant changes in student performance were observed, aptitude variations across the student cohorts make it difficult to draw conclusions about the effectiveness of active
MO-E-18C-03: Incorporating Active Learning Into A Traditional Graduate Medical Physics Course
International Nuclear Information System (INIS)
Burmeister, J
2014-01-01
Purpose: To improve the ability of graduate students to learn medical physics concepts through the incorporation of active learning techniques. Methods: A traditional lecture-based radiological physics course was modified such that: (1) traditional (two-hour) lectures were provided online for students to watch prior to class, (2) a student was chosen randomly at the start of each class to give a two minute synopsis of the material and its relevance (two-minute drill), (3) lectures were significantly abbreviated and remaining classroom time used for group problem solving, and (4) videos of the abbreviated lectures were made available online for review. In the transition year, students were surveyed about the perceived effects of these changes on learning. Student performance was evaluated for 3 years prior to and 4 years after modification. Results: The survey tool used a five point scale from 1=Not True to 5=Very True. While nearly all students reviewed written materials prior to class (4.3±0.9), a minority watched the lectures (2.1±1.5). A larger number watched the abbreviated lectures for further clarification (3.6±1.6) and found it helpful in learning the content (4.2±1.0). Most felt that the two-minute drill helped them get more out of the lecture (3.9±0.8) and the problem solving contributed to their understanding of the content (4.1±0.8). However, no significant improvement in exam scores resulted from the modifications (mean scores well within 1 SD during study period). Conclusion: Students felt that active learning techniques improved their ability to learn the material in what is considered the most difficult course in the program. They valued the ability to review the abbreviated class lecture more than the opportunity to watch traditional lectures prior to class. While no significant changes in student performance were observed, aptitude variations across the student cohorts make it difficult to draw conclusions about the effectiveness of active
Energy transfers in large-scale and small-scale dynamos
Samtaney, Ravi; Kumar, Rohit; Verma, Mahendra
2015-11-01
We present the energy transfers, mainly energy fluxes and shell-to-shell energy transfers in small-scale dynamo (SSD) and large-scale dynamo (LSD) using numerical simulations of MHD turbulence for Pm = 20 (SSD) and for Pm = 0.2 on 10243 grid. For SSD, we demonstrate that the magnetic energy growth is caused by nonlocal energy transfers from the large-scale or forcing-scale velocity field to small-scale magnetic field. The peak of these energy transfers move towards lower wavenumbers as dynamo evolves, which is the reason for the growth of the magnetic fields at the large scales. The energy transfers U2U (velocity to velocity) and B2B (magnetic to magnetic) are forward and local. For LSD, we show that the magnetic energy growth takes place via energy transfers from large-scale velocity field to large-scale magnetic field. We observe forward U2U and B2B energy flux, similar to SSD.
A multi scale model for small scale plasticity
International Nuclear Information System (INIS)
Zbib, Hussein M.
2002-01-01
Full text.A framework for investigating size-dependent small-scale plasticity phenomena and related material instabilities at various length scales ranging from the nano-microscale to the mesoscale is presented. The model is based on fundamental physical laws that govern dislocation motion and their interaction with various defects and interfaces. Particularly, a multi-scale model is developed merging two scales, the nano-microscale where plasticity is determined by explicit three-dimensional dislocation dynamics analysis providing the material length-scale, and the continuum scale where energy transport is based on basic continuum mechanics laws. The result is a hybrid simulation model coupling discrete dislocation dynamics with finite element analyses. With this hybrid approach, one can address complex size-dependent problems, including dislocation boundaries, dislocations in heterogeneous structures, dislocation interaction with interfaces and associated shape changes and lattice rotations, as well as deformation in nano-structured materials, localized deformation and shear band
DEFF Research Database (Denmark)
Svendsen, Morten Bo Søndergaard; Christensen, Emil Aputsiaq Flindt; Steffensen, John Fleng
2017-01-01
Conventionally, dynamic energy budget (DEB) models operate with animals that have maintenance rates scaling with their body volume, and assimilation rates scaling with body surface area. However, when applying such criteria for the individual in a population level model, the emergent behaviour...
Specific Tandem 3'UTR Patterns and Gene Expression Profiles in Mouse Thy1+ Germline Stem Cells.
Directory of Open Access Journals (Sweden)
Yan Huang
Full Text Available A recently developed strategy of sequencing alternative polyadenylation (APA sites (SAPAS with second-generation sequencing technology can be used to explore complete genome-wide patterns of tandem APA sites and global gene expression profiles. spermatogonial stem cells (SSCs maintain long-term reproductive abilities in male mammals. The detailed mechanisms by which SSCs self-renew and generate mature spermatozoa are not clear. To understand the specific alternative polyadenylation pattern and global gene expression profile of male germline stem cells (GSCs, mainly referred to SSCs here, we isolated and purified mouse Thy1+ cells from testis by magnetic-activated cell sorting (MACS and then used the SAPAS method for analysis, using pluripotent embryonic stem cells (ESCs and differentiated mouse embryonic fibroblast cells (MEFs as controls. As a result, we obtained 99,944 poly(A sites, approximately 40% of which were newly detected in our experiments. These poly(A sites originated from three mouse cell types and covered 17,499 genes, including 831 long non-coding RNA (lncRNA genes. We observed that GSCs tend to have shorter 3'UTR lengths while MEFs tend towards longer 3'UTR lengths. We also identified 1337 genes that were highly expressed in GSCs, and these genes were highly consistent with the functional characteristics of GSCs. Our detailed bioinformatics analysis identified APA site-switching events at 3'UTRs and many new specifically expressed genes in GSCs, which we experimentally confirmed. Furthermore, qRT-PCR was performed to validate several events of the 334 genes with distal-to-proximal poly(A switch in GSCs. Consistently APA reporter assay confirmed the total 3'UTR shortening in GSCs compared to MEFs. We also analyzed the cis elements around the proximal poly(A site preferentially used in GSCs and found C-rich elements may contribute to this regulation. Overall, our results identified the expression level and polyadenylation site
Specific Tandem 3'UTR Patterns and Gene Expression Profiles in Mouse Thy1+ Germline Stem Cells
Lin, Zhuoheng; Feng, Xuyang; Jiang, Xue; Songyang, Zhou; Huang, Junjiu
2015-01-01
A recently developed strategy of sequencing alternative polyadenylation (APA) sites (SAPAS) with second-generation sequencing technology can be used to explore complete genome-wide patterns of tandem APA sites and global gene expression profiles. spermatogonial stem cells (SSCs) maintain long-term reproductive abilities in male mammals. The detailed mechanisms by which SSCs self-renew and generate mature spermatozoa are not clear. To understand the specific alternative polyadenylation pattern and global gene expression profile of male germline stem cells (GSCs, mainly referred to SSCs here), we isolated and purified mouse Thy1+ cells from testis by magnetic-activated cell sorting (MACS) and then used the SAPAS method for analysis, using pluripotent embryonic stem cells (ESCs) and differentiated mouse embryonic fibroblast cells (MEFs) as controls. As a result, we obtained 99,944 poly(A) sites, approximately 40% of which were newly detected in our experiments. These poly(A) sites originated from three mouse cell types and covered 17,499 genes, including 831 long non-coding RNA (lncRNA) genes. We observed that GSCs tend to have shorter 3'UTR lengths while MEFs tend towards longer 3'UTR lengths. We also identified 1337 genes that were highly expressed in GSCs, and these genes were highly consistent with the functional characteristics of GSCs. Our detailed bioinformatics analysis identified APA site-switching events at 3'UTRs and many new specifically expressed genes in GSCs, which we experimentally confirmed. Furthermore, qRT-PCR was performed to validate several events of the 334 genes with distal-to-proximal poly(A) switch in GSCs. Consistently APA reporter assay confirmed the total 3'UTR shortening in GSCs compared to MEFs. We also analyzed the cis elements around the proximal poly(A) site preferentially used in GSCs and found C-rich elements may contribute to this regulation. Overall, our results identified the expression level and polyadenylation site profiles and
One-fifth-scale and full-scale fuel element rocking tests
International Nuclear Information System (INIS)
Nau, P.V.; Olsen, B.E.
1978-06-01
Using 1 / 5 -scale and 1 / 1 -scale (prototype H451) fuel elements, one, two, or three stacked elements on a clamped base element were rocked from an initial release position. Relative displacement, rock-down loads, and dowel pin shear forces were measured. A scaled comparison between 1 / 5 -scale and 1 / 1 -scale results was made to evaluate the model scaling laws, and an error analysis was performed to assess the accuracy and usefulness of the test data
Scales are a visible peeling or flaking of outer skin layers. These layers are called the stratum ... Scales may be caused by dry skin, certain inflammatory skin conditions, or infections. Examples of disorders that ...
Optimal renormalization scales and commensurate scale relations
International Nuclear Information System (INIS)
Brodsky, S.J.; Lu, H.J.
1996-01-01
Commensurate scale relations relate observables to observables and thus are independent of theoretical conventions, such as the choice of intermediate renormalization scheme. The physical quantities are related at commensurate scales which satisfy a transitivity rule which ensures that predictions are independent of the choice of an intermediate renormalization scheme. QCD can thus be tested in a new and precise way by checking that the observables track both in their relative normalization and in their commensurate scale dependence. For example, the radiative corrections to the Bjorken sum rule at a given momentum transfer Q can be predicted from measurements of the e+e - annihilation cross section at a corresponding commensurate energy scale √s ∝ Q, thus generalizing Crewther's relation to non-conformal QCD. The coefficients that appear in this perturbative expansion take the form of a simple geometric series and thus have no renormalon divergent behavior. The authors also discuss scale-fixed relations between the threshold corrections to the heavy quark production cross section in e+e - annihilation and the heavy quark coupling α V which is measurable in lattice gauge theory
INIS: Authority List for Journal Titles
International Nuclear Information System (INIS)
1992-01-01
This is the nineteenth revision of the INIS: Authority List for Journal Titles (IAEA-INIS-11). It lists 10,797 journal titles which have contained articles within the scope of INIS. The purpose of this Authority List is to provide descriptive cataloguers with a standard abbreviation for journal titles and to assist users of INIS products with a tool for verifying the full title of a journal. A journal, or periodical, is generally published within a defined, fixed interval between issues, which usually has more than one issue a year, and which usually includes a mixture of articles, letters, summaries, etc. Within this definition, annuals such as Annual Review of Nuclear Science are included. Series titles as, for example the McGraw-Hill Series in Nuclear Engineering, are not included in this Authority. Entries: Each entry consists of: - the full journal title (highlighted); - the abbreviated title; - ISSN, if available; - CODEN, if available; - additional information related to the journal title. Arrangement: In Part I, the full journal titles are grouped by country or international organization name and ordered alphabetically, followed by the ISSN, the CODEN in square brackets if available, and then the abbreviated title. The abbreviated title is based on the rules of ISO 4: Documentation - International Code for the Abbreviation of Titles of Periodicals. The abbreviations of the words are taken from the ISDS List of Periodical Title Word Abbreviation. In Part II, the order of the citations is reversed: the abbreviated journal titles are arranged alphabetically, followed by country code. Then the full journal titles are followed by the country of publication, and if available, ISSN and CODEN. Additional Information: There is important information related to the journal titles which are fundamental for tracing the history of the title and the present status. They are listed below and are entered whenever applicable: - Ceased publication; - Superseded by
Combaluzier, S; Gouvernet, B; Menant, F; Rezrazi, A
2018-02-01
Since the publication of the DSM-5 (APA, 2013), the dimensional conception of the personality disorders is co-existing with the classical categorical paradigm. Tools have been proposed for the evaluations of five big pathological factors to be explored further according to the APA (negative affectivity, detachment, antagonism, disinhibition, psychoticism). Despite numerous works using these questionnaires (30 works in 3 years according to Al-Adjani et al., 2015), none of them have yet been translated into French. Also, the main objective of the paper is to present a French translation of the Personality Inventory for DSM -5 by Kruegger et al. (2013) in its brief form of 25 items (PID-5 BF). To reach this goal, we have employed the classic translation-retranslation method (Vallerand, 1989) and tested the consistence and the validity of this French version among a non-clinical sample (n=216) of young adults (age=31.4, SD=4.8), in joining some other questionnaires in their short forms to study the external validity of the PID-5 about the psychological distress (SCL-10, Nguyen, 1983), the categorical diagnosis of personality disorders (SAPAS, Moran et al., 2003) and the classical Big Five dimensions of the personality (BDI 10, Ramamstedt and John, 2007). The internal consistency of this translation has been studied through the classical outcomes on factor analysis for the dimensional repartitions of the items in 5 scales and Cronbach's alpha for the consistency of each found dimensions. The external validity has been explored by studying Pearson's correlations between the outcomes on each dimension of the PID-5 BF and both the clinical dimensions of SCL-10, personality dimensions of the BFI-10 or personality disorders (SAPAS). Factor analysis led to the same repartition of the 25 items as the original versions. Each of the dimensions is consistent enough (α>.65) to be taken into account as clinically significant. The items of the French version of the PID-5 BF follow
Progress on Radioactive Waste Treatment Facilities Construction
Institute of Scientific and Technical Information of China (English)
无
2011-01-01
In 2011, five projects were undertaken by radioactive waste projects management department, which are "Cold Commissioning of the Pilot Project on Radioactive Waste Retrieval and Conditioning (abbreviation 'Pilot Project')", "Radioactive Ventilation Project Construction (abbreviation 'Ventilation
Hammersvik, Eirik; Sandberg, Sveinung; Pedersen, Willy
2012-11-01
Over the past 15-20 years, domestic cultivation of cannabis has been established in a number of European countries. New techniques have made such cultivation easier; however, the bulk of growers remain small-scale. In this study, we explore the factors that prevent small-scale growers from increasing their production. The study is based on 1 year of ethnographic fieldwork and qualitative interviews conducted with 45 Norwegian cannabis growers, 10 of whom were growing on a large-scale and 35 on a small-scale. The study identifies five mechanisms that prevent small-scale indoor growers from going large-scale. First, large-scale operations involve a number of people, large sums of money, a high work-load and a high risk of detection, and thus demand a higher level of organizational skills than for small growing operations. Second, financial assets are needed to start a large 'grow-site'. Housing rent, electricity, equipment and nutrients are expensive. Third, to be able to sell large quantities of cannabis, growers need access to an illegal distribution network and knowledge of how to act according to black market norms and structures. Fourth, large-scale operations require advanced horticultural skills to maximize yield and quality, which demands greater skills and knowledge than does small-scale cultivation. Fifth, small-scale growers are often embedded in the 'cannabis culture', which emphasizes anti-commercialism, anti-violence and ecological and community values. Hence, starting up large-scale production will imply having to renegotiate or abandon these values. Going from small- to large-scale cannabis production is a demanding task-ideologically, technically, economically and personally. The many obstacles that small-scale growers face and the lack of interest and motivation for going large-scale suggest that the risk of a 'slippery slope' from small-scale to large-scale growing is limited. Possible political implications of the findings are discussed. Copyright
Multi-Scale Models for the Scale Interaction of Organized Tropical Convection
Yang, Qiu
Assessing the upscale impact of organized tropical convection from small spatial and temporal scales is a research imperative, not only for having a better understanding of the multi-scale structures of dynamical and convective fields in the tropics, but also for eventually helping in the design of new parameterization strategies to improve the next-generation global climate models. Here self-consistent multi-scale models are derived systematically by following the multi-scale asymptotic methods and used to describe the hierarchical structures of tropical atmospheric flows. The advantages of using these multi-scale models lie in isolating the essential components of multi-scale interaction and providing assessment of the upscale impact of the small-scale fluctuations onto the large-scale mean flow through eddy flux divergences of momentum and temperature in a transparent fashion. Specifically, this thesis includes three research projects about multi-scale interaction of organized tropical convection, involving tropical flows at different scaling regimes and utilizing different multi-scale models correspondingly. Inspired by the observed variability of tropical convection on multiple temporal scales, including daily and intraseasonal time scales, the goal of the first project is to assess the intraseasonal impact of the diurnal cycle on the planetary-scale circulation such as the Hadley cell. As an extension of the first project, the goal of the second project is to assess the intraseasonal impact of the diurnal cycle over the Maritime Continent on the Madden-Julian Oscillation. In the third project, the goals are to simulate the baroclinic aspects of the ITCZ breakdown and assess its upscale impact on the planetary-scale circulation over the eastern Pacific. These simple multi-scale models should be useful to understand the scale interaction of organized tropical convection and help improve the parameterization of unresolved processes in global climate models.
Scale-by-scale contributions to Lagrangian particle acceleration
Lalescu, Cristian C.; Wilczek, Michael
2017-11-01
Fluctuations on a wide range of scales in both space and time are characteristic of turbulence. Lagrangian particles, advected by the flow, probe these fluctuations along their trajectories. In an effort to isolate the influence of the different scales on Lagrangian statistics, we employ direct numerical simulations (DNS) combined with a filtering approach. Specifically, we study the acceleration statistics of tracers advected in filtered fields to characterize the smallest temporal scales of the flow. Emphasis is put on the acceleration variance as a function of filter scale, along with the scaling properties of the relevant terms of the Navier-Stokes equations. We furthermore discuss scaling ranges for higher-order moments of the tracer acceleration, as well as the influence of the choice of filter on the results. Starting from the Lagrangian tracer acceleration as the short time limit of the Lagrangian velocity increment, we also quantify the influence of filtering on Lagrangian intermittency. Our work complements existing experimental results on intermittency and accelerations of finite-sized, neutrally-buoyant particles: for the passive tracers used in our DNS, feedback effects are neglected such that the spatial averaging effect is cleanly isolated.
Directory of Open Access Journals (Sweden)
Sameer Valsangkar
2011-01-01
Full Text Available Background : The effect of infertility on marital and sexual functioning, health-related quality of life (QoL and the acceptability of the treatment modalities is a poorly researched area in India. Aims and Objectives : To measure and compare the impact of infertility on marital adjustment, sexual functioning, QoL and the acceptability of various treatment modalities in infertility. Design and Setting : Hospital-based cross-sectional controlled study. Materials and Methods : Data regarding infertility, socio-demographic characteristics and treatment acceptability was obtained via a semi-structured questionnaire. validated, standardized scales were used to measure marital adjustment (abbreviated dyadic adjustment scale, sexual functioning (abbreviated sexual functioning questionnaire in cases and controls, and quality of life (FertiQol in cases. Data from 106 women attending tertiary infertility centers who met the definition of primary infertility and 212 controls attending the medical outpatient department in the same centers was obtained. Results : Body mass index and socioeconomic status were significant (P < 0.006 and < 0.0001 respectively for infertility. Fertility-enhancing regimens and adoption had the highest acceptability with a wide dispersion of range for adoption and least acceptance for sperm, egg, embryo donation and surrogate motherhood. Logistic regression analysis revealed a significant effect size of infertility on marital adjustment (Nagelkerke R 2 0.725, Cohen′s D 0.86 and sexual functioning (Nagelkerke R 2 0.73, Cohen′s D 0.815. QoL showed a decrease in mean scores on the FertiQol scale similar to normative data. Conclusions : Effective counseling, reassurance and measures to reduce the impact of the condition on marital and sexual life, overall QoL are needed to impart a holistic treatment in infertility.
Howard, Matt C.
2018-01-01
Scale pretests analyze the suitability of individual scale items for further analysis, whether through judging their face validity, wording concerns, and/or other aspects. The current article reviews scale pretests, separated by qualitative and quantitative methods, in order to identify the differences, similarities, and even existence of the…
Directory of Open Access Journals (Sweden)
Núbia Maria Freire Vieira Lima
2009-12-01
Full Text Available O objetivo do trabalho foi traduzir a Amyotrophic Lateral Sclerosis Severity Scale para o português, como Escala de gravidade da esclerose lateral amiotrófica (Egela, além de validar e estudar sua confiabilidade. A escala foi submetida à versão e retroversão por tradutores bilíngües e três fisioterapeutas treinaram para padronizar sua aplicação. Foram avaliados 22 pacientes (5 mulheres, 17 homens, média de idade 45,9 anos pela Egela e pela medida de independência funcional (MIF; 11 foram examinados para classificação de disfagia. Os coeficientes de correlação intraclasse dos domínios da Egela foram acima de 0,89. Foi constatada alta consistência interna em todos os seus domínios e para cada avaliador; foram encontradas fortes correlações entre a MIF motora e o escore espinhal da Egela (r=0.87 e pThe purpose was to translate the Amyotrophic Lateral Sclerosis Severity Scale (ALSSS into Portuguese, to validate it and assess its reliability. The scale was submitted to bilingual translators, its abbreviation in Portuguese being Egela; three physical therapists were trained for its application. Twenty-two patients (5 women, 17 men, mean age 45.9 were evaluated by the Egela and by the functional independence measure (FIM; 11 of them were assessed for dysphagia classification. In all ALSSS domains the intraclass correlation coefficients were over 0.89; high internal consistency was found in all scale domains and for each examiner. Strong correlations were found between motor FIM and spinal ALSSS (r=0.87; p<0.0001, ALSSS swallow domain and both dysphagia classifications (r=-0.88; p=0.0015, and ALSSS speech domain and expression FIM (r=0.76; p<0.001. The Portuguese version of ALSSS showed significant inter-examiner reliability and internal consistency, as well as strong correlations with FIM scores, thus proving a valid and reliable tool for assessing patients with amyotrophic lateral sclerosis.
Developing a culture of safety in a reluctant audience
Schieber, Richard A; Olson, Sarah J
2002-01-01
Objective To describe the injury pattern of skateboarding injuriestoday. Methods The pattern of injuries, circumstances, and severitywere investigated in a study of 139 people injured in skateboarding accidentsduring 1995 through 1998 inclusive and admitted to the University Hospital ofUmeå, Umeå, Sweden. This is the only hospital in the area, servinga population of 135,000. Results Of the 139 injured, 3 were pedestrainshit by a skateboard rider; the rest were riders. The age range was 7 to 47years (mean, 16.0). The severity of the injuries was minor (Abbreviated InjuryScale 1) to moderate (Abbreviated Injury Scale 2); fractures were classifiedas moderate. The annual number of injuries increased during the study period.Fractures were found in 29% of the casualties, and four children hadconcussion. The most common fractures were of the ankle and wrist. Olderpatients had less severe injuries, mainly sprains and soft tissue injuries.Most children were injured while skateboarding on ramps and at arenas; only 12(9%) were injured while skateboarding on roads. Some 37% of the injuriesoccurred because of a loss of balance and 26% because of a failed trickattempt. Falls caused by surface irregularities resulted in the highestproportion of the moderate injuries. Conclusions Skateboarding shouldbe restricted to supervised skateboard parks, and skateboarders should berequired to wear protective gear. These measures would reduce the number ofskateboarders injured in motor vehicle collisions, the personal injuries amongskateboarders, and the number of pedestrians injured in collisions withskateboarders. PMID:12016256
Reiff, Donald A; McGwin, Gerald; Metzger, Jesse; Windham, Samuel T; Doss, Marilyn; Rue, Loring W
2002-12-01
Diaphragmatic rupture (DR) remains a diagnostic challenge because of the lack of an accurate test demonstrating the injury. Our purpose was to identify motor vehicle collision (MVC) characteristics and patient injuries that collectively could identify the presence of a DR. The National Automotive Sampling System was used to identify occupants involved in MVCs from 1995 to 1999 who sustained abdominal (Abbreviated Injury Scale score >or= 2) and/or thoracic injuries (Abbreviated Injury Scale score >or= 2). Odds ratios (ORs) and 95% confidence intervals (CIs) were calculated to quantify the association between patient injuries, vehicle collision characteristics, and DR. Sensitivity and specificity were also calculated to determine the ability of organ injury and MVC characteristics to correctly classify patients with and without DR. Overall, occupants sustaining a DR had a significantly higher delta-V (DeltaV) (49.8 kilometers per hour [kph] vs. 33.8 kph, por= 30 cm or DeltaV >or= 40 kph with specific organ injuries generated a sensitivity for indicating the likelihood of diaphragm injury ranging from 68% to 89%. Patients with any of the following characteristics had a sensitivity for detecting DR of 91%: splenic injury, pelvic fracture, DeltaV >or= 40 kph, or occupant compartment intrusion from any direction >or= 30 cm. Specific MVC characteristics combined with patient injuries have been identified that are highly suggestive of DR. For this subpopulation, additional invasive procedures including exploratory laparotomy, laparoscopy, or thoracoscopy may be warranted to exclude DR.
Brenner, Megan; Stein, Deborah M; Hu, Peter F; Aarabi, Bizhan; Sheth, Kevin; Scalea, Thomas M
2012-05-01
Vital signs, particularly blood pressure, are often manipulated to maximize perfusion and optimize recovery from severe traumatic brain injury (sTBI). We investigated the utility of automated continuously recorded vital signs to predict outcomes after sTBI. Sixty patients with head Abbreviated Injury Scale score ≥ 3, age >14 years, "isolated" TBI, and need for intracranial pressure monitoring were prospectively enrolled at a single, large urban tertiary care facility. Outcome was measured by mortality and extended Glasgow Outcome Scale (GOSE) at 12 months. Continuous, automated, digital data were collected every 6 seconds for 72 hours after admission, and 5-minute means of systolic blood pressure (SBP) were recorded. We calculated SBP as pressure × time dose (PTD) to describe the cumulative amplitude and duration of episodes above and below clinical thresholds. The extent and duration of the insults were calculated as percent time (%time), PTD, and PTD per day (PTD/D) of defined thresholds (SBP: 100 bpm and >120 bpm; and SpO(2): GOSE by receiver operator characteristics. Mean age was 33.9 (range, 16-83) years, mean admission Glasgow Coma Scale score 6.4 ± 3, and mean head Abbreviated Injury Scale score 4.2 ± 0.72. The 30-day mortality rate was 13.3%. Of the 45 patients in whom GOSE at 12 months was available, 28 (62%) had good neurologic outcomes (GOSE score >4). Traditional markers of poor outcome (admission SBP, admission Glasgow Coma Scale, and Marshall score) were not different between groups with good or poor outcome. PTD, PTD/D, and %time SBP GOSE (p = 0.02). PTD/D SBP GOSE (p < 0.05). Within the first 48 hours of intensive care unit admission, hypotension was found to be predictive of mortality and functional outcomes at higher thresholds than traditionally defined. Systemic blood pressure targets closer to 120 mm Hg may be more efficacious in minimizing secondary insults and particularly useful in settings without invasive intracranial monitoring
International Nuclear Information System (INIS)
Cook, J.R.
1981-03-01
This abbreviated data report presents results of ground water and stream sediment reconnaissance in the National Topographic Map Series (NTMS) Lake Champlain 1 0 x 2 0 quadrangle. Surface sediment samples were collected at 1196 sites. Ground-water samples were collected at 619 sites. Neutron activation analysis (NAA) results are given for uranium and 16 other elements in sediments, for uranium and 8 other elements in ground water, and for uranium and 9 other elements in surface water. Field measurements and observations are reported for each site. Analytical data and field measurements are presented in tables and maps. Data from ground-water sites include (1) water chemistry measurements (pH, conductivity, and alkalinity), (2) physical measurements where applicable (water temperature, well description, etc.), and (3) elemental analyses (U, Al, Br, Cl, Dy, F, Mn, Na, and V). Data from sediment sites include (1) stream water chemistry measurements (pH, conductivity, and alkalinity), and (2) elemental analyses for sediment samples (U, Th, Hf, Al, Ce, Dy, Eu, Fe, La, Lu, Mn, Sc, Sm, Na, Ti, V, and Yb). Sample site descriptors (stream characteristics, vegetation, etc.) are also tabulated. A real distribution maps, histograms, and cumulative frequency plots for most elements and for U/Th and U/Hf ratios are included. Key data from stream water sites include (1) water quality measurements (pH, conductivity, and alkalinity) and (2) elemental analyses (U, Al, Br, Cl, Dy, F, Mg, Mg, Na, and V). Uranium concentrations in the sediments range from 0.30 to 43.40 ppM with a mean of 3.03 ppM. A cluster of high log (U/Th+Hf) ratios appear in the southeastern portion of the quadrangle. The U x 1000/conductivity ratio in surface water is high in this same area
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-06-01
This document is a master list of acronyms and other abbreviations that are used by or could be useful to, the personnel at Los Alamos National Laboratory. Many specialized and well-known abbreviations are not included in this list.
Energy tax in the Netherlands replaces REB and BSB
International Nuclear Information System (INIS)
Koevoet, H.
2004-01-01
The structure of energy taxes in the Netherlands has been changed January 1, 2004. The so-called Regulating Energy Levy (REB, abbreviated in Dutch) and the Fuel Tax (BSB, abbreviated in Dutch) are merged into the Energy Tax [nl
Do depressive traits and hostility predict age-related decline in general intelligence?
DEFF Research Database (Denmark)
Mortensen, Erik Lykke; Barefoot, John Calvin; Avlund, Kirsten
2012-01-01
on decline in general intelligence over a 30-year period. The Minnesota Multiphasic Personality Inventory was administered at a 50-year baseline exam, and from this inventory the Obvious Depression Scale and an abbreviated version of the Cook-Medley Hostility Scale were derived. At the 50-year baseline...... and at the 60-, 70-, and 80-year followups the full version of Wechsler's Adult Intelligence Scale (WAIS) was administered to 673, 513, 136, and 184 participants. Mixed effects statistical models were used to evaluate both the effect of the personality scores on level of intelligence and the interaction between...... the personality scores and the time since followup. Analyses were adjusted for demographic background and a wide range of lifestyle factors. Both obvious depression and hostility were negatively associated with level of intelligence, but personality scores did not influence rate of decline in general intelligence....
Scaling Effects on Materials Tribology: From Macro to Micro Scale.
Stoyanov, Pantcho; Chromik, Richard R
2017-05-18
The tribological study of materials inherently involves the interaction of surface asperities at the micro to nanoscopic length scales. This is the case for large scale engineering applications with sliding contacts, where the real area of contact is made up of small contacting asperities that make up only a fraction of the apparent area of contact. This is why researchers have sought to create idealized experiments of single asperity contacts in the field of nanotribology. At the same time, small scale engineering structures known as micro- and nano-electromechanical systems (MEMS and NEMS) have been developed, where the apparent area of contact approaches the length scale of the asperities, meaning the real area of contact for these devices may be only a few asperities. This is essentially the field of microtribology, where the contact size and/or forces involved have pushed the nature of the interaction between two surfaces towards the regime where the scale of the interaction approaches that of the natural length scale of the features on the surface. This paper provides a review of microtribology with the purpose to understand how tribological processes are different at the smaller length scales compared to macrotribology. Studies of the interfacial phenomena at the macroscopic length scales (e.g., using in situ tribometry) will be discussed and correlated with new findings and methodologies at the micro-length scale.
DEFF Research Database (Denmark)
Høyrup, Jens
From the early fourteenth century onward, some Italian Abbacus manuscripts begin to use particular abbreviations for algebraic operations and objects and, to be distinguished from that, examples of symbolic operation. The algebraic abbreviations and symbolic operations we find in German Rechenmei...
Nuclear Regulatory Authority of the Slovak Republic. Annual Report 1999
International Nuclear Information System (INIS)
Seliga, M.
2000-01-01
A brief account of activities carried out by the Nuclear Regulatory Authority of the Slovak Republic in 1999 is presented. These activities are reported under the headings: (1) Foreword; (2) Mission of the Nuclear Regulatory Authority; (3) Legislation; (4) Assessment and inspection of safety at nuclear installations; (4) Safety analyses; (5) Nuclear materials; (6) Radioactive waste; (7) Quality assurance; (8) Personnel qualification and training; (9) Emergency preparedness; (10) International co-operation; (11) Public information; (12) Conclusions; (13) Appendices: Economic and personnel data; Abbreviations; The International nuclear event scales - INES
Pro Oracle database 11g RAC on Linux
Shaw, Steve
2010-01-01
Pro Oracle Database 11g RAC on Linux provides full-life-cycle guidance on implementing Oracle Real Application Clusters in a Linux environment. Real Application Clusters, commonly abbreviated as RAC, is Oracle's industry-leading architecture for scalable and fault-tolerant databases. RAC allows you to scale up and down by simply adding and subtracting inexpensive Linux servers. Redundancy provided by those multiple, inexpensive servers is the basis for the failover and other fault-tolerance features that RAC provides. Written by authors well-known for their talent with RAC, Pro Oracle Database
Bench-scale/field-scale interpretations: Session overview
International Nuclear Information System (INIS)
Cunningham, A.B.; Peyton, B.M.
1995-04-01
In situ bioremediation involves complex interactions between biological, chemical, and physical processes and requires integration of phenomena operating at scales ranging from that of a microbial cell (10 -6 ) to that of a remediation site (10 to 1000 m). Laboratory investigations of biodegradation are usually performed at a relatively small scale, governed by convenience, cost, and expedience. However, extending the results from a laboratory-scale experimental system to the design and operation of a field-scale system introduces (1) additional mass transport mechanisms and limitations; (2) the presence of multiple phases, contants, and competing microorganisms (3) spatial geologic heterogeneities; and (4) subsurface environmental factors that may inhibit bacterial growth such as temperature, pH, nutrient, or redox conditions. Field bioremediation rates may be limited by the availability of one of the necessary constituents for biotransformation: substrate, contaminant, electron acceptor, nutrients, or microorganisms capable of degrading the target compound. The factor that limits the rate of bioremediation may not be the same in the laboratory as it is in the field, thereby leading, to development of unsuccessful remediation strategies
2012-02-15
... reference product for the purpose of submitting a marketing application through an abbreviated licensure... submitting a marketing application through the abbreviated licensure pathway under section 351(k) of the... FDA will use to review applications for biosimilar products; and General scientific principles in...
2013-02-21
... Gas Company d/b/a Dominion East Ohio; Dominion Transmission, Inc.; Notice of Abbreviated Application for Limited Amendment to Certificate of Public Convenience and Necessity On February 11, 2013, The...''), filed an abbreviated application for limited amendment to certificate of public convenience and...
Development of a Short Version of the Thyroid-Related Patient-Reported Outcome ThyPRO
DEFF Research Database (Denmark)
Watt, Torquil; Bjorner, Jakob Bue; Groenvold, Mogens
2015-01-01
BACKGROUND: Thyroid diseases affect quality of life (QoL). The Thyroid-Related Patient-Reported Outcome (ThyPRO) is an international comprehensive well-validated patient-reported outcome, measuring thyroid-related QoL. The current version is rather long-85 items. The purpose of the present study...... was to develop an abbreviated version of the ThyPRO, with conserved good measurement properties. METHODS: A cross-sectional (N = 907) and a longitudinal sample (N = 435) of thyroid patients were analyzed. A graded item response theory (IRT) model was fitted to the cross-sectional data. Short-form scales.......89-0.98), and the mean scale levels were similar. CONCLUSIONS: A 39-item version of the ThyPRO, with good measurement properties, was developed and is recommended for clinical use....
Efficacy of chess training for the treatment of ADHD: A prospective, open label study.
Blasco-Fontecilla, Hilario; Gonzalez-Perez, Marisa; Garcia-Lopez, Raquel; Poza-Cano, Belen; Perez-Moreno, Maria Rosario; de Leon-Martinez, Victoria; Otero-Perez, Jose
2016-01-01
To examine the effectiveness of playing chess as a treatment option for children with ADHD. Parents of 44 children ages 6 to 17 with a primary diagnosis of ADHD consented to take part in the study. Parents completed the Spanish version of the Swanson, Nolan and Pelham Scale for parents (SNAP-IV) and the Abbreviated Conner's Rating Scales for parents (CPRS-HI) prior to an 11-week chess-training program. We used a paired t-test to compare pre- and post-intervention outcomes, and Cohen-d calculations to measure the magnitude of the effect. The statistical significance was set at Pchess could be included within the multimodal treatment of ADHD. Copyright © 2014 SEP y SEPB. Published by Elsevier España. All rights reserved.
Examining the role of interrogative suggestibility in Miranda rights comprehension in adolescents.
McLachlan, Kaitlyn; Roesch, Ronald; Douglas, Kevin S
2011-06-01
This study aimed to further clarify the association between interrogative suggestibility and Miranda rights comprehension in adolescents; in particular, we examined whether intellectual ability (IQ) serves as a mediator of this relationship. Participants completed Grisso's Miranda Instruments, the Wechsler Abbreviated Scale of Intelligence, and the Gudjonsson Suggestibility Scale. Many youth demonstrated poor comprehension of their rights, particularly younger and less intellectually capable adolescents. Both yield and shift components of interrogative suggestibility were inversely related to rights comprehension; however, IQ fully mediated these relationships. Neither demographic variables (gender, ethnicity, socio-economic status after controlling for IQ, and English as a second language (ESL) status) nor previous police experience were significantly associated with rights comprehension in the present sample. The implications of these findings are discussed.
The importance of macro- versus microstructure in modulating light levels inside coral colonies
DEFF Research Database (Denmark)
Kaniewska, Paulina; Magnusson, Sveinn H.; Anthony, Ken R. N.
2011-01-01
Adjusting the light exposure and capture of their symbiotic photosynthetic dinoflagellates (genus Symbiodinium Freud.) is central to the success of reef-building corals (order Scleractinia) across high spatio-temporal variation in the light environment of coral reefs. We tested the hypothesis...... irradiances at the level of coral photosymbionts. Key index words: irradiance; morphology; photoacclimation; scale; scleractinian coral; Symbiodinium Abbreviations: a chl a, specific absorption coefficient of chl a; Ddn, diadinoxanthin; Dtn, diatoxanthin; GBR, Great Barrier Reef; GFP, green fluorescent...... that optical properties of tissues in some coral species can provide light management at the tissue scale comparable to light modulation by colony architecture in other species. We compared within-tissue scalar irradiance in two coral species from the same light habitat but with contrasting colony growth forms...
Directory of Open Access Journals (Sweden)
Mary M. Boggiano
2015-06-01
Full Text Available Highly palatable foods play a salient role in obesity and binge-eating, and if habitually eaten to deal with intrinsic and extrinsic factors unrelated to metabolic need, may compromise adaptive coping and interpersonal skills. This study used event sampling methodology (ESM to examine whether individuals who report eating palatable foods primarily to cope, to enhance reward, to be social, or to conform, as measured by the Palatable Eating Motives Scale (PEMS, actually eat these foods primarily for the motive(s they report on the PEMS. Secondly this study examined if the previously reported ability of the PEMS Coping motive to predict BMI would replicate if the real-time (ESM-reported coping motive was used to predict BMI. A total of 1691 palatable eating events were collected from 169 college students over 4 days. Each event included the day, time, and types of tasty foods or drinks consumed followed by a survey that included an abbreviated version of the PEMS, hunger as an additional possible motive, and a question assessing general perceived stress during the eating event. Two-level mixed modeling confirmed that ESM-reported motives correlated most strongly with their respective PEMS motives and that all were negatively associated with eating for hunger. While stress surrounding the eating event was strongly associated with the ESM-coping motive, its inclusion in the model as a predictor of this motive did not abolish the significant association between ESM and PEMS Coping scores. Regression models confirmed that scores on the ESM-coping motive predicted BMI. These findings provide ecological validity for the PEMS to identify true-to-life motives for consuming palatable foods. This further adds to the utility of the PEMS in individualizing, and hence improving, treatment strategies for obesity, binge-eating, dietary nutrition, coping, reward acquisition, and psychosocial skills.
Statistical scaling of pore-scale Lagrangian velocities in natural porous media.
Siena, M; Guadagnini, A; Riva, M; Bijeljic, B; Pereira Nunes, J P; Blunt, M J
2014-08-01
We investigate the scaling behavior of sample statistics of pore-scale Lagrangian velocities in two different rock samples, Bentheimer sandstone and Estaillades limestone. The samples are imaged using x-ray computer tomography with micron-scale resolution. The scaling analysis relies on the study of the way qth-order sample structure functions (statistical moments of order q of absolute increments) of Lagrangian velocities depend on separation distances, or lags, traveled along the mean flow direction. In the sandstone block, sample structure functions of all orders exhibit a power-law scaling within a clearly identifiable intermediate range of lags. Sample structure functions associated with the limestone block display two diverse power-law regimes, which we infer to be related to two overlapping spatially correlated structures. In both rocks and for all orders q, we observe linear relationships between logarithmic structure functions of successive orders at all lags (a phenomenon that is typically known as extended power scaling, or extended self-similarity). The scaling behavior of Lagrangian velocities is compared with the one exhibited by porosity and specific surface area, which constitute two key pore-scale geometric observables. The statistical scaling of the local velocity field reflects the behavior of these geometric observables, with the occurrence of power-law-scaling regimes within the same range of lags for sample structure functions of Lagrangian velocity, porosity, and specific surface area.
International Nuclear Information System (INIS)
B Bello; M Junker
2006-01-01
Hydrogen production by water electrolysis represents nearly 4 % of the world hydrogen production. Future development of hydrogen vehicles will require large quantities of hydrogen. Installation of large scale hydrogen production plants will be needed. In this context, development of low cost large scale electrolysers that could use 'clean power' seems necessary. ALPHEA HYDROGEN, an European network and center of expertise on hydrogen and fuel cells, has performed for its members a study in 2005 to evaluate the potential of large scale electrolysers to produce hydrogen in the future. The different electrolysis technologies were compared. Then, a state of art of the electrolysis modules currently available was made. A review of the large scale electrolysis plants that have been installed in the world was also realized. The main projects related to large scale electrolysis were also listed. Economy of large scale electrolysers has been discussed. The influence of energy prices on the hydrogen production cost by large scale electrolysis was evaluated. (authors)
40 CFR Table 8 to Subpart Kkkkk of... - Applicability of General Provisions to Subpart KKKKK
2010-07-01
... Standard Procedures for getting an alternative standard Yes. § 63.6(h) Opacity/VE Standards Requirements... standard established; permit requirements; extensions, notifications. Yes. § 63.2 Definitions Definitions for part 63 standards Yes. § 63.3 Units and Abbreviations Units and abbreviations for part 63...
Research Article Special Issue
African Journals Online (AJOL)
pc
2018-05-16
May 16, 2018 ... International License. ... Department of Computer Information and Sciences, Universiti Teknologi ... In order to send messages in the fastest way, people tend to use abbreviation or short ... Keywords: Online Chatting, Short forms, Abbreviation. .... news that they have in their social media [7]. .... communities.
2011-03-18
... Abbreviations. The following acronyms and abbreviations are used in this document. APA Administrative Procedure... (XML) format. Development of the reporting tool has involved translating the detailed industry-specific... cause exemption under the Administrative Procedure Act (APA) to take the actions set forth in this final...
Servitization, Services and Managing Complexity
DEFF Research Database (Denmark)
Harjo, Ieva; Frandsen, Thomas; Hsuan, Juliana
This paper explores how seemingly complex servitized solutions can become tradable in a customer–supplier relationship by objectification and abbreviation. The key argument is that the complexity of product-service solutions can be reduced by abbreviation of the reality in written form of contracts...
Psychometric properties of the Positive Mental Health Scale (PMH-scale)
Lukat, J.; Margraf, J.; Lutz, R.; Veld, W.M. van der; Becker, E.S.
2016-01-01
Background: In recent years, it has been increasingly recognized that the absence of mental disorder is not the same as the presence of positive mental health (PMH). With the PMH-scale we propose a short, unidimensional scale for the assessment of positive mental health. The scale consists of 9
International Nuclear Information System (INIS)
Nottale, Laurent
2003-01-01
The principle of relativity, when it is applied to scale transformations, leads to the suggestion of a generalization of fundamental dilations laws. These new special scale-relativistic resolution transformations involve log-Lorentz factors and lead to the occurrence of a minimal and of a maximal length-scale in nature, which are invariant under dilations. The minimal length-scale, that replaces the zero from the viewpoint of its physical properties, is identified with the Planck length l P , and the maximal scale, that replaces infinity, is identified with the cosmic scale L=Λ -1/2 , where Λ is the cosmological constant.The new interpretation of the Planck scale has several implications for the structure and history of the early Universe: we consider the questions of the origin, of the status of physical laws at very early times, of the horizon/causality problem and of fluctuations at recombination epoch.The new interpretation of the cosmic scale has consequences for our knowledge of the present universe, concerning in particular Mach's principle, the large number coincidence, the problem of the vacuum energy density, the nature and the value of the cosmological constant. The value (theoretically predicted ten years ago) of the scaled cosmological constant Ω Λ =0.75+/-0.15 is now supported by several different experiments (Hubble diagram of Supernovae, Boomerang measurements, gravitational lensing by clusters of galaxies).The scale-relativity framework also allows one to suggest a solution to the missing mass problem, and to make theoretical predictions of fundamental energy scales, thanks to the interpretation of new structures in scale space: fractal/classical transitions as Compton lengths, mass-coupling relations and critical value 4π 2 of inverse couplings. Among them, we find a structure at 3.27+/-0.26x10 20 eV, which agrees closely with the observed highest energy cosmic rays at 3.2+/-0.9x10 20 eV, and another at 5.3x10 -3 eV, which corresponds to the
Weisbord, Steven D; Mor, Maria K; Sevick, Mary Ann; Shields, Anne Marie; Rollman, Bruce L; Palevsky, Paul M; Arnold, Robert M; Green, Jamie A; Fine, Michael J
2014-09-05
Depressive symptoms and pain are common in patients receiving chronic hemodialysis, yet their effect on dialysis adherence, health resource utilization, and mortality is not fully understood. This study sought to characterize the longitudinal associations of these symptoms with dialysis adherence, emergency department (ED) visits, hospitalizations, and mortality. As part of a trial comparing symptom management strategies in patients receiving chronic hemodialysis, this study prospectively assessed depressive symptoms using the Patient Health Questionnaire 9, and pain using the Short-Form McGill Pain Questionnaire, monthly between 2009 and 2011. This study used negative binomial, Poisson, and proportional hazards regression to analyze the longitudinal associations of depressive symptoms and pain, scaled based on 5-point increments in symptom scores, with missed and abbreviated hemodialysis treatments, ED visits, hospitalizations, and mortality, respectively. Among 286 patients, moderate-to-severe depressive symptoms were identified on 788 of 4452 (18%) assessments and pain was reported on 3537 of 4459 (79%) assessments. Depressive symptoms were independently associated with missed (incident rate ratio [IRR], 1.21; 95% confidence interval [95% CI], 1.10 to 1.33) and abbreviated (IRR, 1.08; 95% CI, 1.03 to 1.14) hemodialysis treatments, ED visits (IRR, 1.24; 95% CI, 1.12 to 1.37), hospitalizations (IRR, 1.19; 95% CI, 1.10 to 1.30), and mortality (IRR, 1.40; 95% CI, 1.11 to 1.77). Pain was independently associated with abbreviated hemodialysis treatments (IRR, 1.03; 95% CI, 1.01 to 1.06) and hospitalizations (IRR, 1.05; 95% CI, 1.00 to 1.10). Severe pain was independently associated with abbreviated hemodialysis treatments (IRR, 1.16; 95% CI, 1.06 to 1.28), ED visits (IRR, 1.58; 95% CI, 1.28 to 1.94), and hospitalizations (IRR, 1.22; 95% CI, 1.03 to 1.45), but not mortality (hazard ratio, 1.71; 95% CI, 0.81 to 2.96). Depressive symptoms and pain are independently
SCALE INTERACTION IN A MIXING LAYER. THE ROLE OF THE LARGE-SCALE GRADIENTS
Fiscaletti, Daniele
2015-08-23
The interaction between scales is investigated in a turbulent mixing layer. The large-scale amplitude modulation of the small scales already observed in other works depends on the crosswise location. Large-scale positive fluctuations correlate with a stronger activity of the small scales on the low speed-side of the mixing layer, and a reduced activity on the high speed-side. However, from physical considerations we would expect the scales to interact in a qualitatively similar way within the flow and across different turbulent flows. Therefore, instead of the large-scale fluctuations, the large-scale gradients modulation of the small scales has been additionally investigated.
Directory of Open Access Journals (Sweden)
Ronald L Breiger
2015-11-01
Full Text Available While “scaling up” is a lively topic in network science and Big Data analysis today, my purpose in this essay is to articulate an alternative problem, that of “scaling down,” which I believe will also require increased attention in coming years. “Scaling down” is the problem of how macro-level features of Big Data affect, shape, and evoke lower-level features and processes. I identify four aspects of this problem: the extent to which findings from studies of Facebook and other Big-Data platforms apply to human behavior at the scale of church suppers and department politics where we spend much of our lives; the extent to which the mathematics of scaling might be consistent with behavioral principles, moving beyond a “universal” theory of networks to the study of variation within and between networks; and how a large social field, including its history and culture, shapes the typical representations, interactions, and strategies at local levels in a text or social network.
Energy Technology Data Exchange (ETDEWEB)
Lario, J.; Bardaji, T.; Silva, P.G.; Zazo, C.; Goy, J.L.
2016-07-01
This paper discusses possibilities to improve the Environmental Seismic Intensity Scale (ESI-07 scale), a scale based on the effects of earthquakes in the environment. This scale comprises twelve intensity degrees and considers primary and secondary effects, one of them the occurrence of tsunamis. Terminology and physical tsunami parameters corresponding to different intensity levels are often misleading and confusing. The present work proposes: i) a revised and updated catalogue of environmental and geological effects of tsunamis, gathering all the available information on Tsunami Environmental Effects (TEEs) produced by recent earthquake-tsunamis; ii) a specific intensity scale (TEE-16) for the effects of tsunamis in the natural environment at coastal areas. The proposed scale could be used in future tsunami events and, in historic and paleo-tsunami studies. The new TEE- 16 scale incorporates the size specific parameters already considered in the ESI-07 scale, such as wave height, run-up and inland extension of inundation, and a comprehensive and more accurate terminology that covers all the different intensity levels identifiable in the geological record (intensities VI-XII). The TEE-16 scale integrates the description and quantification of the potential sedimentary and erosional features (beach scours, transported boulders and classical tsunamites) derived from different tsunami events at diverse coastal environments (e.g. beaches, estuaries, rocky cliffs,). This new approach represents an innovative advance in relation to the tsunami descriptions provided by the ESI-07 scale, and allows the full application of the proposed scale in paleoseismological studies. The analysis of the revised and updated tsunami environmental damage suggests that local intensities recorded in coastal areas do not correlate well with the TEE-16 intensity (normally higher), but shows a good correlation with the earthquake magnitude (Mw). Tsunamis generated by earthquakes can then be
2010-07-01
... COMMUNITY RIGHT-TO-KNOW PROGRAMS NATIONAL OIL AND HAZARDOUS SUBSTANCES POLLUTION CONTINGENCY PLAN... Substances and Disease Registry CDC—Centers for Disease Control DOC—Department of Commerce DOD—Department of... and Atmospheric Administration OSHA—Occupational Health and Safety Administration RSPA—Research and...
2010-01-01
... 103-354. (l) LFAC—Local Food and Agriculture Council. (m) NASS—State Statistical Office of the USDA National Agricultural Statistics Service. (n) OMB—Office of Management and Budget. (o) SBA—Small Business... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE...
Psychometric Properties of a Social Abilities Evaluation Scale: C-scale
Directory of Open Access Journals (Sweden)
María José Rabazo Méndez
2004-11-01
Full Text Available In this paper the psychometric data of a scale of evaluation of the social abilities (social expression and motor skills are presented. The scale was constructed to investigate social competence and antisocial conduct in adolescence. The process of the scale’s construction is explained; and the data on its internal consistency, its test-retest reliability, and its concurrent validity are presented. The scale was filled out by 325 teachers from different schools in the city of Badajoz (Spain; however, 20 scales were rejected because they were not properly completed. As well, the scale was analyzed, giving as a result 9 factors that explain 59.4% of the total variance. With the results obtained, the position of situational specificity with regard to social abilities is supported.
The Menopause Rating Scale (MRS scale: A methodological review
Directory of Open Access Journals (Sweden)
Strelow Frank
2004-09-01
Full Text Available Abstract Background This paper compiles data from different sources to get a first comprehensive picture of psychometric and other methodological characteristics of the Menopause Rating Scale (MRS scale. The scale was designed and standardized as a self-administered scale to (a to assess symptoms/complaints of aging women under different conditions, (b to evaluate the severity of symptoms over time, and (c to measure changes pre- and postmenopause replacement therapy. The scale became widespread used (available in 10 languages. Method A large multinational survey (9 countries in 4 continents from 2001/ 2002 is the basis for in depth analyses on reliability and validity of the MRS. Additional small convenience samples were used to get first impressions about test-retest reliability. The data were centrally analyzed. Data from a postmarketing HRT study were used to estimate discriminative validity. Results Reliability measures (consistency and test-retest stability were found to be good across countries, although the sample size for test-retest reliability was small. Validity: The internal structure of the MRS across countries was astonishingly similar to conclude that the scale really measures the same phenomenon in symptomatic women. The sub-scores and total score correlations were high (0.7–0.9 but lower among the sub-scales (0.5–0.7. This however suggests that the subscales are not fully independent. Norm values from different populations were presented showing that a direct comparison between Europe and North America is possible, but caution recommended with comparisons of data from Latin America and Indonesia. But this will not affect intra-individual comparisons within clinical trials. The comparison with the Kupperman Index showed sufficiently good correlations, illustrating an adept criterion-oriented validity. The same is true for the comparison with the generic quality-of-life scale SF-36 where also a sufficiently close association
40 CFR Table 7 to Subpart Jjjjj of... - Applicability of General Provisions to Subpart JJJJJ
2010-07-01
... Standard Procedures for getting an alternative standard Yes. § 63.6(h) Opacity/VE Standards Requirements...; applicability after standard established; permit requirements; extensions, notifications Yes. § 63.2 Definitions Definitions for part 63 standards Yes. § 63.3 Units and Abbreviations Units and abbreviations for part 63...
40 CFR Table 10 to Subpart Uuuu of... - Applicability of General Provisions to Subpart UUUU
2010-07-01
.... § 63.6(g)(1) through (3) Alternative Standard Procedures for getting an alternative standard Yes. § 63... standard established; permit requirements; extensions, notifications Yes. § 63.2 Definitions Definitions for part 63 standards Yes. § 63.3 Units and Abbreviations Units and abbreviations for part 63...
2013-10-03
... Processing Manual (CMS Publication 100- 04) was inadvertently abbreviated incorrectly. On page 47963, in our... Benefit Policy Manual (CMS Publication 100-02) was inadvertently abbreviated incorrectly. B. Summary of... provisions of a rule take effect in accordance with section 553(b) of the Administrative Procedure Act (APA...
Scaling and scale invariance of conservation laws in Reynolds transport theorem framework
Haltas, Ismail; Ulusoy, Suleyman
2015-07-01
Scale invariance is the case where the solution of a physical process at a specified time-space scale can be linearly related to the solution of the processes at another time-space scale. Recent studies investigated the scale invariance conditions of hydrodynamic processes by applying the one-parameter Lie scaling transformations to the governing equations of the processes. Scale invariance of a physical process is usually achieved under certain conditions on the scaling ratios of the variables and parameters involved in the process. The foundational axioms of hydrodynamics are the conservation laws, namely, conservation of mass, conservation of linear momentum, and conservation of energy from continuum mechanics. They are formulated using the Reynolds transport theorem. Conventionally, Reynolds transport theorem formulates the conservation equations in integral form. Yet, differential form of the conservation equations can also be derived for an infinitesimal control volume. In the formulation of the governing equation of a process, one or more than one of the conservation laws and, some times, a constitutive relation are combined together. Differential forms of the conservation equations are used in the governing partial differential equation of the processes. Therefore, differential conservation equations constitute the fundamentals of the governing equations of the hydrodynamic processes. Applying the one-parameter Lie scaling transformation to the conservation laws in the Reynolds transport theorem framework instead of applying to the governing partial differential equations may lead to more fundamental conclusions on the scaling and scale invariance of the hydrodynamic processes. This study will investigate the scaling behavior and scale invariance conditions of the hydrodynamic processes by applying the one-parameter Lie scaling transformation to the conservation laws in the Reynolds transport theorem framework.
Arabian, Sandra S; Marcus, Michael; Captain, Kevin; Pomphrey, Michelle; Breeze, Janis; Wolfe, Jennefer; Bugaev, Nikolay; Rabinovici, Reuven
2015-09-01
Analyses of data aggregated in state and national trauma registries provide the platform for clinical, research, development, and quality improvement efforts in trauma systems. However, the interhospital variability and accuracy in data abstraction and coding have not yet been directly evaluated. This multi-institutional, Web-based, anonymous study examines interhospital variability and accuracy in data coding and scoring by registrars. Eighty-two American College of Surgeons (ACS)/state-verified Level I and II trauma centers were invited to determine different data elements including diagnostic, procedure, and Abbreviated Injury Scale (AIS) coding as well as selected National Trauma Data Bank definitions for the same fictitious case. Variability and accuracy in data entries were assessed by the maximal percent agreement among the registrars for the tested data elements, and 95% confidence intervals were computed to compare this level of agreement to the ideal value of 100%. Variability and accuracy in all elements were compared (χ testing) based on Trauma Quality Improvement Program (TQIP) membership, level of trauma center, ACS verification, and registrar's certifications. Fifty registrars (61%) completed the survey. The overall accuracy for all tested elements was 64%. Variability was noted in all examined parameters except for the place of occurrence code in all groups and the lower extremity AIS code in Level II trauma centers and in the Certified Specialist in Trauma Registry- and Certified Abbreviated Injury Scale Specialist-certified registrar groups. No differences in variability were noted when groups were compared based on TQIP membership, level of center, ACS verification, and registrar's certifications, except for prehospital Glasgow Coma Scale (GCS), where TQIP respondents agreed more than non-TQIP centers (p = 0.004). There is variability and inaccuracy in interhospital data coding and scoring of injury information. This finding casts doubt on the
Salzburger State Reactance Scale (SSR Scale): Validation of a Scale Measuring State Reactance.
Sittenthaler, Sandra; Traut-Mattausch, Eva; Steindl, Christina; Jonas, Eva
This paper describes the construction and empirical evaluation of an instrument for measuring state reactance, the Salzburger State Reactance (SSR) Scale. The results of a confirmatory factor analysis supported a hypothesized three-factor structure: experience of reactance, aggressive behavioral intentions, and negative attitudes. Correlations with divergent and convergent measures support the validity of this structure. The SSR Subscales were strongly related to the other state reactance measures. Moreover, the SSR Subscales showed modest positive correlations with trait measures of reactance. The SSR Subscales correlated only slightly or not at all with neighboring constructs (e.g., autonomy, experience of control). The only exception was fairness scales, which showed moderate correlations with the SSR Subscales. Furthermore, a retest analysis confirmed the temporal stability of the scale. Suggestions for further validation of this questionnaire are discussed.
Phenomenology of local scale invariance: from conformal invariance to dynamical scaling
International Nuclear Information System (INIS)
Henkel, Malte
2002-01-01
Statistical systems displaying a strongly anisotropic or dynamical scaling behaviour are characterized by an anisotropy exponent θ or a dynamical exponent z. For a given value of θ (or z), we construct local scale transformations, which can be viewed as scale transformations with a space-time-dependent dilatation factor. Two distinct types of local scale transformations are found. The first type may describe strongly anisotropic scaling of static systems with a given value of θ, whereas the second type may describe dynamical scaling with a dynamical exponent z. Local scale transformations act as a dynamical symmetry group of certain non-local free-field theories. Known special cases of local scale invariance are conformal invariance for θ=1 and Schroedinger invariance for θ=2. The hypothesis of local scale invariance implies that two-point functions of quasi primary operators satisfy certain linear fractional differential equations, which are constructed from commuting fractional derivatives. The explicit solution of these yields exact expressions for two-point correlators at equilibrium and for two-point response functions out of equilibrium. A particularly simple and general form is found for the two-time auto response function. These predictions are explicitly confirmed at the uniaxial Lifshitz points in the ANNNI and ANNNS models and in the aging behaviour of simple ferromagnets such as the kinetic Glauber-Ising model and the kinetic spherical model with a non-conserved order parameter undergoing either phase-ordering kinetics or non-equilibrium critical dynamics
Estimating returns to scale and scale efficiency for energy consuming appliances
Energy Technology Data Exchange (ETDEWEB)
Blum, Helcio [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Energy Efficiency Standards Group; Okwelum, Edson O. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Energy Efficiency Standards Group
2018-01-18
Energy consuming appliances accounted for over 40% of the energy use and $17 billion in sales in the U.S. in 2014. Whether such amounts of money and energy were optimally combined to produce household energy services is not straightforwardly determined. The efficient allocation of capital and energy to provide an energy service has been previously approached, and solved with Data Envelopment Analysis (DEA) under constant returns to scale. That approach, however, lacks the scale dimension of the problem and may restrict the economic efficient models of an appliance available in the market when constant returns to scale does not hold. We expand on that approach to estimate returns to scale for energy using appliances. We further calculate DEA scale efficiency scores for the technically efficient models that comprise the economic efficient frontier of the energy service delivered, under different assumptions of returns to scale. We then apply this approach to evaluate dishwashers available in the market in the U.S. Our results show that (a) for the case of dishwashers scale matters, and (b) the dishwashing energy service is delivered under non-decreasing returns to scale. The results further demonstrate that this method contributes to increase consumers’ choice of appliances.
The Chinese version of the Myocardial Infarction Dimensional Assessment Scale (MIDAS: Mokken scaling
Directory of Open Access Journals (Sweden)
Watson Roger
2012-01-01
Full Text Available Abstract Background Hierarchical scales are very useful in clinical practice due to their ability to discriminate precisely between individuals, and the original English version of the Myocardial Infarction Dimensional Assessment Scale has been shown to contain a hierarchy of items. The purpose of this study was to analyse a Mandarin Chinese translation of the Myocardial Infarction Dimensional Assessment Scale for a hierarchy of items according to the criteria of Mokken scaling. Data from 180 Chinese participants who completed the Chinese translation of the Myocardial Infarction Dimensional Assessment Scale were analysed using the Mokken Scaling Procedure and the 'R' statistical programme using the diagnostics available in these programmes. Correlation between Mandarin Chinese items and a Chinese translation of the Short Form (36 Health Survey was also analysed. Findings Fifteen items from the Mandarin Chinese Myocardial Infarction Dimensional Assessment Scale were retained in a strong and reliable Mokken scale; invariant item ordering was not evident and the Mokken scaled items of the Chinese Myocardial Infarction Dimensional Assessment Scale correlated with the Short Form (36 Health Survey. Conclusions Items from the Mandarin Chinese Myocardial Infarction Dimensional Assessment Scale form a Mokken scale and this offers further insight into how the items of the Myocardial Infarction Dimensional Assessment Scale relate to the measurement of health-related quality of life people with a myocardial infarction.
40 CFR Table 12 to Subpart Eeee of... - Applicability of General Provisions to Subpart EEEE
2010-07-01
... maintenance plans, records, inspection Yes. § 63.6(g)(1)-(3) Alternative Standard Procedures for getting an...; Permit requirements; Extensions, Notifications Yes. § 63.2 Definitions Definitions for part 63 standards Yes. § 63.3 Units and Abbreviations Units and abbreviations for part 63 standards Yes. § 63.4...
40 CFR Table 3 to Subpart Ggggg of... - Applicability of General Provisions to Subpart GGGGG
2010-07-01
... maintenance plans, records, inspection Yes. § 63.6(g)(1)-(3) Alternative Standard Procedures for getting an...; Permit Requirements; Extensions, Notifications Yes. § 63.2 Definitions Definitions for part 63 standards Yes. § 63.3 Units and Abbreviations Units and abbreviations for part 63 standards Yes. § 63.4...
40 CFR Table 7 to Subpart Lllll of... - Applicability of General Provisions to Subpart LLLLL
2010-07-01
..., inspection Yes. § 63.6(g)(1)-(3) Alternative Nonopacity Standard Procedures for getting an alternative... Established; Permit Requirements; Extensions, Notifications Yes. § 63.2 Definitions Definitions for part 63 standards Yes. § 63.3 Units and Abbreviations Units and abbreviations for part 63 standards Yes. § 63.4...
Padt, F.J.G.; Arts, B.J.M.
2014-01-01
This chapter provides some clarity to the scale debate. It bridges a variety of approaches, definitions and jargons used in various disciplines in order to provide common ground for a concept of scale as a basis for scale-sensitive governance of the environment. The chapter introduces the concept of
Riley, W. J.; Dwivedi, D.; Ghimire, B.; Hoffman, F. M.; Pau, G. S. H.; Randerson, J. T.; Shen, C.; Tang, J.; Zhu, Q.
2015-12-01
Numerical model representations of decadal- to centennial-scale soil-carbon dynamics are a dominant cause of uncertainty in climate change predictions. Recent attempts by some Earth System Model (ESM) teams to integrate previously unrepresented soil processes (e.g., explicit microbial processes, abiotic interactions with mineral surfaces, vertical transport), poor performance of many ESM land models against large-scale and experimental manipulation observations, and complexities associated with spatial heterogeneity highlight the nascent nature of our community's ability to accurately predict future soil carbon dynamics. I will present recent work from our group to develop a modeling framework to integrate pore-, column-, watershed-, and global-scale soil process representations into an ESM (ACME), and apply the International Land Model Benchmarking (ILAMB) package for evaluation. At the column scale and across a wide range of sites, observed depth-resolved carbon stocks and their 14C derived turnover times can be explained by a model with explicit representation of two microbial populations, a simple representation of mineralogy, and vertical transport. Integrating soil and plant dynamics requires a 'process-scaling' approach, since all aspects of the multi-nutrient system cannot be explicitly resolved at ESM scales. I will show that one approach, the Equilibrium Chemistry Approximation, improves predictions of forest nitrogen and phosphorus experimental manipulations and leads to very different global soil carbon predictions. Translating model representations from the site- to ESM-scale requires a spatial scaling approach that either explicitly resolves the relevant processes, or more practically, accounts for fine-resolution dynamics at coarser scales. To that end, I will present recent watershed-scale modeling work that applies reduced order model methods to accurately scale fine-resolution soil carbon dynamics to coarse-resolution simulations. Finally, we
Anand, Rahul J; Whelan, James F; Ferrada, Paula; Duane, Therese M; Malhotra, Ajai K; Aboutanos, Michel B; Ivatury, Rao R
2012-04-01
The factors contributing to the development of pneumothorax after removal of chest tube thoracostomy are not fully understood. We hypothesized that development of post pull pneumothorax (PPP) after chest tube removal would be significantly lower in those patients with thicker chest walls, due to the "protective" layer of adipose tissue. All patients on our trauma service who underwent chest tube thoracostomy from July 2010 to February 2011 were retrospectively reviewed. Patient age, mechanism of trauma, and chest Abbreviated Injury Scale score were analyzed. Thoracic CTs were reviewed to ascertain chest wall thickness (CW). Thickness was measured at the level of the nipple at the midaxillary line, as perpendicular distance between skin and pleural cavity. Chest X-ray reports from immediately prior and after chest tube removal were reviewed for interval development of PPP. Data are presented as average ± standard deviation. Ninety-one chest tubes were inserted into 81 patients. Patients who died before chest tube removal (n = 11), or those without thoracic CT scans (n = 13) were excluded. PPP occurred in 29.9 per cent of chest tube removals (20/67). When PPP was encountered, repeat chest tube was necessary in 20 per cent of cases (4/20). After univariate analysis, younger age, penetrating mechanism, and thin chest wall were found to be significant risk factors for development of PPP. Chest Abbreviated Injury Scale score was similar in both groups. Logistic regression showed only chest wall thickness to be an independent risk factor for development of PPP.
The academic challenge of teaching psychomotor skills for hemostasis of solid organ injury.
Lucas, Charles E; Ledgerwood, Anna M
2009-03-01
This study highlights the inherent challenges of achieving psychomotor skills in an era of nonoperative therapy for solid organ injuries. Technical procedures on the liver, the most frequent intra-abdominal solid organ injured, were assessed in five decades. Guided by prospective assessment and registry data, all patients with liver injury seen during 24 months in five consecutive decades were reviewed. Initially (1960s), all injuries were explored; currently (2000s), most injuries are observed. The number of patients was 235 (1960s), 228 (1970s), 79 (1980s), 116 (1990s), and 64 (2000s). The greater number in the 1990s reflects the diagnosis of minor, clinically insignificant, blunt injuries after abdominal CAT scan became available. Each injury was categorized by cause, severity (Abbreviated Injury Scale), associated shock, and primary therapy (observe [OBS], operation alone [OR], hepatorrhaphy [SUT], tractotomy [TRACT] with intraparenchymal hemostasis, hepatic dearterialization [HAL], and resection [RESECT]). Packing, used in each decade, was placed in one of the above primary treatment groups. The primary techniques for hemostasis are shown in the text table.Shock and Abbreviated Injury Scale correlated with mortality averaged 16%; 40 of 116 deaths (34%) exsanguinated from hepatic injury. During training, a resident performed an average of 12.0, 12.0, 2.4, 4.0, and 1.3 procedures for hemostasis. Reduced incidence and decreased therapeutic laparotomies for liver injury have created a training vacuum for future trauma surgeons. Surgical residents will need to supplement their clinical experience with solid organ hemostasis by practice on appropriate animal models of injury and cadaver dissections.
Demarzo, Marcelo; Montero-Marin, Jesus; Puebla-Guedea, Marta; Navarro-Gil, Mayte; Herrera-Mercadal, Paola; Moreno-González, Sergio; Calvo-Carrión, Sandra; Bafaluy-Franch, Laura; Garcia-Campayo, Javier
2017-01-01
Background: Many attempts have been made to abbreviate mindfulness programmes in order to make them more accessible for general and clinical populations while maintaining their therapeutic components and efficacy. The aim of this study was to assess the efficacy of an 8-week mindfulness-based intervention (MBI) programme and a 4-week abbreviated version for the improvement of well-being in a non-clinical population. Method: A quasi-experimental, controlled, pilot study was conducted with pre-post and 6-month follow-up measurements and three study conditions (8- and 4-session MBI programmes and a matched no-treatment control group, with a sample of 48, 46, and 47 participants in each condition, respectively). Undergraduate students were recruited, and mindfulness, positive and negative affect, self-compassion, resilience, anxiety, and depression were assessed. Mixed-effects multi-level analyses for repeated measures were performed. Results: The intervention groups showed significant improvements compared to controls in mindfulness and positive affect at the 2- and 6-month follow-ups, with no differences between 8- vs. 4-session programmes. The only difference between the abbreviated MBI vs. the standard MBI was found in self-kindness at 6 months, favoring the standard MBI. There were marginal differences in anxiety between the controls vs. the abbreviated MBI, but there were differences between the controls vs. the standard MBI at 2- and 6-months, with higher levels in the controls. There were no differences in depression between the controls vs. the abbreviated MBI, but differences were found between the controls vs. the standard MBI at 2- and 6-months, favoring the standard MBI. There were no differences with regard to negative affect and resilience. Conclusion: To our knowledge, this is the first study to directly investigate the efficacy of a standard 8-week MBI and a 4-week abbreviated protocol in the same population. Based on our findings, both programmes
Directory of Open Access Journals (Sweden)
Marcelo Demarzo
2017-08-01
Full Text Available Background: Many attempts have been made to abbreviate mindfulness programmes in order to make them more accessible for general and clinical populations while maintaining their therapeutic components and efficacy. The aim of this study was to assess the efficacy of an 8-week mindfulness-based intervention (MBI programme and a 4-week abbreviated version for the improvement of well-being in a non-clinical population.Method: A quasi-experimental, controlled, pilot study was conducted with pre-post and 6-month follow-up measurements and three study conditions (8- and 4-session MBI programmes and a matched no-treatment control group, with a sample of 48, 46, and 47 participants in each condition, respectively. Undergraduate students were recruited, and mindfulness, positive and negative affect, self-compassion, resilience, anxiety, and depression were assessed. Mixed-effects multi-level analyses for repeated measures were performed.Results: The intervention groups showed significant improvements compared to controls in mindfulness and positive affect at the 2- and 6-month follow-ups, with no differences between 8- vs. 4-session programmes. The only difference between the abbreviated MBI vs. the standard MBI was found in self-kindness at 6 months, favoring the standard MBI. There were marginal differences in anxiety between the controls vs. the abbreviated MBI, but there were differences between the controls vs. the standard MBI at 2- and 6-months, with higher levels in the controls. There were no differences in depression between the controls vs. the abbreviated MBI, but differences were found between the controls vs. the standard MBI at 2- and 6-months, favoring the standard MBI. There were no differences with regard to negative affect and resilience.Conclusion: To our knowledge, this is the first study to directly investigate the efficacy of a standard 8-week MBI and a 4-week abbreviated protocol in the same population. Based on our findings, both
Evolution of scaling emergence in large-scale spatial epidemic spreading.
Wang, Lin; Li, Xiang; Zhang, Yi-Qing; Zhang, Yan; Zhang, Kan
2011-01-01
Zipf's law and Heaps' law are two representatives of the scaling concepts, which play a significant role in the study of complexity science. The coexistence of the Zipf's law and the Heaps' law motivates different understandings on the dependence between these two scalings, which has still hardly been clarified. In this article, we observe an evolution process of the scalings: the Zipf's law and the Heaps' law are naturally shaped to coexist at the initial time, while the crossover comes with the emergence of their inconsistency at the larger time before reaching a stable state, where the Heaps' law still exists with the disappearance of strict Zipf's law. Such findings are illustrated with a scenario of large-scale spatial epidemic spreading, and the empirical results of pandemic disease support a universal analysis of the relation between the two laws regardless of the biological details of disease. Employing the United States domestic air transportation and demographic data to construct a metapopulation model for simulating the pandemic spread at the U.S. country level, we uncover that the broad heterogeneity of the infrastructure plays a key role in the evolution of scaling emergence. The analyses of large-scale spatial epidemic spreading help understand the temporal evolution of scalings, indicating the coexistence of the Zipf's law and the Heaps' law depends on the collective dynamics of epidemic processes, and the heterogeneity of epidemic spread indicates the significance of performing targeted containment strategies at the early time of a pandemic disease.
40 CFR Table 10 to Subpart Ddddd... - Applicability of General Provisions to Subpart DDDDD
2010-07-01
... Standard Procedures for getting an alternative standard Yes. § 63.6(h)(1) Compliance with Opacity/VE... Established; Permit Requirements; Extensions, Notifications Yes. § 63.2 Definitions Definitions for part 63 standards Yes. § 63.3 Units and Abbreviations Units and abbreviations for part 63 standards Yes. § 63.4...
40 CFR Table 10 to Subpart Dddd of... - Applicability of General Provisions to Subpart DDDD
2010-07-01
...)-(3) Alternative Standard Procedures for getting an alternative standard Yes. § 63.6(h)(1)-(9) Opacity...; extensions, notifications Yes. § 63.2 Definitions Definitions for part 63 standards Yes. § 63.3 Units and Abbreviations Units and abbreviations for part 63 standards Yes. § 63.4 Prohibited Activities Prohibited...
International Nuclear Information System (INIS)
1990-06-01
This book has introduction of dictionary of machine terms, and a compilation committee and introductory remarks. It gives descriptions of the machine terms in alphabetical order from a to Z and also includes abbreviation of machine terms and symbol table, way to read mathematical symbols and abbreviation and terms of drawings.
46 CFR Sec. 2 - Voyage numbers.
2010-10-01
... voyage No. 1 having the prefixed designation NSA and followed by the General Agents' abbreviated designation and voyage number, as NSA-1/ABC-1. (b) The continuity of NSA voyage numbers shall not change with... General Agent shall affix his abbreviated designation and initial voyage numbers, as NSA-13/XYZ-1. ...
Scaling Techniques for Massive Scale-Free Graphs in Distributed (External) Memory
Pearce, Roger
2013-05-01
We present techniques to process large scale-free graphs in distributed memory. Our aim is to scale to trillions of edges, and our research is targeted at leadership class supercomputers and clusters with local non-volatile memory, e.g., NAND Flash. We apply an edge list partitioning technique, designed to accommodate high-degree vertices (hubs) that create scaling challenges when processing scale-free graphs. In addition to partitioning hubs, we use ghost vertices to represent the hubs to reduce communication hotspots. We present a scaling study with three important graph algorithms: Breadth-First Search (BFS), K-Core decomposition, and Triangle Counting. We also demonstrate scalability on BG/P Intrepid by comparing to best known Graph500 results. We show results on two clusters with local NVRAM storage that are capable of traversing trillion-edge scale-free graphs. By leveraging node-local NAND Flash, our approach can process thirty-two times larger datasets with only a 39% performance degradation in Traversed Edges Per Second (TEPS). © 2013 IEEE.
Refining and validating the Social Interaction Anxiety Scale and the Social Phobia Scale.
Carleton, R Nicholas; Collimore, Kelsey C; Asmundson, Gordon J G; McCabe, Randi E; Rowa, Karen; Antony, Martin M
2009-01-01
The Social Interaction Anxiety Scale and Social Phobia Scale are companion measures for assessing symptoms of social anxiety and social phobia. The scales have good reliability and validity across several samples, however, exploratory and confirmatory factor analyses have yielded solutions comprising substantially different item content and factor structures. These discrepancies are likely the result of analyzing items from each scale separately or simultaneously. The current investigation sets out to assess items from those scales, both simultaneously and separately, using exploratory and confirmatory factor analyses in an effort to resolve the factor structure. Participants consisted of a clinical sample (n 5353; 54% women) and an undergraduate sample (n 5317; 75% women) who completed the Social Interaction Anxiety Scale and Social Phobia Scale, along with additional fear-related measures to assess convergent and discriminant validity. A three-factor solution with a reduced set of items was found to be most stable, irrespective of whether the items from each scale are assessed together or separately. Items from the Social Interaction Anxiety Scale represented one factor, whereas items from the Social Phobia Scale represented two other factors. Initial support for scale and factor validity, along with implications and recommendations for future research, is provided. (c) 2009 Wiley-Liss, Inc.
JY1 time scale: a new Kalman-filter time scale designed at NIST
International Nuclear Information System (INIS)
Yao, Jian; Parker, Thomas E; Levine, Judah
2017-01-01
We report on a new Kalman-filter hydrogen-maser time scale (i.e. JY1 time scale) designed at the National Institute of Standards and Technology (NIST). The JY1 time scale is composed of a few hydrogen masers and a commercial Cs clock. The Cs clock is used as a reference clock to ease operations with existing data. Unlike other time scales, the JY1 time scale uses three basic time-scale equations, instead of only one equation. Also, this time scale can detect a clock error (i.e. time error, frequency error, or frequency drift error) automatically. These features make the JY1 time scale stiff and less likely to be affected by an abnormal clock. Tests show that the JY1 time scale deviates from the UTC by less than ±5 ns for ∼100 d, when the time scale is initially aligned to the UTC and then is completely free running. Once the time scale is steered to a Cs fountain, it can maintain the time with little error even if the Cs fountain stops working for tens of days. This can be helpful when we do not have a continuously operated fountain or when the continuously operated fountain accidentally stops, or when optical clocks run occasionally. (paper)
Cardiac Depression Scale: Mokken scaling in heart failure patients
Directory of Open Access Journals (Sweden)
Ski Chantal F
2012-11-01
Full Text Available Abstract Background There is a high prevalence of depression in patients with heart failure (HF that is associated with worsening prognosis. The value of using a reliable and valid instrument to measure depression in this population is therefore essential. We validated the Cardiac Depression Scale (CDS in heart failure patients using a model of ordinal unidimensional measurement known as Mokken scaling. Findings We administered in face-to-face interviews the CDS to 603 patients with HF. Data were analysed using Mokken scale analysis. Items of the CDS formed a statistically significant unidimensional Mokken scale of low strength (H0.8. Conclusions The CDS has a hierarchy of items which can be interpreted in terms of the increasingly serious effects of depression occurring as a result of HF. Identifying an appropriate instrument to measure depression in patients with HF allows for early identification and better medical management.
Attia, S.; Paterson, S. R.; Jiang, D.; Miller, R. B.
2017-12-01
Structural studies of orogenic deformation fields are mostly based on small-scale structures ubiquitous in field exposures, hand samples, and under microscopes. Relating deformation histories derived from such structures to changing lithospheric-scale deformation and boundary conditions is not trivial due to vast scale separation (10-6 107 m) between characteristic lengths of small-scale structures and lithospheric plates. Rheological heterogeneity over the range of orogenic scales will lead to deformation partitioning throughout intervening scales of structural development. Spectacular examples of structures documenting deformation partitioning are widespread within hot (i.e., magma-rich) orogens such as the well-studied central Sierra Nevada and Cascades core of western North America: (1) deformation partitioned into localized, narrow, triclinic shear zones separated by broad domains of distributed pure shear at micro- to 10 km scales; (2) deformation partitioned between plutons and surrounding metamorphic host rocks as shown by pluton-wide magmatic fabrics consistently oriented differently than coeval host rock fabrics; (3) partitioning recorded by different fabric intensities, styles, and orientations established from meter-scale grid mapping to 100 km scale domainal analyses; and (4) variations in the causes of strain and kinematics within fold-dominated domains. These complex, partitioned histories require synthesized mapping, geochronology, and structural data at all scales to evaluate partitioning and in the absence of correct scaling can lead to incorrect interpretations of histories. Forward modeling capable of addressing deformation partitioning in materials containing multiple scales of rheologically heterogeneous elements of varying characteristic lengths provides the ability to upscale the large synthesized datasets described above to plate-scale tectonic processes and boundary conditions. By comparing modeling predictions from the recently developed
International Nuclear Information System (INIS)
2012-05-01
A brief account of activities carried out by the Nuclear Regulatory Authority of the Slovak Republic (UJD SR) in 2011 is presented. These activities are reported under the headings: Foreword; (1) Legislative activities; (2) Regulatory Activities; (3) Nuclear safety of nuclear power plants; (4) Nuclear Materials in SR; (5) Nuclear materials and physical protection of nuclear materials; (6) Scope of powers of the office building; (7) Emergency planning and preparedness; (8) International activities; (9) Public communication; (10) Nuclear Regulatory Authority of the Slovak Republic; (11) UJD SR organization chart; The International Nuclear Event Scale (INES); (12) Abbreviations.
International Nuclear Information System (INIS)
2010-05-01
A brief account of activities carried out by the Nuclear Regulatory Authority of the Slovak Republic (UJD SR) in 2010 is presented. These activities are reported under the headings: Address of the Chairperson; (1) Legislative activities; (2) Issuance of authorizations, assessment, supervisory activities and enforcement; (3) Nuclear safety of nuclear power plants; (4) Nuclear materials and physical protection of nuclear materials; (5) Powers of the office building; (6) Emergency planning and preparedness; (7) International activities; (8) Public communication; (9) Nuclear Regulatory Authority of the Slovak Republic; (10) Appendix: UJD SR organization chart; The International Nuclear Event Scale (INES); Abbreviations.
Directory of Open Access Journals (Sweden)
Paweł Wróbel
2018-03-01
Conclusions: CKD-EPI and abbreviated MDRD formulas have a similar usefulness in GFR value estimation in patients with diagnosed chronic kidney disease. Lower eGFR values achieved using abbreviated MDRD formula and CKD-EPI equation in comparison with Bjornsson’s formula may result in an increased number of patients diagnosed with CKD.
SCALE INTERACTION IN A MIXING LAYER. THE ROLE OF THE LARGE-SCALE GRADIENTS
Fiscaletti, Daniele; Attili, Antonio; Bisetti, Fabrizio; Elsinga, Gerrit E.
2015-01-01
from physical considerations we would expect the scales to interact in a qualitatively similar way within the flow and across different turbulent flows. Therefore, instead of the large-scale fluctuations, the large-scale gradients modulation of the small scales has been additionally investigated.
Scale interactions in a mixing layer – the role of the large-scale gradients
Fiscaletti, D.
2016-02-15
© 2016 Cambridge University Press. The interaction between the large and the small scales of turbulence is investigated in a mixing layer, at a Reynolds number based on the Taylor microscale of , via direct numerical simulations. The analysis is performed in physical space, and the local vorticity root-mean-square (r.m.s.) is taken as a measure of the small-scale activity. It is found that positive large-scale velocity fluctuations correspond to large vorticity r.m.s. on the low-speed side of the mixing layer, whereas, they correspond to low vorticity r.m.s. on the high-speed side. The relationship between large and small scales thus depends on position if the vorticity r.m.s. is correlated with the large-scale velocity fluctuations. On the contrary, the correlation coefficient is nearly constant throughout the mixing layer and close to unity if the vorticity r.m.s. is correlated with the large-scale velocity gradients. Therefore, the small-scale activity appears closely related to large-scale gradients, while the correlation between the small-scale activity and the large-scale velocity fluctuations is shown to reflect a property of the large scales. Furthermore, the vorticity from unfiltered (small scales) and from low pass filtered (large scales) velocity fields tend to be aligned when examined within vortical tubes. These results provide evidence for the so-called \\'scale invariance\\' (Meneveau & Katz, Annu. Rev. Fluid Mech., vol. 32, 2000, pp. 1-32), and suggest that some of the large-scale characteristics are not lost at the small scales, at least at the Reynolds number achieved in the present simulation.
Small-scale microwave background anisotropies implied by large-scale data
Kashlinsky, A.
1993-01-01
In the absence of reheating microwave background radiation (MBR) anisotropies on arcminute scales depend uniquely on the amplitude and the coherence length of the primordial density fluctuations (PDFs). These can be determined from the recent data on galaxy correlations, xi(r), on linear scales (APM survey). We develop here expressions for the MBR angular correlation function, C(theta), on arcminute scales in terms of the power spectrum of PDFs and demonstrate their accuracy by comparing with detailed calculations of MBR anisotropies. We then show how to evaluate C(theta) directly in terms of the observed xi(r) and show that the APM data give information on the amplitude, C(O), and the coherence angle of MBR anisotropies on small scales.
Integrated simulation of continuous-scale and discrete-scale radiative transfer in metal foams
Xia, Xin-Lin; Li, Yang; Sun, Chuang; Ai, Qing; Tan, He-Ping
2018-06-01
A novel integrated simulation of radiative transfer in metal foams is presented. It integrates the continuous-scale simulation with the direct discrete-scale simulation in a single computational domain. It relies on the coupling of the real discrete-scale foam geometry with the equivalent continuous-scale medium through a specially defined scale-coupled zone. This zone holds continuous but nonhomogeneous volumetric radiative properties. The scale-coupled approach is compared to the traditional continuous-scale approach using volumetric radiative properties in the equivalent participating medium and to the direct discrete-scale approach employing the real 3D foam geometry obtained by computed tomography. All the analyses are based on geometrical optics. The Monte Carlo ray-tracing procedure is used for computations of the absorbed radiative fluxes and the apparent radiative behaviors of metal foams. The results obtained by the three approaches are in tenable agreement. The scale-coupled approach is fully validated in calculating the apparent radiative behaviors of metal foams composed of very absorbing to very reflective struts and that composed of very rough to very smooth struts. This new approach leads to a reduction in computational time by approximately one order of magnitude compared to the direct discrete-scale approach. Meanwhile, it can offer information on the local geometry-dependent feature and at the same time the equivalent feature in an integrated simulation. This new approach is promising to combine the advantages of the continuous-scale approach (rapid calculations) and direct discrete-scale approach (accurate prediction of local radiative quantities).
Energy Technology Data Exchange (ETDEWEB)
Wang, Xu; Ding, Jie; Guo, Wan-Qian; Ren, Nan-Qi [State Key Laboratory of Urban Water Resource and Environment, Harbin Institute of Technology, 202 Haihe Road, Nangang District, Harbin, Heilongjiang 150090 (China)
2010-10-15
The objective of conducting experiments in a laboratory is to gain data that helps in designing and operating large-scale biological processes. However, the scale-up and design of industrial-scale biohydrogen production reactors is still uncertain. In this paper, an established and proven Eulerian-Eulerian computational fluid dynamics (CFD) model was employed to perform hydrodynamics assessments of an industrial-scale continuous stirred-tank reactor (CSTR) for biohydrogen production. The merits of the laboratory-scale CSTR and industrial-scale CSTR were compared and analyzed on the basis of CFD simulation. The outcomes demonstrated that there are many parameters that need to be optimized in the industrial-scale reactor, such as the velocity field and stagnation zone. According to the results of hydrodynamics evaluation, the structure of industrial-scale CSTR was optimized and the results are positive in terms of advancing the industrialization of biohydrogen production. (author)
Mokken scaling of the Myocardial Infarction Dimensional Assessment Scale (MIDAS).
Thompson, David R; Watson, Roger
2011-02-01
The purpose of this study was to examine the hierarchical and cumulative nature of the 35 items of the Myocardial Infarction Dimensional Assessment Scale (MIDAS), a disease-specific health-related quality of life measure. Data from 668 participants who completed the MIDAS were analysed using the Mokken Scaling Procedure, which is a computer program that searches polychotomous data for hierarchical and cumulative scales on the basis of a range of diagnostic criteria. Fourteen MIDAS items were retained in a Mokken scale and these items included physical activity, insecurity, emotional reaction and dependency items but excluded items related to diet, medication or side-effects. Item difficulty, in item response theory terms, ran from physical activity items (low difficulty) to insecurity, suggesting that the most severe quality of life effect of myocardial infarction is loneliness and isolation. Items from the MIDAS form a strong and reliable Mokken scale, which provides new insight into the relationship between items in the MIDAS and the measurement of quality of life after myocardial infarction. © 2010 Blackwell Publishing Ltd.
Indian Academy of Sciences (India)
First page Back Continue Last page Overview Graphics. Flux scaling: Ultimate regime. With the Nusselt number and the mixing length scales, we get the Nusselt number and Reynolds number (w'd/ν) scalings: and or. and. scaling expected to occur at extremely high Ra Rayleigh-Benard convection. Get the ultimate regime ...
Minimum Efficient Scale (MES) and preferred scale of container terminals
Kaselimi, Evangelia N.; Notteboom, Theo E.; Pallis, Athanasios A.; Farrell, Sheila
2011-01-01
Abstract: The decision on the scale of a port terminal affects the terminals managerial, operational and competitive position in all the phases of its life. It also affects competition structures in the port in which the terminal is operating, and has a potential impact on other terminals. Port authorities and terminal operators need to know the scale of the terminal when engaging in concession agreements. In economic theory the scale of a plant/firm is typically defined in relation to the Mi...
International Nuclear Information System (INIS)
DeHart, Mark D.; Williams, Mark L.; Bowman, Stephen M.
2010-01-01
The SCALE computational architecture has remained basically the same since its inception 30 years ago, although constituent modules and capabilities have changed significantly. This SCALE concept was intended to provide a framework whereby independent codes can be linked to provide a more comprehensive capability than possible with the individual programs - allowing flexibility to address a wide variety of applications. However, the current system was designed originally for mainframe computers with a single CPU and with significantly less memory than today's personal computers. It has been recognized that the present SCALE computation system could be restructured to take advantage of modern hardware and software capabilities, while retaining many of the modular features of the present system. Preliminary work is being done to define specifications and capabilities for a more advanced computational architecture. This paper describes the state of current SCALE development activities and plans for future development. With the release of SCALE 6.1 in 2010, a new phase of evolutionary development will be available to SCALE users within the TRITON and NEWT modules. The SCALE (Standardized Computer Analyses for Licensing Evaluation) code system developed by Oak Ridge National Laboratory (ORNL) provides a comprehensive and integrated package of codes and nuclear data for a wide range of applications in criticality safety, reactor physics, shielding, isotopic depletion and decay, and sensitivity/uncertainty (S/U) analysis. Over the last three years, since the release of version 5.1 in 2006, several important new codes have been introduced within SCALE, and significant advances applied to existing codes. Many of these new features became available with the release of SCALE 6.0 in early 2009. However, beginning with SCALE 6.1, a first generation of parallel computing is being introduced. In addition to near-term improvements, a plan for longer term SCALE enhancement
Wilson, K M; Huff, J L
2001-05-01
The influence on social behavior of beliefs in Satan and the nature of evil has received little empirical study. Elaine Pagels (1995) in her book, The Origin of Satan, argued that Christians' intolerance toward others is due to their belief in an active Satan. In this study, more than 200 college undergraduates completed the Manitoba Prejudice Scale and the Attitudes Toward Homosexuals Scale (B. Altemeyer, 1988), as well as the Belief in an Active Satan Scale, developed by the authors. The Belief in an Active Satan Scale demonstrated good internal consistency and temporal stability. Correlational analyses revealed that for the female participants, belief in an active Satan was directly related to intolerance toward lesbians and gay men and intolerance toward ethnic minorities. For the male participants, belief in an active Satan was directly related to intolerance toward lesbians and gay men but was not significantly related to intolerance toward ethnic minorities. Results of this research showed that it is possible to meaningfully measure belief in an active Satan and that such beliefs may encourage intolerance toward others.
Small scale models equal large scale savings
International Nuclear Information System (INIS)
Lee, R.; Segroves, R.
1994-01-01
A physical scale model of a reactor is a tool which can be used to reduce the time spent by workers in the containment during an outage and thus to reduce the radiation dose and save money. The model can be used for worker orientation, and for planning maintenance, modifications, manpower deployment and outage activities. Examples of the use of models are presented. These were for the La Salle 2 and Dresden 1 and 2 BWRs. In each case cost-effectiveness and exposure reduction due to the use of a scale model is demonstrated. (UK)
The Impact of Texting on Comprehension
Directory of Open Access Journals (Sweden)
Jamal K. M. Ali
2015-07-01
Full Text Available This paper presents a study of the effects of texting on English language comprehension. The authors believe that English used in texting causes a lack of comprehension for English speakers, learners, and texters. Wei, Xian-hai and Jiang (2008:3 declare “In Netspeak, there are some newly-created vocabularies, which people cannot comprehend them either from their partial pronunciation or from their figures.” Crystal (2007:23 claims; “variation causes problems of comprehension and acceptability. If you speak or write differently from the way I do, we may fail to understand each other.” In this paper, the authors conducted a questionnaire at Aligarh Muslim University to ninety respondents from five different Faculties and four different levels. To measure respondents’ comprehension of English texting, the authors gave the respondents abbreviations used by texters and asked them to write the full forms of the abbreviations. The authors found that many abbreviations were not understood, which suggested that most of the respondents did not understand and did not use these abbreviations.
Falk, C.; And Others
The development of the Maslowian Scale, a method of revealing a picture of one's needs and concerns based on Abraham Maslow's levels of self-actualization, is described. This paper also explains how the scale is supported by the theories of L. Kohlberg, C. Rogers, and T. Rusk. After a literature search, a list of statements was generated…
Mokken scale analysis : Between the Guttman scale and parametric item response theory
van Schuur, Wijbrandt H.
2003-01-01
This article introduces a model of ordinal unidimensional measurement known as Mokken scale analysis. Mokken scaling is based on principles of Item Response Theory (IRT) that originated in the Guttman scale. I compare the Mokken model with both Classical Test Theory (reliability or factor analysis)
Scaling a Convection-Resolving RCM to Near-Global Scales
Leutwyler, D.; Fuhrer, O.; Chadha, T.; Kwasniewski, G.; Hoefler, T.; Lapillonne, X.; Lüthi, D.; Osuna, C.; Schar, C.; Schulthess, T. C.; Vogt, H.
2017-12-01
In the recent years, first decade-long kilometer-scale resolution RCM simulations have been performed on continental-scale computational domains. However, the size of the planet Earth is still an order of magnitude larger and thus the computational implications of performing global climate simulations at this resolution are challenging. We explore the gap between the currently established RCM simulations and global simulations by scaling the GPU accelerated version of the COSMO model to a near-global computational domain. To this end, the evolution of an idealized moist baroclinic wave has been simulated over the course of 10 days with a grid spacing of up to 930 m. The computational mesh employs 36'000 x 16'001 x 60 grid points and covers 98.4% of the planet's surface. The code shows perfect weak scaling up to 4'888 Nodes of the Piz Daint supercomputer and yields 0.043 simulated years per day (SYPD) which is approximately one seventh of the 0.2-0.3 SYPD required to conduct AMIP-type simulations. However, at half the resolution (1.9 km) we've observed 0.23 SYPD. Besides formation of frontal precipitating systems containing embedded explicitly-resolved convective motions, the simulations reveal a secondary instability that leads to cut-off warm-core cyclonic vortices in the cyclone's core, once the grid spacing is refined to the kilometer scale. The explicit representation of embedded moist convection and the representation of the previously unresolved instabilities exhibit a physically different behavior in comparison to coarser-resolution simulations. The study demonstrates that global climate simulations using kilometer-scale resolution are imminent and serves as a baseline benchmark for global climate model applications and future exascale supercomputing systems.
Scaling of differential equations
Langtangen, Hans Petter
2016-01-01
The book serves both as a reference for various scaled models with corresponding dimensionless numbers, and as a resource for learning the art of scaling. A special feature of the book is the emphasis on how to create software for scaled models, based on existing software for unscaled models. Scaling (or non-dimensionalization) is a mathematical technique that greatly simplifies the setting of input parameters in numerical simulations. Moreover, scaling enhances the understanding of how different physical processes interact in a differential equation model. Compared to the existing literature, where the topic of scaling is frequently encountered, but very often in only a brief and shallow setting, the present book gives much more thorough explanations of how to reason about finding the right scales. This process is highly problem dependent, and therefore the book features a lot of worked examples, from very simple ODEs to systems of PDEs, especially from fluid mechanics. The text is easily accessible and exam...
DSB Task Force on Cyber Supply Chain
2017-02-06
Abbreviations and Acronyms iii Acronyms and Abbreviations ACQ: acquisition management AIS : Automated Indicator Sharing AMRAAM: Advanced...situational awareness to enable mission planners and commanders to recognize the danger presented potential attacks prior to missions and to develop...and disseminate information reported pursuant to CISA, DHS operates an Automated Indicator Sharing ( AIS ) system within the National Cybersecurity and
1984-06-01
318-324, 1954. .3 11. Finney, D.J., Probit Analysis, 3rd Ed., Cambridge University Press, 1971. 12. Thompson, W.R. and C.S. Weil, Biometrics 8, 51-58...824, 1980. 531 .4 Table 1. Abbreviations and Ligand Charges Abbreviation Name H 2-Proto2 Protoporphyr in-IX H 2-flemato 2 - Hemat opo rphyr in-IX -DPS4
Organisational innovation in health services: lessons from the NHS treatment centres
National Research Council Canada - National Science Library
Gabbay, J
2011-01-01
... design and methods References Index 103 133 147 149 155 165 v List of abbreviationsOrganisational innovation in health services List of abbreviations A&E ACAD DH DTC GP G-Supp NHS NIHR PCT PFI SDO SHA TC accident and emergency (department) Ambulatory Care and Diagnostic Centre Department of Health ('the Department') diagnosis and treatment centr...
Full-scale and time-scale heating experiments at Stripa: preliminary results
International Nuclear Information System (INIS)
Cook, N.G.W.; Hood, Michael; California Univ., Berkeley
1978-01-01
Two full-scale heating experiments and a time-scale heating experiment have recently been started in granite 340 meters below surface. The purpose of the full-scale heating experiments is to assess the near-field effects of thermal loading for the design of an underground repository of nuclear wastes. That of the time-scale heating experiments is to obtain field data of the interaction between heaters and its effect on the rock mass during a period of about two years, which corresponds to about twenty years of full-scale operation. Geological features of the rock around each experiment have been mapped carefully, and temperatures, stresses and displacements induced in the rock by heating have been calculated in advance of the experiments. Some 800 different measurements are recorded at frequent intervals by a computer system situated underground. These data can be compared at any time with predictions made earlier on video display units underground
Directory of Open Access Journals (Sweden)
A.N. Madewell
2016-09-01
Full Text Available The data presented in this article are related to the article entitled “Assessing Resilience in Emerging Adulthood: The Resilience Scale (RS, Connor Davidson Resilience Scale (CD-RISC, and Scale of Protective Factors (SPF” (Madewell and Ponce-Garcia, 2016 [1]. The data were collected from a sample of 451 college students from three universities located in the Southwestern region of the United States: 374 from a large public university and 67 from two smaller regional universities. The data from the three universities did not significantly differ in terms of demographics. The data represent participant responses on six measurements to include the Resilience Scale-25 (RS-25, Resilience Scale-14 (RS-14, Connor Davidson Resilience Scale-25 (CD-RISC-25, Connor Davidson Resilience Scale-10 (CD-RISC-10, Scale of Protective Factors-24 (SPF-24, and the Life Stressor Checklist Revised (LSC-R. Keywords: Scale of Protective Factors, Resilience Scale, Connor–Davidson Resilience Scale, Emerging adulthood, Confirmatory factor analysis
Scaling analysis for a Savannah River reactor scaled model integral system
International Nuclear Information System (INIS)
Boucher, T.J.; Larson, T.K.; McCreery, G.E.; Anderson, J.L.
1990-11-01
801The Savannah River Laboratory has requested that the Idaho National Engineering Laboratory perform an analysis to help define, examine, and assess potential concepts for the design of a scaled integral hydraulics test facility representative of the current Savannah River Plant reactor design. In this report the thermal-hydraulic phenomena of importance (based on the knowledge and experience of the authors and the results of the joint INEL/TPG/SRL phenomena identification and ranking effort) to reactor safety during the design basis loss-of-coolant accident were examined and identified. Established scaling methodologies were used to develop potential concepts for integral hydraulic testing facilities. Analysis is conducted to examine the scaling of various phenomena in each of the selected concepts. Results generally support that a one-fourth (1/4) linear scale visual facility capable of operating at pressures up to 350 kPa (51 psia) and temperatures up to 330 K (134 degree F) will scale most hydraulic phenomena reasonably well. However, additional research will be necessary to determine the most appropriate method of simulating several of the reactor components, since the scaling methodology allows for several approaches which may only be assessed via appropriate research. 34 refs., 20 figs., 14 tabs
The Fermi scale as a focus point of high-scale gauge mediation
Energy Technology Data Exchange (ETDEWEB)
Bruemmer, F.; Buchmueller, W.
2012-01-15
We consider the minimal supersymmetric Standard Model with large scalar and gaugino mass terms at the GUT scale, which are generated predominantly by gauge-mediated supersymmetry breaking. For certain ratios of GUT-scale masses, determined by the messenger indices, large radiative corrections lead to a small electroweak scale in a way which resembles the well-known focus point mechanism. The Fermi scale, the gravitino mass and the higgsino masses are of comparable size. For a Higgs mass of about 124 GeV all other superparticles have masses outside the reach of the LHC. (orig.)
International Nuclear Information System (INIS)
Brodsky, S.J.; Lu, H.J.
1994-10-01
We derive commensurate scale relations which relate perturbatively calculable QCD observables to each other, including the annihilation ratio R e+ e - , the heavy quark potential, τ decay, and radiative corrections to structure function sum rules. For each such observable one can define an effective charge, such as α R (√s)/π ≡ R e+ e - (√s)/(3Σe q 2 )-1. The commensurate scale relation connecting the effective charges for observables A and B has the form α A (Q A ) α B (Q B )(1 + r A/Bπ / αB + hor-ellipsis), where the coefficient r A/B is independent of the number of flavors ∫ contributing to coupling renormalization, as in BLM scale-fixing. The ratio of scales Q A /Q B is unique at leading order and guarantees that the observables A and B pass through new quark thresholds at the same physical scale. In higher orders a different renormalization scale Q n* is assigned for each order n in the perturbative series such that the coefficients of the series are identical to that of a invariant theory. The commensurate scale relations and scales satisfy the renormalization group transitivity rule which ensures that predictions in PQCD are independent of the choice of an intermediate renormalization scheme C. In particular, scale-fixed predictions can be made without reference to theoretically constructed singular renormalization schemes such as MS. QCD can thus be tested in a new and precise way by checking that the effective charges of observables track both in their relative normalization and in their commensurate scale dependence. The commensurate scale relations which relate the radiative corrections to the annihilation ratio R e + e - to the radiative corrections for the Bjorken and Gross-Llewellyn Smith sum rules are particularly elegant and interesting
Energy Technology Data Exchange (ETDEWEB)
Bunke, Dirk; Gross, Rita; Vogel, Steffen [Oeko-Institut e.V. - Institut fuer Angewandte Oekologie e.V., Freiburg im Breisgau (Germany)
2011-11-15
Scaling in the context of REACH means: use of simple mathematics to check, whether chemi-cals are used in a safe way. Even in case if certain conditions of use deviate from the exposure scenario. In specific cases, scaling offers downstream users the opportunity to demonstrate coverage by an exposure scenario for their individual conditions of use. In this report we describe the duty of downstream users to check their conditions of use. We give a definition of scaling related to REACH. We describe objectives and results of scaling. We characterise available scaling tools in a structured way. We describe options for further development and harmonisation of scaling tools. Under use of the experience with existing tools, we develop a guidance document on scaling. Three examples in this guidance make clear how scaling works. In five steps. The guidance is addressed to persons using substances in industrial or professional applications - downstream users according to REACH. In addition, the guidance supports producers of substances and formulators who want to develop scaling tools for their customers. The report includes a calculation table for scaling related to the environment (REACH Scale Environment). In addition, it includes a template to generate product-specific scaling tools. This report focuses on scaling related to environmental exposure assessment. Scaling is possible related to workers and consumer exposure, too. References for this are given in chapter 7. (orig.)
Kelly, Dana L.
1999-11-01
The scale anchoring method was used to analyze and describe the TIMSS primary and middle school (Populations 1 and 2) mathematics and science achievement scales. Scale anchoring is a way of attaching meaning to a scale by describing what students know and can do at specific points on the scale. Student achievement was scrutinized at four points on the TIMSS primary and middle school achievement scales---the 25th, 50th, 75th, and 90th international percentiles for fourth and eighth grades. The scale anchoring method was adapted for the TIMSS data and items that students scoring at each of the four scale points were likely to answer correctly (with a 65 percent probability) were identified. The items were assembled in binders organized by anchor level and content area. Two ten-member panels of subject-matter specialists were convened to scrutinize the items, draft descriptions of student proficiency at the four scale points, and identify example TIMSS items to illustrate performance at each level. Following the panel meetings, the descriptions were refined through an iterative review process. The result is a content-referenced interpretation of the TIMSS scales through which TIMSS achievement results can be better communicated and understood.
International Nuclear Information System (INIS)
Hegyi, S.
1998-01-01
A generalization of the Koba-Nielsen-Olesen scaling law of the multiplicity distributions P(n) is presented. It consists of a change in the normalization point of P(n) compensated by a suitable change in the renormalized parameters and a rescaling. The iterative repetition of the transformation yields the sequence of higher-order moment distributions of P(n). Each member of this sequence may exhibit data collapsing behavior in case of violation of the original KNO scaling hypothesis. It is shown that the iterative procedure can be viewed as varying the collision energy, i.e. the moment distributions of P(n) can represent the pattern of pre-asymptotic KNO scaling violation. The fixed points of the iteration will be determined and a consistency test based on Feynman scaling is to be given. (author)
Dynamic critical behaviour and scaling
International Nuclear Information System (INIS)
Oezoguz, B.E.
2001-01-01
Traditionally the scaling is the property of dynamical systems at thermal equilibrium. In second order phase transitions scaling behaviour is due to the infinite correlation length around the critical point. In first order phase transitions however, the correlation length remains finite and a different type of scaling can be observed. For first order phase transitions all singularities are governed by the volume of the system. Recently, a different type of scaling, namely dynamic scaling has attracted attention in second order phase transitions. In dynamic scaling, when a system prepared at high temperature is quenched to the critical temperature, it exhibits scaling behaviour. Dynamic scaling has been applied to various spin systems and the validity of the arguments are shown. Firstly, in this thesis project the dynamic scaling is applied to 4-dimensional using spin system which exhibits second order phase transition with mean-field critical indices. Secondly, it is shown that although the dynamic is quite different, first order phase transitions also has a different type of dynamic scaling
Ripple scalings in geothermal facilities, a key to understand the scaling process
Köhl, Bernhard; Grundy, James; Baumann, Thomas
2017-04-01
Scalings are a widespread problem among geothermal plants which exploit the Malm Aquifer in the Bavarian Molasse Zone. They effect the technical and economic efficiency of geothermal plants. The majority of the scalings observed at geothermal facilities exploring the Malm aquifer in the Bavarian Molasse Basin are carbonates. They are formed due to a disruption of the lime-carbonic-acid equilibrium during production caused by degassing of CO2. These scalings are found in the production pipes, at the pumps and at filters and can nicely be described using existing hydrogeochemical models. This study proposes a second mechanism for the formation of scalings in ground-level facilities. We investigated scalings which accumulated at the inlet to the heat exchanger. Interestingly, the scalings were recovered after the ground level facilities had been cleaned. The scalings showed distinct ripple structures, which is likely a result of solid particle deposition. From the ripple features the the flow conditions during their formation were calculated based on empirical equations (Soulsby, 2012). The calculations suggest that the deposits were formed during maintenance works. Thin section images of the sediments indicate a two-step process: deposition of sediment grains, followed by stabilization with a calcite layer. The latter likely occured during maintenance. To prevent this type of scalings blocking the heat exchangers, the maintenance procedure has to be revised. References: Soulsby, R. L.; Whitehouse, R. J. S.; Marten, K. V.: Prediction of time-evolving sand ripples in shelf seas. Continental Shelf Research 2012, 38, 47-62
Žardin, Norbert
2017-01-01
NoSQL database scaling is a decision, where system resources or financial expenses are traded for database performance or other benefits. By scaling a database, database performance and resource usage might increase or decrease, such changes might have a negative impact on an application that uses the database. In this work it is analyzed how database scaling affect database resource usage and performance. As a results, calculations are acquired, using which database scaling types and differe...
Rating scale for psychogenic nonepileptic seizures: scale development and clinimetric testing.
Cianci, Vittoria; Ferlazzo, Edoardo; Condino, Francesca; Mauvais, Hélène Somma; Farnarier, Guy; Labate, Angelo; Latella, Maria Adele; Gasparini, Sara; Branca, Damiano; Pucci, Franco; Vazzana, Francesco; Gambardella, Antonio; Aguglia, Umberto
2011-06-01
Our aim was to develop a clinimetric scale evaluating motor phenomena, associated features, and severity of psychogenic nonepileptic seizures (PNES). Sixty video/EEG-recorded PNES induced by suggestion maneuvers were evaluated. We examined the relationship between results from this scale and results from the Clinical Global Impression (CGI) scale to validate this technique. Interrater reliabilities of the PNES scale for three raters were analyzed using the AC1 statistic, Kendall's coefficient of concordance (KCC), and intraclass correlation coefficients (ICCs). The relationship between the CGI and PNES scales was evaluated with Spearman correlations. The AC1 statistic demonstrated good interrater reliability for each phenomenon analyzed (tremor/oscillation, tonic; clonic/jerking, hypermotor/agitation, atonic/akinetic, automatisms, associated features). KCC and the ICC showed moderate interrater agreement for phenomenology, associated phenomena, and total PNES scores. Spearman's correlation of mean CGI score with mean total PNES score was 0.69 (Pscale described here accurately evaluates the phenomenology of PNES and could be used to assess and compare subgroups of patients with PNES. Copyright © 2011 Elsevier Inc. All rights reserved.
Water scaling in the North Sea oil and gas fields and scale prediction: An overview
Energy Technology Data Exchange (ETDEWEB)
Yuan, M
1997-12-31
Water-scaling is a common and major production chemistry problem in the North Sea oil and gas fields and scale prediction has been an important means to assess the potential and extent of scale deposition. This paper presents an overview of sulphate and carbonate scaling problems in the North Sea and a review of several widely used and commercially available scale prediction software. In the paper, the water chemistries and scale types and severities are discussed relative of the geographical distribution of the fields in the North Sea. The theories behind scale prediction are then briefly described. Five scale or geochemical models are presented and various definitions of saturation index are compared and correlated. Views are the expressed on how to predict scale precipitation under some extreme conditions such as that encountered in HPHT reservoirs. 15 refs., 7 figs., 9 tabs.
Effect of wettability on scale-up of multiphase flow from core-scale to reservoir fine-grid-scale
Energy Technology Data Exchange (ETDEWEB)
Chang, Y.C.; Mani, V.; Mohanty, K.K. [Univ. of Houston, TX (United States)
1997-08-01
Typical field simulation grid-blocks are internally heterogeneous. The objective of this work is to study how the wettability of the rock affects its scale-up of multiphase flow properties from core-scale to fine-grid reservoir simulation scale ({approximately} 10{prime} x 10{prime} x 5{prime}). Reservoir models need another level of upscaling to coarse-grid simulation scale, which is not addressed here. Heterogeneity is modeled here as a correlated random field parameterized in terms of its variance and two-point variogram. Variogram models of both finite (spherical) and infinite (fractal) correlation length are included as special cases. Local core-scale porosity, permeability, capillary pressure function, relative permeability functions, and initial water saturation are assumed to be correlated. Water injection is simulated and effective flow properties and flow equations are calculated. For strongly water-wet media, capillarity has a stabilizing/homogenizing effect on multiphase flow. For small variance in permeability, and for small correlation length, effective relative permeability can be described by capillary equilibrium models. At higher variance and moderate correlation length, the average flow can be described by a dynamic relative permeability. As the oil wettability increases, the capillary stabilizing effect decreases and the deviation from this average flow increases. For fractal fields with large variance in permeability, effective relative permeability is not adequate in describing the flow.
Child Development Program Evaluation Scale.
Fiene, Richard J.
The Child Development Program Evaluation Scale (CDPES) is actually two scales in one, a licensing scale and a quality scale. Licensing predictor items have been found to predict overall compliance of child day care centers with state regulations in four states. Quality scale items have been found to predict the overall quality of child day care…
Cardinal scales for health evaluation
DEFF Research Database (Denmark)
Harvey, Charles; Østerdal, Lars Peter Raahave
2010-01-01
Policy studies often evaluate health for an individual or for a population by using measurement scales that are ordinal scales or expected-utility scales. This paper develops scales of a different type, commonly called cardinal scales, that measure changes in health. Also, we argue that cardinal...... scales provide a meaningful and useful means of evaluating health policies. Thus, we develop a means of using the perspective of early neoclassical welfare economics as an alternative to ordinalist and expected-utility perspectives....
Energy Technology Data Exchange (ETDEWEB)
Quirós Segovia, M.; Condés Ruiz, S.; Drápela, K.
2016-07-01
Aim of the study: The main objective of this study was to test Geographically Weighted Regression (GWR) for developing height-diameter curves for forests on a large scale and to compare it with Linear Mixed Models (LMM). Area of study: Monospecific stands of Pinus halepensis Mill. located in the region of Murcia (Southeast Spain). Materials and Methods: The dataset consisted of 230 sample plots (2582 trees) from the Third Spanish National Forest Inventory (SNFI) randomly split into training data (152 plots) and validation data (78 plots). Two different methodologies were used for modelling local (Petterson) and generalized height-diameter relationships (Cañadas I): GWR, with different bandwidths, and linear mixed models. Finally, the quality of the estimated models was compared throughout statistical analysis. Main results: In general, both LMM and GWR provide better prediction capability when applied to a generalized height-diameter function than when applied to a local one, with R2 values increasing from around 0.6 to 0.7 in the model validation. Bias and RMSE were also lower for the generalized function. However, error analysis showed that there were no large differences between these two methodologies, evidencing that GWR provides results which are as good as the more frequently used LMM methodology, at least when no additional measurements are available for calibrating. Research highlights: GWR is a type of spatial analysis for exploring spatially heterogeneous processes. GWR can model spatial variation in tree height-diameter relationship and its regression quality is comparable to LMM. The advantage of GWR over LMM is the possibility to determine the spatial location of every parameter without additional measurements. Abbreviations: GWR (Geographically Weighted Regression); LMM (Linear Mixed Model); SNFI (Spanish National Forest Inventory). (Author)
Absolute flux scale for radioastronomy
International Nuclear Information System (INIS)
Ivanov, V.P.; Stankevich, K.S.
1986-01-01
The authors propose and provide support for a new absolute flux scale for radio astronomy, which is not encumbered with the inadequacies of the previous scales. In constructing it the method of relative spectra was used (a powerful tool for choosing reference spectra). A review is given of previous flux scales. The authors compare the AIS scale with the scale they propose. Both scales are based on absolute measurements by the ''artificial moon'' method, and they are practically coincident in the range from 0.96 to 6 GHz. At frequencies above 6 GHz, 0.96 GHz, the AIS scale is overestimated because of incorrect extrapolation of the spectra of the primary and secondary standards. The major results which have emerged from this review of absolute scales in radio astronomy are summarized
Winters, Nancy C; Myers, Kathleen; Proud, Laura
2002-10-01
This is the third article in a series of 10-year reviews of rating scales. Here, the authors review scales that are useful in tapping the affective disturbances experienced with various psychiatric disorders, including suicidality, cognitive style, and self-esteem. The authors sampled articles incorporating these constructs over the past 25 years and selected scales with established uses or new development. Those presented here have adequate psychometric properties and high utility for efficiently elucidating youths' functioning, plus either wide literature citations or a special niche. These scales were developed bimodally. Many were developed in the 1980s when internalizing disorders were elucidated, but there has been a resurgence of interest in these constructs. Scales assessing suicidality have clear constructs, whereas scales of cognitive style demonstrate deficits in developmental relevance, and scales of self-esteem suffer from lax constructs. The constructs underlying these scales tap core symptoms of internalizing disorders, mediate the expression of affective disturbances associated with various disorders, and depict the impairments resulting from these disorders. Overall, the psychometrics of these scales are adequate. These scales provide a broader representation of youths' functioning than that conveyed with diagnostic scales alone.
Psychometric Properties of the Persian Adaptation of Mini-Cog Test in Iranian Older Adults.
Rezaei, Mohammad; Rashedi, Vahid; Lotfi, Gohar; Shirinbayan, Peymaneh; Foroughan, Mahshid
2018-04-01
The aim of this study was to assess the psychometric properties of the Mini-Cog in Iranian older adults. It was a cross-sectional study; 50 older people with dementia and 50 without dementia who matched for age, gender, and education entered the study. The diagnostic and statistical manual of mental disorders criteria for dementia were used as gold standard. A battery of scales included the abbreviated mental test score (AMTS), the Geriatric Depression Scale, and the Mini-Cog was performed. Validity and reliability of the Mini-Cog determined using the Pearson product-moment correlation coefficient (Pearson's r), Cronbach's alpha, and Receiver Operating Characteristic (ROC) curve analysis. The Persian version of Mini-Cog showed a good inter-rater reliability ( K = 0.76, p Mini-Cog have an acceptable sensitivity, specificity, and substantial overall agreement with the AMTS.
Kim, John; Neilipovitz, David; Cardinal, Pierre; Chiu, Michelle
2009-01-01
Crisis resource management (CRM) skills are a set of nonmedical skills required to manage medical emergencies. There is currently no gold standard for evaluation of CRM performance. A prior study examined the use of a global rating scale (GRS) to evaluate CRM performance. This current study compared the use of a GRS and a checklist as formal rating instruments to evaluate CRM performance during simulated emergencies. First-year and third-year residents participated in two simulator scenarios each. Three raters then evaluated resident performance in CRM using edited video recordings using both a GRS and a checklist. The Ottawa GRS provides a seven-point anchored ordinal scale for performance in five categories of CRM, and an overall performance score. The Ottawa CRM checklist provides 12 items in the five categories of CRM, with a maximum cumulative score of 30 points. Construct validity was measured on the basis of content validity, response process, internal structure, and response to other variables. T-test analysis of Ottawa GRS scores was conducted to examine response to the variable of level of training. Intraclass correlation coefficient (ICC) scores were used to measure inter-rater reliability for both scenarios. Thirty-two first-year and 28 third-year residents participated in the study. Third-year residents produced higher mean scores for overall CRM performance than first-year residents (P CRM checklist (P CRM checklist. Users indicated a strong preference for the Ottawa GRS given ease of scoring, presence of an overall score, and the potential for formative evaluation. Construct validity seems to be present when using both the Ottawa GRS and CRM checklist to evaluate CRM performance during simulated emergencies. Data also indicate the presence of moderate inter-rater reliability when using both the Ottawa GRS and CRM checklist.
Campbell, Alistair; Hemsley, Samantha
2009-01-01
The validity and reliability of the Outcome Rating Scale (ORS) and the Session Rating Scale (SRS) were evaluated against existing longer measures, including the Outcome Questionnaire-45, Working Alliance Inventory, Depression Anxiety Stress Scale-21, Quality of Life Scale, Rosenberg Self-Esteem Scale and General Self-efficacy Scale. The measures…
The factor structure of the Social Interaction Anxiety Scale and the Social Phobia Scale.
Heidenreich, Thomas; Schermelleh-Engel, Karin; Schramm, Elisabeth; Hofmann, Stefan G; Stangier, Ulrich
2011-05-01
The Social Interaction Anxiety Scale (SIAS) and the Social Phobia Scale (SPS) are two compendium measures that have become some of the most popular self-report scales of social anxiety. Despite their popularity, it remains unclear whether it is necessary to maintain two separate scales of social anxiety. The primary objective of the present study was to examine the factor analytic structure of both measures to determine the factorial validity of each scale. For this purpose, we administered both scales to 577 patients at the beginning of outpatient treatment. Analyzing both scales simultaneously, a CFA with two correlated factors showed a better fit to the data than a single factor model. An additional EFA with an oblique rotation on all 40 items using the WLSMV estimator further supported the two factor solution. These results suggest that the SIAS and SPS measure similar, but not identical facets of social anxiety. Thus, our findings provide support to retain the SIAS and SPS as two separate scales. Copyright © 2011 Elsevier Ltd. All rights reserved.
Ekin, Jack W; Goodrich, Loren; Splett, Jolene; Bordini, Bernardo; Richter, David
2016-01-01
A scaling study of several thousand Nb$_{3}$Sn critical-current $(I_c)$ measurements is used to derive the Extrapolative Scaling Expression (ESE), a relation that can quickly and accurately extrapolate limited datasets to obtain full three-dimensional dependences of I c on magnetic field (B), temperature (T), and mechanical strain (ε). The relation has the advantage of being easy to implement, and offers significant savings in sample characterization time and a useful tool for magnet design. Thorough data-based analysis of the general parameterization of the Unified Scaling Law (USL) shows the existence of three universal scaling constants for practical Nb$_{3}$Sn conductors. The study also identifies the scaling parameters that are conductor specific and need to be fitted to each conductor. This investigation includes two new, rare, and very large I c(B,T,ε) datasets (each with nearly a thousand I c measurements spanning magnetic fields from 1 to 16 T, temperatures from ~2.26 to 14 K, and intrinsic strain...
International Nuclear Information System (INIS)
Tim Scheibe; Alexandre Tartakovsky; Brian Wood; Joe Seymour
2007-01-01
Effective environmental management of DOE sites requires reliable prediction of reactive transport phenomena. A central issue in prediction of subsurface reactive transport is the impact of multiscale physical, chemical, and biological heterogeneity. Heterogeneity manifests itself through incomplete mixing of reactants at scales below those at which concentrations are explicitly defined (i.e., the numerical grid scale). This results in a mismatch between simulated reaction processes (formulated in terms of average concentrations) and actual processes (controlled by local concentrations). At the field scale, this results in apparent scale-dependence of model parameters and inability to utilize laboratory parameters in field models. Accordingly, most field modeling efforts are restricted to empirical estimation of model parameters by fitting to field observations, which renders extrapolation of model predictions beyond fitted conditions unreliable. The objective of this project is to develop a theoretical and computational framework for (1) connecting models of coupled reactive transport from pore-scale processes to field-scale bioremediation through a hierarchy of models that maintain crucial information from the smaller scales at the larger scales; and (2) quantifying the uncertainty that is introduced by both the upscaling process and uncertainty in physical parameters. One of the challenges of addressing scale-dependent effects of coupled processes in heterogeneous porous media is the problem-specificity of solutions. Much effort has been aimed at developing generalized scaling laws or theories, but these require restrictive assumptions that render them ineffective in many real problems. We propose instead an approach that applies physical and numerical experiments at small scales (specifically the pore scale) to a selected model system in order to identify the scaling approach appropriate to that type of problem. Although the results of such studies will
Energy Technology Data Exchange (ETDEWEB)
Tim Scheibe; Alexandre Tartakovsky; Brian Wood; Joe Seymour
2007-04-19
Effective environmental management of DOE sites requires reliable prediction of reactive transport phenomena. A central issue in prediction of subsurface reactive transport is the impact of multiscale physical, chemical, and biological heterogeneity. Heterogeneity manifests itself through incomplete mixing of reactants at scales below those at which concentrations are explicitly defined (i.e., the numerical grid scale). This results in a mismatch between simulated reaction processes (formulated in terms of average concentrations) and actual processes (controlled by local concentrations). At the field scale, this results in apparent scale-dependence of model parameters and inability to utilize laboratory parameters in field models. Accordingly, most field modeling efforts are restricted to empirical estimation of model parameters by fitting to field observations, which renders extrapolation of model predictions beyond fitted conditions unreliable. The objective of this project is to develop a theoretical and computational framework for (1) connecting models of coupled reactive transport from pore-scale processes to field-scale bioremediation through a hierarchy of models that maintain crucial information from the smaller scales at the larger scales; and (2) quantifying the uncertainty that is introduced by both the upscaling process and uncertainty in physical parameters. One of the challenges of addressing scale-dependent effects of coupled processes in heterogeneous porous media is the problem-specificity of solutions. Much effort has been aimed at developing generalized scaling laws or theories, but these require restrictive assumptions that render them ineffective in many real problems. We propose instead an approach that applies physical and numerical experiments at small scales (specifically the pore scale) to a selected model system in order to identify the scaling approach appropriate to that type of problem. Although the results of such studies will
Qin, QinBo; Wang, Juan; Wang, YuDe; Liu, Yun; Liu, ShaoJun
2015-03-13
The offspring with 100 chromosomes (abbreviated as GRCC) have been obtained in the first generation of Carassius auratus red var. (abbreviated as RCC, 2n = 100) (♀) × Megalobrama amblycephala (abbreviated as BSB, 2n = 48) (♂), in which the females and unexpected males both are found. Chromosomal and karyotypic analysis has been reported in GRCC which gynogenesis origin has been suggested, but lack genetic evidence. Fluorescence in situ hybridization with species-specific centromere probes directly proves that GRCC possess two sets of RCC-derived chromosomes. Sequence analysis of the coding region (5S) and adjacent nontranscribed spacer (abbreviated as NTS) reveals that three types of 5S rDNA class (class I; class II and class III) in GRCC are completely inherited from their female parent (RCC), and show obvious base variations and insertions-deletions. Fluorescence in situ hybridization with the entire 5S rDNA probe reveals obvious chromosomal loci (class I and class II) variation in GRCC. This paper provides directly genetic evidence that GRCC is gynogenesis origin. In addition, our result is also reveals that distant hybridization inducing gynogenesis can lead to sequence and partial chromosomal loci of 5S rDNA gene obvious variation.
Directory of Open Access Journals (Sweden)
Didiek Sri Wiyono
2012-02-01
Full Text Available Ditinjau dari kajian Supply Chain Management (SCM, salah satu akar masalah pada bisnis komoditas padi paska-panen adalah masalah distribusi. Rendahnya tingkat aksesibilitas informasi ketersediaan komoditas bagi para stakeholder mengakibatkan proses distribusi tidak berjalan dengan baik, sehingga sering terjadi penumpukan komoditas maupun kekosongan komoditas di sisi yang lain. Permasalahan komunikasi dan koordinasi ini mengakibatkan distribusi komoditas padi tidak berjalan dengan baik sehingga sangat merugikan konsumen, petani dan semua pihak yang terlibat di dalam sistem SCM. Fokus penelitian ini adalah merancang model distribusi komoditas padi paska-panen. Rancangan model berbasis Supply Chain Management (SCM dipilih karena karakteristiknya dalam hal kemudahan interaksi antar stakeholder dinilai mampu menjawab permasalahan rendahnya tingkat aksesibilitas informasi ketersediaan komoditas. Proses perancangan dimulai dengan melakukan inventarisasi kebutuhan stakeholder hingga mendapatkan format yang sesuai dengan distribusi komoditas padi paska-panen. Selanjutnya dibuat System Requirement Specification (SRS dan diidentifikasi value chain dari komoditas padi paska-panen. SRS dan value chain yang telah didapat dijadikan dasar dalam merancang model distribusi dengan bantuan Use Case Model. Hasil penelitian ini berupa model bisnis yang komperhensif dari sebuah sistem distribusi komoditas padi paska-panen berbasis SCM yang telah disesuaikan dengan kebutuhan pengguna. Kata kunci: Supply Chain Management, komunikasi dan koordinasi, penyebaran informasi, model distribusi komoditas padi pascapanen. Abstract With the Supply Chain Management’s (SCM appoach, uncertaintly of rice, main commodity in agri-industry after-harvest paddy, supply and distribution which is giving a bad impact for consumers, farmers, and all who are involved in this business, found that root of the problems is minimum availability of comodities and accessibility of informations. These problems happened because uncertaintly and unavailability of accurate informations about inventory, demands and also products capacity form industries. By the advanced development of internet, web and mobile technologies, problems in creating, providing and deseminating of informations can be minimized by using appropriate application in SCM based information system that uses the advanced facilities of internet and mobile communication network which have been widely spead in Indonesia. Creating software requirement specifications (SRS, use case diagrams, class diagrams and comparing SRS with these diagrams, will be much helpfull for the designed processes to meet and fit with user needs. User interface and prototype of these applications, as a result, also introduced to the client and users to guarantee the fitness of the designed applications. Keywords: Supply Chain Management, comunication and coordinaton, sharing information, distribution model of after-harvest paddy
Directory of Open Access Journals (Sweden)
David M. Condon
2016-01-01
Full Text Available These data were collected during the initial evaluation of the International Cognitive Ability Resource (ICAR project. ICAR is an international collaborative effort to develop open-source public-domain tools for cognitive ability assessment, including tools that can be administered in non-proctored environments (e.g., online administration and those which are based on automatic item generation algorithms. These data provide initial validation of the first four ICAR item types as reported in Condon & Revelle [1]. The 4 item types contain a total of 60 items: 9 Letter and Number Series items, 11 Matrix Reasoning items, 16 Verbal Reasoning items and 24 Three-dimensional Rotation items. Approximately 97,000 individuals were administered random subsets of these 60 items using the Synthetic Aperture Personality Assessment method between August 18, 2010 and May 20, 2013. The data are available in rdata and csv formats and are accompanied by documentation stored as a text file. Re-use potential includes a wide range of structural and item-level analyses.
Variational Multi-Scale method with spectral approximation of the sub-scales.
Dia, Ben Mansour; Chá con-Rebollo, Tomas
2015-01-01
A variational multi-scale method where the sub-grid scales are computed by spectral approximations is presented. It is based upon an extension of the spectral theorem to non necessarily self-adjoint elliptic operators that have an associated base
Scaling Techniques for Massive Scale-Free Graphs in Distributed (External) Memory
Pearce, Roger; Gokhale, Maya; Amato, Nancy M.
2013-01-01
We present techniques to process large scale-free graphs in distributed memory. Our aim is to scale to trillions of edges, and our research is targeted at leadership class supercomputers and clusters with local non-volatile memory, e.g., NAND Flash
Flynn, Tim
This 25-item scale for rating prekindergarten children concerns personal and cognitive skills. Directions for using the scale are provided. Personal skills include personal hygiene, communication skills, eating habits, relationships with the teacher, peer relations, and personal behavior. Cognitive skills rated are verbal skills, object…
Conditional maximum-entropy method for selecting prior distributions in Bayesian statistics
Abe, Sumiyoshi
2014-11-01
The conditional maximum-entropy method (abbreviated here as C-MaxEnt) is formulated for selecting prior probability distributions in Bayesian statistics for parameter estimation. This method is inspired by a statistical-mechanical approach to systems governed by dynamics with largely separated time scales and is based on three key concepts: conjugate pairs of variables, dimensionless integration measures with coarse-graining factors and partial maximization of the joint entropy. The method enables one to calculate a prior purely from a likelihood in a simple way. It is shown, in particular, how it not only yields Jeffreys's rules but also reveals new structures hidden behind them.
How does extracerebral trauma affect the clinical value of S100B measurements?
DEFF Research Database (Denmark)
Ohrt-Nissen, Søren; Friis-Hansen, Lennart; Dahl, Benny
2011-01-01
with head injury (MTHI), or no head injury (NHI). The primary aim was to assess if a significant difference in serum levels of S100B could be found between IHI and MTHI patients. Methods Patients (233) were primarily admitted to the trauma centre. Serum samples were drawn on admission and 6 h after...... trauma and then stored at -80°C until analysed. Variables included Abbreviated Injury Scale (AIS) for head trauma, Injury Severity Score (ISS) and 30-day survival. Results Two patients could not be classified. IHI occurred in 28, MTHI in 102 and NHI was found in 101. The median S100B concentrations...
Yupapin, Preecha
2013-01-01
The behavior of light in small scale optics or nano/micro optical devices has shown promising results, which can be used for basic and applied research, especially in nanoelectronics. Small Scale Optics presents the use of optical nonlinear behaviors for spins, antennae, and whispering gallery modes within micro/nano devices and circuits, which can be used in many applications. This book proposes a new design for a small scale optical device-a microring resonator device. Most chapters are based on the proposed device, which uses a configuration know as a PANDA ring resonator. Analytical and nu
International Nuclear Information System (INIS)
Dvali, Gia; Kolanovic, Marko; Nitti, Francesco; Gabadadze, Gregory
2002-01-01
We propose a framework in which the quantum gravity scale can be as low as 10 -3 eV. The key assumption is that the standard model ultraviolet cutoff is much higher than the quantum gravity scale. This ensures that we observe conventional weak gravity. We construct an explicit brane-world model in which the brane-localized standard model is coupled to strong 5D gravity of infinite-volume flat extra space. Because of the high ultraviolet scale, the standard model fields generate a large graviton kinetic term on the brane. This kinetic term 'shields' the standard model from the strong bulk gravity. As a result, an observer on the brane sees weak 4D gravity up to astronomically large distances beyond which gravity becomes five dimensional. Modeling quantum gravity above its scale by the closed string spectrum we show that the shielding phenomenon protects the standard model from an apparent phenomenological catastrophe due to the exponentially large number of light string states. The collider experiments, astrophysics, cosmology and gravity measurements independently point to the same lower bound on the quantum gravity scale, 10 -3 eV. For this value the model has experimental signatures both for colliders and for submillimeter gravity measurements. Black holes reveal certain interesting properties in this framework
Natural Scales in Geographical Patterns
Menezes, Telmo; Roth, Camille
2017-04-01
Human mobility is known to be distributed across several orders of magnitude of physical distances, which makes it generally difficult to endogenously find or define typical and meaningful scales. Relevant analyses, from movements to geographical partitions, seem to be relative to some ad-hoc scale, or no scale at all. Relying on geotagged data collected from photo-sharing social media, we apply community detection to movement networks constrained by increasing percentiles of the distance distribution. Using a simple parameter-free discontinuity detection algorithm, we discover clear phase transitions in the community partition space. The detection of these phases constitutes the first objective method of characterising endogenous, natural scales of human movement. Our study covers nine regions, ranging from cities to countries of various sizes and a transnational area. For all regions, the number of natural scales is remarkably low (2 or 3). Further, our results hint at scale-related behaviours rather than scale-related users. The partitions of the natural scales allow us to draw discrete multi-scale geographical boundaries, potentially capable of providing key insights in fields such as epidemiology or cultural contagion where the introduction of spatial boundaries is pivotal.
Oktariyanda, T. A.; Rahaju, T.
2018-01-01
The use of information technology by Surabaya City Government has generated various innovations of public services such as “e-Sapa Warga”, e-Commerce, “e-RT/RW”, e-Budgeting, e-Project, e-Procurement, “e-Pendidikan”. Among the many innovations, e-RT/RW (Rukun Tetangga / Rukun Warga) is an innovation that is quite prominent because there are still many areas that have not implemented. This research can be classified as literature review and critical research. The aims of this research are to describe and analyze e-government strategy in Surabaya City through e-RT / RW to improve public service quality. The result of this research is e-government strategy in Surabaya City through e-RT / RW is already relevant and in accordance with Goldsmith’s theory of e-government. The positive impact of the implementation of e-RT / RW is the increasing quality of public services to bring benefits to all citizens Surabaya City.
EKMEKLİK BUĞDAY ÇEŞİTLERİNDE FARKLI AZOT DOZLARININ BAZI VERİM ÖĞELERİ ÜZERİNE ETKİLERİ
MERT, Berkan; ÇİFTÇİ, Cemalettin; ATAK, Mehmet
2014-01-01
Bu araştırma, 2002 yılında Ankara Üniversitesi, Ziraat Fakültesi Araştırma Uygulama Çiftliğinde yürütülmüştür. Araştırma, bazı ekmeklik buğday çeşitlerinde farklı azot dozlarının bazı verim öğeleri üzerine etkilerini incelemek amacıyla kurulmuştur. Denemede, Gün-91, İkizce-96, Mızrak, Uzunyayla ve Yakar-99 ekmeklik buğday çeşitleri materyal olarak kullanılmıştır. Beş değişik azot dozu (2, 4, 6, 8 ve 10 kg/da N) kullanılmış olup, azotun yarısı ekimle birlikte kalan diğer yarısı da sapa kalkma ...
There is a need to develop scale explicit understanding of erosion to overcome existing conceptual and methodological flaws in our modelling methods currently applied to understand the process of erosion, transport and deposition at the catchment scale. These models need to be based on a sound under...
2007-03-01
that bone metastases of prostate cancer have an extensive bone resorptive component mediated by osteoclasts: resorption of the bone matrix provides...enhances protection by parenteral Mycobac- 795 terium bovis BCG immunization against pulmonary tuberculosis. 796 Infection and Immunity, 74, 4634–4643. 797...oncolysis; replicating adeno- virus; TIMP-2; tumor growth ABBReviATionS MMP matrix metalloproteinase TIMP-2 tissue inhibitor of metalloproteinases-2
DEFF Research Database (Denmark)
Lyra, Maria C. D. P.; Valsiner, Jaan
2011-01-01
of the future. We provide an empirical example of the process of abbreviation in mother-infant communication, and we analyse and discuss the characteristic transformation achievement encapsulated by this developmental step. The abbreviated format, abstract from its specific content of dyadic actions, emerges...... from the past history and projects into the future through the construction of the seeds of a “sign-manufacturer' in early communication process....
International Nuclear Information System (INIS)
Lysenko, W.P.
1986-01-01
Accelerator scaling laws how they can be generated, and how they are used are discussed. A scaling law is a relation between machine parameters and beam parameters. An alternative point of view is that a scaling law is an imposed relation between the equations of motion and the initial conditions. The relation between the parameters is obtained by requiring the beam to be matched. (A beam is said to be matched if the phase-space distribution function is a function of single-particle invariants of the motion.) Because of this restriction, the number of independent parameters describing the system is reduced. Using simple models for bunched- and unbunched-beam situations. Scaling laws are shown to determine the general behavior of beams in accelerators. Such knowledge is useful in design studies for new machines such as high-brightness linacs. The simple model presented shows much of the same behavior as a more detailed RFQ model
Energy Technology Data Exchange (ETDEWEB)
Jessee, Matthew Anderson [ORNL
2016-04-01
The SCALE Code System is a widely-used modeling and simulation suite for nuclear safety analysis and design that is developed, maintained, tested, and managed by the Reactor and Nuclear Systems Division (RNSD) of Oak Ridge National Laboratory (ORNL). SCALE provides a comprehensive, verified and validated, user-friendly tool set for criticality safety, reactor and lattice physics, radiation shielding, spent fuel and radioactive source term characterization, and sensitivity and uncertainty analysis. Since 1980, regulators, licensees, and research institutions around the world have used SCALE for safety analysis and design. SCALE provides an integrated framework with dozens of computational modules including three deterministic and three Monte Carlo radiation transport solvers that are selected based on the desired solution strategy. SCALE includes current nuclear data libraries and problem-dependent processing tools for continuous-energy (CE) and multigroup (MG) neutronics and coupled neutron-gamma calculations, as well as activation, depletion, and decay calculations. SCALE includes unique capabilities for automated variance reduction for shielding calculations, as well as sensitivity and uncertainty analysis. SCALE’s graphical user interfaces assist with accurate system modeling, visualization of nuclear data, and convenient access to desired results.SCALE 6.2 provides many new capabilities and significant improvements of existing features.New capabilities include:• ENDF/B-VII.1 nuclear data libraries CE and MG with enhanced group structures,• Neutron covariance data based on ENDF/B-VII.1 and supplemented with ORNL data,• Covariance data for fission product yields and decay constants,• Stochastic uncertainty and correlation quantification for any SCALE sequence with Sampler,• Parallel calculations with KENO,• Problem-dependent temperature corrections for CE calculations,• CE shielding and criticality accident alarm system analysis with MAVRIC,• CE
An evaluation of a pre-scaling gel (SofScale) on the ease of supragingival calculus removal.
Smith, S R; Foyle, D M; Daniels, J
1994-09-01
SofScale is a pre-scaling gel, containing disodium EDTA and sodium lauryl sulphate, which is claimed to soften calculus and therefore facilitate its removal. 31 subjects were treated in a double blind randomised placebo controlled split mouth study to evaluate this product. Test or placebo gels were applied to the lingual surfaces of the mandibular teeth for 4 min and the time taken to complete the removal of supragingival calculus recorded. The operator recorded on which side the calculus was considered easier to remove and the patient indicated how comfortable the scaling had been. The mean calculus index was 1.99 for the SofScale group and 1.97 for the placebo. The mean time taken to complete scaling was 5.31 min for both groups. Using the Student t-test, there were no statistically significant differences (p > 0.7) between either the calculus index or time taken to complete the scaling between the groups. The operator did not consider SofScale to facilitate calculus removal and patients did not find calculus removal more comfortable when SofScale had been used. There was no increased sensitivity in the SofScale group following scaling. The results of this study do not support the use of SofScale as an adjunct to scaling.
An abbreviated history of osseous surgery.
Rudy, Robert J; Marcuschamer, Eduardo
2011-01-01
Various forms of periodontal therapy, including surgery, have been advocated and documented in the dental literature during the last three centuries. This variety of treatment modalities has been developed to address the anatomical consequences (pocket formation and bone loss) sustained from chronic periodontal disease. The marked differences in techniques have created significant controversies between the greatest leaders in dentistry and their equally influential disciples. Nevertheless, these leaders have always shared a common goal: the preservation of the natural dentition in a harmonious environment of health, comfort, and proper function. This article discusses the history of periodontal osseous surgery, including not only the technical issues, but also the conceptual underpinnings of this form of therapeutic intervention. In the process of examining this subject closely, three main controversies in the field of periodontics are brought into sharper focus: non-surgical versus surgical periodontal therapy; gingivectomy versus osseous resective periodontal therapy; and the nature of clinical decision-making: scientific and evidenced-based versus subjective clinical judgement.
40 CFR 86.094-3 - Abbreviations.
2010-07-01
..., and for 1985 and Later Model Year New Gasoline Fueled, Natural Gas-Fueled, Liquefied Petroleum Gas... of this part, and have the following meanings: ALVW—Adjusted Loaded Vehicle Weight LPG—Liquefied Petroleum Gas NMHC—Nonmethane Hydrocarbons NMHCE—Non-Methane Hydrocarbon Equivalent PM—Particulate Matter...
40 CFR 86.1703-99 - Abbreviations.
2010-07-01
... the Voluntary National Low Emission Vehicle Program for Light-Duty Vehicles and Light-Duty Trucks § 86...—hybrid electric vehicle. LEV—low emission vehicle. NMOG—non-methane organic gases. NTR—Northeast Trading...
COMOPTEVFOR Acronym and Abbreviation List (CAAL).
1981-10-01
Control AFCS Automatic Flight Control System AD Acoustic Firing Device AFEWC Air Force Electronic Warfare Center * AFETR Air Force Eastern Test Range...Dressing Station * BE Bearing Error BER Bit Effectiveness Report Bit Error Rate BETA Battlefield Exploitation and Target Acquisition BFDL Blue Force...System Command Destruct System CDSS Command Decision Subsystem CE Cost Effectiveness Critical Examination CEB CNO Executive Board CEI Communications
77 FR 7546 - Definitions and Abbreviations
2012-02-13
... Act of 1995 (44 U.S.C. Chapter 35). E-Government Act Compliance Rural Development is committed to complying with the E-Government Act, to promote the use of the Internet and other information technologies... comments to this proposed rule by any of the following methods: Federal eRulemaking Portal: http://www...
77 FR 7517 - Definitions and Abbreviations
2012-02-13
... Paperwork Reduction Act of 1995 (44 U.S.C. Chapter 35). E-Government Act Compliance Rural Development is committed to complying with the E-Government Act, to promote the use of the Internet and other information... following methods: Federal eRulemaking Portal: http://www.regulations.gov . Follow the instructions for...
40 CFR 86.078-3 - Abbreviations.
2010-07-01
..., and for 1985 and Later Model Year New Gasoline Fueled, Natural Gas-Fueled, Liquefied Petroleum Gas... feet per hour. CFV—Critical flow venturi. CFV-CVS—Critical flow venturi—constant volume sampler... pump—constant volume sampler. ppm—parts per million by volume. ppm C—parts per million, carbon. psi...
Development of a Scale for Domain General Perceived Control Scale Primary School ChildrensAND#8217;
Directory of Open Access Journals (Sweden)
Esra Dereli
2012-06-01
Full Text Available SUMMARY AIM: This study aimed to develop a scale to measure domain general perceived control scale for elementary age children. METHOD: Participants were a total of 341 primary school children, 4th and f4th grade for 152 students, 6th, 7th and 8th grade for 162 students aged between 10-14.Skinner (1996, perceived control based on the theory is created 12-item scale of perceived control of the general form of the trial for primary education children and this form, within the scope of the research subjects, are given in order to make the validity and reliability studies. In order to test the validity of the scale developed, Satisfaction with Life was used. This scale was developed by Diener et al. (1985 and adapted into Turkish by Yetim (1993. RESULTS:Exploratory and confirmatory factor analysises and certain reliability analyses were used in the study. As a result of the analysis, four Likert-type five items scale were obtained. The findings revealed one -dimensional scale, 46.35% of whose variance was explained. Cronbach’s coefficient alpha provided evidence for the internal consistency of the exploratory the Scale. The reliability of the scale was 0.70 and indicated that the 5 item scale had good internal consistency for the sample. CONCLUSION: The scale that resulted was given the title “Scale for Primary School Children’ Time Orientation during Classroom Disengagement”. This instrument may be used in various studies in the future, thus contributing to the development of the field. [TAF Prev Med Bull 2012; 11(3.000: 331-338
Contact kinematics of biomimetic scales
Energy Technology Data Exchange (ETDEWEB)
Ghosh, Ranajay; Ebrahimi, Hamid; Vaziri, Ashkan, E-mail: vaziri@coe.neu.edu [Department of Mechanical and Industrial Engineering, Northeastern University, Boston, Massachusetts 02115 (United States)
2014-12-08
Dermal scales, prevalent across biological groups, considerably boost survival by providing multifunctional advantages. Here, we investigate the nonlinear mechanical effects of biomimetic scale like attachments on the behavior of an elastic substrate brought about by the contact interaction of scales in pure bending using qualitative experiments, analytical models, and detailed finite element (FE) analysis. Our results reveal the existence of three distinct kinematic phases of operation spanning linear, nonlinear, and rigid behavior driven by kinematic interactions of scales. The response of the modified elastic beam strongly depends on the size and spatial overlap of rigid scales. The nonlinearity is perceptible even in relatively small strain regime and without invoking material level complexities of either the scales or the substrate.
Resiliency Scale (RS): Scale Development, Reliability and Validity Study
GÜRGAN, Uğur
2003-01-01
The purpose of this study was to develop a new Resiliency Scale (RS) for Turkish samples. Various items from some major resiliency scales, most of them with some partial change, were collected and a pool of 228 items containing almost all possible resilience areas were obtained. This item-pool was administered to a college sample of 419. Resulting of analysis 50 item RS were obtained and administered to a new college sample of 112 participants. This second sample has also received the Rosenba...
International Nuclear Information System (INIS)
1999-01-01
The principal objective of the project was to participate in the definition of a new IEA task concerning solar procurement (''the Task'') and to assess whether involvement in the task would be in the interest of the UK active solar heating industry. The project also aimed to assess the importance of large scale solar purchasing to UK active solar heating market development and to evaluate the level of interest in large scale solar purchasing amongst potential large scale purchasers (in particular housing associations and housing developers). A further aim of the project was to consider means of stimulating large scale active solar heating purchasing activity within the UK. (author)
Semerci, Nuriye
2000-01-01
The main purpose of this study is to develop the scale for critical thinking. The Scale of Critical Thinking was applied to 200 student. In this scale, there are total 55 items, four of which are negative and 51 of which are positive. The KMO (Kaiser-Meyer-Olkin) value is 0.75, the Bartlett test value is 7145.41, and the Cronbach Alpha value is 0.90.
Queiros-Conde, D.; Foucher, F.; Mounaïm-Rousselle, C.; Kassem, H.; Feidt, M.
2008-12-01
Multi-scale features of turbulent flames near a wall display two kinds of scale-dependent fractal features. In scale-space, an unique fractal dimension cannot be defined and the fractal dimension of the front is scale-dependent. Moreover, when the front approaches the wall, this dependency changes: fractal dimension also depends on the wall-distance. Our aim here is to propose a general geometrical framework that provides the possibility to integrate these two cases, in order to describe the multi-scale structure of turbulent flames interacting with a wall. Based on the scale-entropy quantity, which is simply linked to the roughness of the front, we thus introduce a general scale-entropy diffusion equation. We define the notion of “scale-evolutivity” which characterises the deviation of a multi-scale system from the pure fractal behaviour. The specific case of a constant “scale-evolutivity” over the scale-range is studied. In this case, called “parabolic scaling”, the fractal dimension is a linear function of the logarithm of scale. The case of a constant scale-evolutivity in the wall-distance space implies that the fractal dimension depends linearly on the logarithm of the wall-distance. We then verified experimentally, that parabolic scaling represents a good approximation of the real multi-scale features of turbulent flames near a wall.
Banavar, Jayanth
2009-03-01
The unity of life is expressed not only in the universal basis of inheritance and energetics at the molecular level, but also in the pervasive scaling of traits with body size at the whole-organism level. More than 75 years ago, Kleiber and Brody and Proctor independently showed that the metabolic rates, B, of mammals and birds scale as the three-quarter power of their mass, M. Subsequent studies showed that most biological rates and times scale as M-1/4 and M^1/4 respectively, and that these so called quarter-power scaling relations hold for a variety of organisms, from unicellular prokaryotes and eukaryotes to trees and mammals. The wide applicability of Kleiber's law, across the 22 orders of magnitude of body mass from minute bacteria to giant whales and sequoias, raises the hope that there is some simple general explanation that underlies the incredible diversity of form and function. We will present a general theoretical framework for understanding the relationship between metabolic rate, B, and body mass, M. We show how the pervasive quarter-power biological scaling relations arise naturally from optimal directed resource supply systems. This framework robustly predicts that: 1) whole organism power and resource supply rate, B, scale as M^3/4; 2) most other rates, such as heart rate and maximal population growth rate scale as M-1/4; 3) most biological times, such as blood circulation time and lifespan, scale as M^1/4; and 4) the average velocity of flow through the network, v, such as the speed of blood and oxygen delivery, scales as M^1/12. Our framework is valid even when there is no underlying network. Our theory is applicable to unicellular organisms as well as to large animals and plants. This work was carried out in collaboration with Amos Maritan along with Jim Brown, John Damuth, Melanie Moses, Andrea Rinaldo, and Geoff West.
Directory of Open Access Journals (Sweden)
J.-I. Yano
2012-11-01
Full Text Available A generalized mass-flux formulation is presented, which no longer takes a limit of vanishing fractional areas for subgrid-scale components. The presented formulation is applicable to a~situation in which the scale separation is still satisfied, but fractional areas occupied by individual subgrid-scale components are no longer small. A self-consistent formulation is presented by generalizing the mass-flux formulation under the segmentally-constant approximation (SCA to the grid–scale variabilities. The present formulation is expected to alleviate problems arising from increasing resolutions of operational forecast models without invoking more extensive overhaul of parameterizations.
The present formulation leads to an analogy of the large-scale atmospheric flow with multi-component flows. This analogy allows a generality of including any subgrid-scale variability into the mass-flux parameterization under SCA. Those include stratiform clouds as well as cold pools in the boundary layer.
An important finding under the present formulation is that the subgrid-scale quantities are advected by the large-scale velocities characteristic of given subgrid-scale components (large-scale subcomponent flows, rather than by the total large-scale flows as simply defined by grid-box average. In this manner, each subgrid-scale component behaves as if like a component of multi-component flows. This formulation, as a result, ensures the lateral interaction of subgrid-scale variability crossing the grid boxes, which are missing in the current parameterizations based on vertical one-dimensional models, and leading to a reduction of the grid-size dependencies in its performance. It is shown that the large-scale subcomponent flows are driven by large-scale subcomponent pressure gradients. The formulation, as a result, furthermore includes a self-contained description of subgrid-scale momentum transport.
The main purpose of the present paper
Compte, Emilio J; Sepúlveda, Ana R; de Pellegrin, Yolanda; Blanco, Miriam
2015-06-01
Several studies have demonstrated that men express body dissatisfaction differently than women. Although specific instruments that address body dissatisfaction in men have been developed, only a few have been validated in Latin-American male populations. The aim of this study was to reassess the factor structure of the Spanish versions of the Drive for Muscularity Scale (DMS-S) and the Male Body Attitudes Scale (MBAS-S) in an Argentinian sample. A cross-sectional study was conducted among 423 male students to examine: the factorial structure (confirmatory factor analysis), the internal consistency reliability, and the concurrent, convergent and discriminant validity of both scales. Results replicated the two factor structures for the DMS-S and MBAS-S. Both scales showed excellent levels of internal consistency, and various measures of construct validity indicated that the DMS-S and MBAS-S were acceptable and valid instruments to assess body dissatisfaction in Argentinian males. Copyright © 2015 Elsevier Ltd. All rights reserved.
Universal Scaling Relations in Scale-Free Structure Formation
Guszejnov, Dávid; Hopkins, Philip F.; Grudić, Michael Y.
2018-04-01
A large number of astronomical phenomena exhibit remarkably similar scaling relations. The most well-known of these is the mass distribution dN/dM∝M-2 which (to first order) describes stars, protostellar cores, clumps, giant molecular clouds, star clusters and even dark matter halos. In this paper we propose that this ubiquity is not a coincidence and that it is the generic result of scale-free structure formation where the different scales are uncorrelated. We show that all such systems produce a mass function proportional to M-2 and a column density distribution with a power law tail of dA/d lnΣ∝Σ-1. In the case where structure formation is controlled by gravity the two-point correlation becomes ξ2D∝R-1. Furthermore, structures formed by such processes (e.g. young star clusters, DM halos) tend to a ρ∝R-3 density profile. We compare these predictions with observations, analytical fragmentation cascade models, semi-analytical models of gravito-turbulent fragmentation and detailed "full physics" hydrodynamical simulations. We find that these power-laws are good first order descriptions in all cases.
Oishi, Sana; Kimura, Shin-Ichiro; Noguchi, Shuji; Kondo, Mio; Kondo, Yosuke; Shimokawa, Yoshiyuki; Iwao, Yasunori; Itai, Shigeru
2018-01-15
A new scale-down methodology from commercial rotary die scale to laboratory scale was developed to optimize a plant-derived soft gel capsule formulation and eventually manufacture superior soft gel capsules on a commercial scale, in order to reduce the time and cost for formulation development. Animal-derived and plant-derived soft gel film sheets were prepared using an applicator on a laboratory scale and their physicochemical properties, such as tensile strength, Young's modulus, and adhesive strength, were evaluated. The tensile strength of the animal-derived and plant-derived soft gel film sheets was 11.7 MPa and 4.41 MPa, respectively. The Young's modulus of the animal-derived and plant-derived soft gel film sheets was 169 MPa and 17.8 MPa, respectively, and both sheets showed a similar adhesion strength of approximately 4.5-10 MPa. Using a D-optimal mixture design, plant-derived soft gel film sheets were prepared and optimized by varying their composition, including variations in the mass of κ-carrageenan, ι-carrageenan, oxidized starch and heat-treated starch. The physicochemical properties of the sheets were evaluated to determine the optimal formulation. Finally, plant-derived soft gel capsules were manufactured using the rotary die method and the prepared soft gel capsules showed equivalent or superior physical properties compared with pre-existing soft gel capsules. Therefore, we successfully developed a new scale-down methodology to optimize the formulation of plant-derived soft gel capsules on a commercial scale. Copyright © 2017 Elsevier B.V. All rights reserved.
Scale Construction: Motivation and Relationship Scale in Education
Directory of Open Access Journals (Sweden)
Yunus Emre Demir
2016-01-01
Full Text Available The aim of this study is to analyze the validity and reliability of the Turkish version of Motivation and Relationship Scale (MRS, (Raufelder , Drury , Jagenow , Hoferichter & Bukowski , 2013.Participants were 526 students of secondary school. The results of confirmatory factor analysis described that the 21 items loaded three factor and the three-dimensional model was well fit (x2= 640.04, sd= 185, RMSEA= .068, NNFI= .90, CFI = .91, IFI=.91,SRMR=079, GFI= .90,AGFI=.87. Overall findings demonstrated that this scale is a valid and indicates that the adapted MRS is a valid instrument for measuring secondary school children’s motivation in Turkey.
Development of a Facebook Addiction Scale.
Andreassen, Cecilie Schou; Torsheim, Torbjørn; Brunborg, Geir Scott; Pallesen, Ståle
2012-04-01
The Bergen Facebook Addiction Scale (BFAS), initially a pool of 18 items, three reflecting each of the six core elements of addiction (salience, mood modification, tolerance, withdrawal, conflict, and relapse), was constructed and administered to 423 students together with several other standardized self-report scales (Addictive Tendencies Scale, Online Sociability Scale, Facebook Attitude Scale, NEO-FFI, BIS/BAS scales, and Sleep questions). That item within each of the six addiction elements with the highest corrected item-total correlation was retained in the final scale. The factor structure of the scale was good (RMSEA = .046, CFI = .99) and coefficient alpha was .83. The 3-week test-retest reliability coefficient was .82. The scores converged with scores for other scales of Facebook activity. Also, they were positively related to Neuroticism and Extraversion, and negatively related to Conscientiousness. High scores on the new scale were associated with delayed bedtimes and rising times.
The Tobacco Control Scale: a new scale to measure country activity.
Joossens, L; Raw, M
2006-06-01
To quantify the implementation of tobacco control policies at country level using a new Tobacco Control Scale and to report initial results using the scale. A questionnaire sent to correspondents in 30 European countries, using a scoring system designed with the help of a panel of international tobacco control experts. The 30 countries are ranked by their total score on the scale out of a maximum possible score of 100. Only four countries (Ireland, United Kingdom, Norway, Iceland) scored 70 or more, with an eight point gap (most differences in scores are small) to the fifth country, Malta, on 62. Only 13 countries scored above 50, 11 of them from the European Union (EU), and the second largest points gap occurs between Denmark on 45 and Portugal on 39, splitting the table into three groups: 70 and above, 45 to 62, 39 and below. Ireland had the highest overall score, 74 out of 100, and Luxembourg was bottom with 26 points. However even Ireland, much praised for their ban on smoking in public places, did not increase tobacco taxes in 2005, for the first time since 1995. Although the Tobacco Control Scale has limitations, this is the first time such a scale has been developed and applied to so many countries. We hope it will be useful in encouraging countries to strengthen currently weak areas of their tobacco control policy.
International Nuclear Information System (INIS)
Liu Lianshou; Zhang Yang; Wu Yuanfang
1996-01-01
The anomalous scaling of factorial moments with continuously diminishing scale is studied using a random cascading model. It is shown that the model currently used have the property of anomalous scaling only for descrete values of elementary cell size. A revised model is proposed which can give good scaling property also for continuously varying scale. It turns out that the strip integral has good scaling property provided the integral regions are chosen correctly, and that this property is insensitive to the concrete way of self-similar subdivision of phase space in the models. (orig.)
Interim reliability evaluation program, Browns Ferry fault trees
International Nuclear Information System (INIS)
Stewart, M.E.
1981-01-01
An abbreviated fault tree method is used to evaluate and model Browns Ferry systems in the Interim Reliability Evaluation programs, simplifying the recording and displaying of events, yet maintaining the system of identifying faults. The level of investigation is not changed. The analytical thought process inherent in the conventional method is not compromised. But the abbreviated method takes less time, and the fault modes are much more visible
Society Catalog Information - Society Catalog | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available n DOI 10.18908/lsdba.nbdc00963-001 Description of data contents Information of the academic societies in Jap...tion URL Website URL for the society Name Society name Abbreviation Abbreviation for the societ...y name Class Classification for the society Membership fee Membership fee Academy remarks Acad...me for the academic journal published by the society Academic journal: Language of text Language of text for
Energy Technology Data Exchange (ETDEWEB)
Pivovar, Bryan
2017-03-31
Final report from the H2@Scale Workshop held November 16-17, 2016, at the National Renewable Energy Laboratory in Golden, Colorado. The U.S. Department of Energy's National Renewable Energy Laboratory hosted a technology workshop to identify the current barriers and research needs of the H2@Scale concept. H2@Scale is a concept regarding the potential for wide-scale impact of hydrogen produced from diverse domestic resources to enhance U.S. energy security and enable growth of innovative technologies and domestic industries. Feedback received from a diverse set of stakeholders at the workshop will guide the development of an H2@Scale roadmap for research, development, and early stage demonstration activities that can enable hydrogen as an energy carrier at a national scale.
The Development of Marital Maturity Scale
Directory of Open Access Journals (Sweden)
Muhammed YILDIZ
2017-06-01
Full Text Available In this study, validity, reliability and item analysis studies of the Marital Maturity Scale prepared to test whether individuals are ready for marriage have been done. Studies of the development of the scale were made on 623 individuals, consisting of single adults. In the validity studies of the scale, explanatory and confirmatory factor analyses and criterion related validity studies were performed. Factor analysis revealed that the scale had four dimensions. The four factors in the measurement account for 60.91% of the total variance. The factor loadings of the items in the scale range from 0.42 to 0.86. Inonu Marriage Attitude Scale was used in the criterion related validity studies. Correlation value of the two scales r=0.72 (p=0.000 was found significant. It was determined that the subscales of the scale had a significant correlation with the total scale. The cronbach alpha value of the first dimension of the scale was 0.85, the cronbach alpha value of the second dimension of the scale was 0.68, the cronbach alpha value of the third dimension of the scale was 0.80, the cronbach alpha value of the fourth dimension of the scale was 0.91 and the cronbach alpha value of the total scale was 0.90. Test retest results r=0.70, (p=0.000 were found significant. In the item analysis studies, it was revealed that in the lower 27% group, the individuals in the upper 27% group were significantly different in all items (p=0.000. The item total correlation value of the items in the scale was between 0.40 and 0.63. As a result of the assessments, it was concluded that the Marital Maturity Scale was a reliable and valid instrument to measure marital maturity of single adults
Local-scale and watershed-scale determinants of summertime urban stream temperatures
Derek B. Booth; Kristin A. Kraseski; C. Rhett. Jackson
2014-01-01
The influence of urbanization on the temperature of small streams is widely recognized, but these effects are confounded by the great natural variety of their contributing watersheds. To evaluate the relative importance of local-scale and watershed-scale factors on summer temperatures in urban streams, hundreds of near-instantaneous temperature measurements throughout...
The Adaptive Multi-scale Simulation Infrastructure
Energy Technology Data Exchange (ETDEWEB)
Tobin, William R. [Rensselaer Polytechnic Inst., Troy, NY (United States)
2015-09-01
The Adaptive Multi-scale Simulation Infrastructure (AMSI) is a set of libraries and tools developed to support the development, implementation, and execution of general multimodel simulations. Using a minimal set of simulation meta-data AMSI allows for minimally intrusive work to adapt existent single-scale simulations for use in multi-scale simulations. Support for dynamic runtime operations such as single- and multi-scale adaptive properties is a key focus of AMSI. Particular focus has been spent on the development on scale-sensitive load balancing operations to allow single-scale simulations incorporated into a multi-scale simulation using AMSI to use standard load-balancing operations without affecting the integrity of the overall multi-scale simulation.
Kuhlmann, Tim; Dantlgraber, Michael; Reips, Ulf-Dietrich
2017-12-01
Visual analogue scales (VASs) have shown superior measurement qualities in comparison to traditional Likert-type response scales in previous studies. The present study expands the comparison of response scales to properties of Internet-based personality scales in a within-subjects design. A sample of 879 participants filled out an online questionnaire measuring Conscientiousness, Excitement Seeking, and Narcissism. The questionnaire contained all instruments in both answer scale versions in a counterbalanced design. Results show comparable reliabilities, means, and SDs for the VAS versions of the original scales, in comparison to Likert-type scales. To assess the validity of the measurements, age and gender were used as criteria, because all three constructs have shown non-zero correlations with age and gender in previous research. Both response scales showed a high overlap and the proposed relationships with age and gender. The associations were largely identical, with the exception of an increase in explained variance when predicting age from the VAS version of Excitement Seeking (B10 = 1318.95, ΔR(2) = .025). VASs showed similar properties to Likert-type response scales in most cases.
Copper atomic-scale transistors.
Xie, Fangqing; Kavalenka, Maryna N; Röger, Moritz; Albrecht, Daniel; Hölscher, Hendrik; Leuthold, Jürgen; Schimmel, Thomas
2017-01-01
We investigated copper as a working material for metallic atomic-scale transistors and confirmed that copper atomic-scale transistors can be fabricated and operated electrochemically in a copper electrolyte (CuSO 4 + H 2 SO 4 ) in bi-distilled water under ambient conditions with three microelectrodes (source, drain and gate). The electrochemical switching-on potential of the atomic-scale transistor is below 350 mV, and the switching-off potential is between 0 and -170 mV. The switching-on current is above 1 μA, which is compatible with semiconductor transistor devices. Both sign and amplitude of the voltage applied across the source and drain electrodes ( U bias ) influence the switching rate of the transistor and the copper deposition on the electrodes, and correspondingly shift the electrochemical operation potential. The copper atomic-scale transistors can be switched using a function generator without a computer-controlled feedback switching mechanism. The copper atomic-scale transistors, with only one or two atoms at the narrowest constriction, were realized to switch between 0 and 1 G 0 ( G 0 = 2e 2 /h; with e being the electron charge, and h being Planck's constant) or 2 G 0 by the function generator. The switching rate can reach up to 10 Hz. The copper atomic-scale transistor demonstrates volatile/non-volatile dual functionalities. Such an optimal merging of the logic with memory may open a perspective for processor-in-memory and logic-in-memory architectures, using copper as an alternative working material besides silver for fully metallic atomic-scale transistors.
Dish/Stirling Hybrid-Receiver Sub-Scale Tests and Full-Scale Design
International Nuclear Information System (INIS)
Andraka, Charles; Bohn, Mark S.; Corey, John; Mehos, Mark; Moreno, James; Rawlinson, Scott
1999-01-01
We have designed and tested a prototype dish/Stirling hybrid-receiver combustion system. The system consists of a pre-mixed natural-gas burner heating a pin-finned sodium heat pipe. The design emphasizes simplicity, low cost, and ruggedness. Our test was on a 1/6 th -scale device, with a nominal firing rate of 18kWt, a power throughput of 13kWt, and a sodium vapor temperature of 750 ampersand deg;C. The air/fuel mixture was electrically preheated to 640 ampersand deg;C to simulate recuperation. The test rig was instrumented for temperatures, pressures, flow rates, overall leak rate, and exhaust emissions. The data verify our burner and heat-transfer models. Performance and post-test examinations validate our choice of materials and fabrication methods. Based on the 1/6 th -scale results, we are designing a till-scale hybrid receiver. This is a fully-integrated system, including burner, pin-fin primary heat exchanger, recuperator (in place of the electrical pre-heater used in the prototype system), solar absorber, and sodium heat pipe. The major challenges of the design are to avoid pre-ignition, achieve robust heat-pipe performance, and attain long life of the burner matrix, recuperator, and flue-gas seals. We have used computational fluid dynamics extensively in designing to avoid pre-ignition and for designing the heat-pipe wick, and we have used individual component tests and results of the 1/6 th -scale test to optimize for long life. In this paper, we present our design philosophy and basic details of our design. We describe the sub-scale test rig and compare test results with predictions. Finally, we outline the evolution of our full-scale design, and present its current status
Lovejoy, S.; del Rio Amador, L.; Hébert, R.
2015-03-01
At scales of ≈ 10 days (the lifetime of planetary scale structures), there is a drastic transition from high frequency weather to low frequency macroweather. This scale is close to the predictability limits of deterministic atmospheric models; so that in GCM macroweather forecasts, the weather is a high frequency noise. But neither the GCM noise nor the GCM climate is fully realistic. In this paper we show how simple stochastic models can be developped that use empirical data to force the statistics and climate to be realistic so that even a two parameter model can outperform GCM's for annual global temperature forecasts. The key is to exploit the scaling of the dynamics and the enormous stochastic memories that it implies. Since macroweather intermittency is low, we propose using the simplest model based on fractional Gaussian noise (fGn): the Scaling LInear Macroweather model (SLIM). SLIM is based on a stochastic ordinary differential equations, differing from usual linear stochastic models (such as the Linear Inverse Modelling, LIM) in that it is of fractional rather than integer order. Whereas LIM implicitly assumes there is no low frequency memory, SLIM has a huge memory that can be exploited. Although the basic mathematical forecast problem for fGn has been solved, we approach the problem in an original manner notably using the method of innovations to obtain simpler results on forecast skill and on the size of the effective system memory. A key to successful forecasts of natural macroweather variability is to first remove the low frequency anthropogenic component. A previous attempt to use fGn for forecasts had poor results because this was not done. We validate our theory using hindcasts of global and Northern Hemisphere temperatures at monthly and annual resolutions. Several nondimensional measures of forecast skill - with no adjustable parameters - show excellent agreement with hindcasts and these show some skill even at decadal scales. We also compare
Directory of Open Access Journals (Sweden)
Dirk Zahn
Full Text Available Fracture mechanisms of an enamel-like hydroxyapatite-collagen composite model are elaborated by means of molecular and coarse-grained dynamics simulation. Using fully atomistic models, we uncover molecular-scale plastic deformation and fracture processes initiated at the organic-inorganic interface. Furthermore, coarse-grained models are developed to investigate fracture patterns at the μm-scale. At the meso-scale, micro-fractures are shown to reduce local stress and thus prevent material failure after loading beyond the elastic limit. On the basis of our multi-scale simulation approach, we provide a molecular scale rationalization of this phenomenon, which seems key to the resilience of hierarchical biominerals, including teeth and bone.
International Nuclear Information System (INIS)
Rearden, Bradley T.
2010-01-01
The Standardized Computer Analysis for Licensing Evaluation (SCALE) code system developed at Oak Ridge National Laboratory provides a comprehensive, verified and validated, user-friendly tool set for criticality safety, reactor physics, radiation shielding, and sensitivity and uncertainty analysis. For more than 30 years, regulators, licensees, and research institutions around the world have used SCALE for safety analysis and design. SCALE provides a 'plug-and-play' framework with nearly 80 computational modules, including three deterministic and three Monte Carlo radiation transport solvers that are selected based on the desired solution. SCALE's graphical user interfaces assist with accurate system modeling and convenient access to desired results. SCALE 6.1, scheduled for release in the fall of 2010, provides improved reliability and introduces a number of enhanced features, some of which are briefly described here. SCALE 6.1 provides state-of-the-art capabilities for criticality safety, reactor physics, and radiation shielding in a robust yet user-friendly package. The new features and improved reliability of this latest release of SCALE are intended to improve safety and efficiency throughout the nuclear community.
Sabatino, David A.; And Others
1995-01-01
This study determines the comparability of the Wechsler Intelligence Scale for Children-Revised and the Wechsler Intelligence Scale for Children-III in relation to gifted children. Results indicate that both tests produce remarkably similar scale and subtest scores when administered under clinical conditions. (JPS)
International Nuclear Information System (INIS)
Golokhvastov, A.I.; )
2001-01-01
A correct version of the KNO scaling of multiplicity distributions is discussed in detail. Some assertions on KNO-scaling violation based on the misinterpretation of experimental data behavior are analyzed. An accurate comparison with experiment is presented for the distributions of negative particles in e + e - annihilation at √S = 3 - 161 GeV, in inelastic pp interactions at √S = 2.4 - 62 GeV and in nucleus-nucleus interactions at p lab = 4.5 - 520 GeV/c per nucleon. The p-bar p data at √S 546 GeV are considered [ru
Jung, Lee Ann
2018-01-01
What is Goal Attainment Scaling? In this article, Lee Ann Jung defines it as a way to measure a student's progress toward an individualized goal. Instead of measuring a skill at a set time (for instance, on a test or other assignment), Goal Attainment Scaling tracks the steps a student takes over the course of a year in a targeted skill. Together,…
Rozental, Alexander; Forsell, Erik; Svensson, Andreas; Forsström, David; Andersson, Gerhard; Carlbring, Per
2014-01-01
Procrastination is a prevalent self-regulatory failure associated with stress and anxiety, decreased well-being, and poorer performance in school as well as work. One-fifth of the adult population and half of the student population describe themselves as chronic and severe procrastinators. However, despite the fact that it can become a debilitating condition, valid and reliable self-report measures for assessing the occurrence and severity of procrastination are lacking, particularly for use in a clinical context. The current study explored the usefulness of the Swedish version of three Internet-administered self-report measures for evaluating procrastination; the Pure Procrastination Scale, the Irrational Procrastination Scale, and the Susceptibility to Temptation Scale, all having good psychometric properties in English. In total, 710 participants were recruited for a clinical trial of Internet-based cognitive behavior therapy for procrastination. All of the participants completed the scales as well as self-report measures of depression, anxiety, and quality of life. Principal Component Analysis was performed to assess the factor validity of the scales, and internal consistency and correlations between the scales were also determined. Intraclass Correlation Coefficient, Minimal Detectable Change, and Standard Error of Measurement were calculated for the Irrational Procrastination Scale. The Swedish version of the scales have a similar factor structure as the English version, generated good internal consistencies, with Cronbach's α ranging between .76 to .87, and were moderately to highly intercorrelated. The Irrational Procrastination Scale had an Intraclass Correlation Coefficient of .83, indicating excellent reliability. Furthermore, Standard Error of Measurement was 1.61, and Minimal Detectable Change was 4.47, suggesting that a change of almost five points on the scale is necessary to determine a reliable change in self-reported procrastination severity. The
Barriers to activity and participation for stroke survivors in rural China.
Zhang, Lifang; Yan, Tiebin; You, Liming; Li, Kun
2015-07-01
To investigate environmental barriers reported by stroke survivors in the rural areas of China and to determine the impact of environmental barriers on activity and participation relative to demographic characteristics and body functioning. Cross-sectional survey. Structured interviews in the participants' homes. Community-dwelling stroke survivors in the rural areas of China (N=639). Not applicable. Activity and participation (Chinese version of the World Health Organization Disability Assessment Schedule 2.0), environmental barriers (Craig Hospital Inventory of Environmental Factors), neurological function (Canadian Neurological Scale), cognitive function (Abbreviated Mental Test), and depression (6-item Hamilton Rating Scale for Depression). Physical/structural barriers are the major impediment to activity and participation for these participants (odds ratio, 1.86 and 1.99 for activity and participation, respectively; Penvironmental barriers to be decreased and eliminated first. Copyright © 2015 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.
Fine, Eric M; Delis, Dean C; Holdnack, James
2011-11-01
The Delis-Kaplan Executive Function System (D-KEFS) Trail Making Test (TMT), a modification of the original TMT, was created to isolate set-shifting (Letter-Number Switching) from other component skills. This was accomplished by including four baseline conditions (Visual Scanning, Number Sequencing, Letter Sequencing, and Motor Speed) and by placing equal numbers of stimuli in the three sequencing conditions. Given that some studies with the original TMT demonstrated a significant effect of education and intellectual functioning on performance, we utilized the D-KEFS national standardization sample to examine the effects of education and vocabulary level-i.e., Vocabulary subtest from the Wechsler Abbreviated Scale of Intelligence (WASI)-on the D-KEFS TMT. The results indicate a significant effect of these variables on each D-KEFS TMT condition. Normative tables for education- and vocabulary-adjusted scaled scores based on the database from the D-KEFS national normative study were generated.
Atlantic Salmon Scale Measurements
National Oceanic and Atmospheric Administration, Department of Commerce — Scales are collected annually from smolt trapping operations in Maine as wellas other sampling opportunities (e.g. marine surveys, fishery sampling etc.). Scale...
Energy Technology Data Exchange (ETDEWEB)
Vanoost, D., E-mail: dries.vanoost@kuleuven-kulak.be [KU Leuven Technology Campus Ostend, ReMI Research Group, Oostende B-8400 (Belgium); KU Leuven Kulak, Wave Propagation and Signal Processing Research Group, Kortrijk B-8500 (Belgium); Steentjes, S. [Institute of Electrical Machines, RWTH Aachen University, Aachen D-52062 (Germany); Peuteman, J. [KU Leuven Technology Campus Ostend, ReMI Research Group, Oostende B-8400 (Belgium); KU Leuven, Department of Electrical Engineering, Electrical Energy and Computer Architecture, Heverlee B-3001 (Belgium); Gielen, G. [KU Leuven, Department of Electrical Engineering, Microelectronics and Sensors, Heverlee B-3001 (Belgium); De Gersem, H. [KU Leuven Kulak, Wave Propagation and Signal Processing Research Group, Kortrijk B-8500 (Belgium); TU Darmstadt, Institut für Theorie Elektromagnetischer Felder, Darmstadt D-64289 (Germany); Pissoort, D. [KU Leuven Technology Campus Ostend, ReMI Research Group, Oostende B-8400 (Belgium); KU Leuven, Department of Electrical Engineering, Microelectronics and Sensors, Heverlee B-3001 (Belgium); Hameyer, K. [Institute of Electrical Machines, RWTH Aachen University, Aachen D-52062 (Germany)
2016-09-15
This paper proposes a multi-scale energy-based material model for poly-crystalline materials. Describing the behaviour of poly-crystalline materials at three spatial scales of dominating physical mechanisms allows accounting for the heterogeneity and multi-axiality of the material behaviour. The three spatial scales are the poly-crystalline, grain and domain scale. Together with appropriate scale transitions rules and models for local magnetic behaviour at each scale, the model is able to describe the magneto-elastic behaviour (magnetostriction and hysteresis) at the macroscale, although the data input is merely based on a set of physical constants. Introducing a new energy density function that describes the demagnetisation field, the anhysteretic multi-scale energy-based material model is extended to the hysteretic case. The hysteresis behaviour is included at the domain scale according to the micro-magnetic domain theory while preserving a valid description for the magneto-elastic coupling. The model is verified using existing measurement data for different mechanical stress levels. - Highlights: • A ferromagnetic hysteretic energy-based multi-scale material model is proposed. • The hysteresis is obtained by new proposed hysteresis energy density function. • Avoids tedious parameter identification.
International Nuclear Information System (INIS)
Sommer, Rainer
2014-02-01
The principles of scale setting in lattice QCD as well as the advantages and disadvantages of various commonly used scales are discussed. After listing criteria for good scales, I concentrate on the main presently used ones with an emphasis on scales derived from the Yang-Mills gradient flow. For these I discuss discretisation errors, statistical precision and mass effects. A short review on numerical results also brings me to an unpleasant disagreement which remains to be explained.
Energy Technology Data Exchange (ETDEWEB)
Sommer, Rainer [DESY, Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC
2014-02-15
The principles of scale setting in lattice QCD as well as the advantages and disadvantages of various commonly used scales are discussed. After listing criteria for good scales, I concentrate on the main presently used ones with an emphasis on scales derived from the Yang-Mills gradient flow. For these I discuss discretisation errors, statistical precision and mass effects. A short review on numerical results also brings me to an unpleasant disagreement which remains to be explained.
Scaling structure loads for SMA
Energy Technology Data Exchange (ETDEWEB)
Lee, Dong Won; Song, Jeong Guk; Jeon, Sang Ho; Lim, Hak Kyu; Lee, Kwang Nam [KEPCO ENC, Yongin (Korea, Republic of)
2012-10-15
When the Seismic Margin Analysis(SMA) is conducted, the new structural load generation with Seismic Margin Earthquake(SME) is the time consuming work. For the convenience, EPRI NP 6041 suggests the scaling of the structure load. The report recommend that the fixed base(rock foundation) structure designed using either constant modal damping or modal damping ratios developed for a single material damping. For these cases, the SME loads can easily and accurately be calculated by scaling the spectral accelerations of the individual modes for the new SME response spectra. EPRI NP 6041 provides two simple methodologies for the scaling structure seismic loads which are the dominant frequency scaling methodology and the mode by mode scaling methodology. Scaling of the existing analysis to develop SME loads is much easier and more efficient than performing a new analysis. This paper is intended to compare the calculating results of two different methodologies.
Scaling structure loads for SMA
International Nuclear Information System (INIS)
Lee, Dong Won; Song, Jeong Guk; Jeon, Sang Ho; Lim, Hak Kyu; Lee, Kwang Nam
2012-01-01
When the Seismic Margin Analysis(SMA) is conducted, the new structural load generation with Seismic Margin Earthquake(SME) is the time consuming work. For the convenience, EPRI NP 6041 suggests the scaling of the structure load. The report recommend that the fixed base(rock foundation) structure designed using either constant modal damping or modal damping ratios developed for a single material damping. For these cases, the SME loads can easily and accurately be calculated by scaling the spectral accelerations of the individual modes for the new SME response spectra. EPRI NP 6041 provides two simple methodologies for the scaling structure seismic loads which are the dominant frequency scaling methodology and the mode by mode scaling methodology. Scaling of the existing analysis to develop SME loads is much easier and more efficient than performing a new analysis. This paper is intended to compare the calculating results of two different methodologies
International Nuclear Information System (INIS)
Sen, Oishik; Davis, Sean; Jacobs, Gustaaf; Udaykumar, H.S.
2015-01-01
The effectiveness of several metamodeling techniques, viz. the Polynomial Stochastic Collocation method, Adaptive Stochastic Collocation method, a Radial Basis Function Neural Network, a Kriging Method and a Dynamic Kriging Method is evaluated. This is done with the express purpose of using metamodels to bridge scales between micro- and macro-scale models in a multi-scale multimaterial simulation. The rate of convergence of the error when used to reconstruct hypersurfaces of known functions is studied. For sufficiently large number of training points, Stochastic Collocation methods generally converge faster than the other metamodeling techniques, while the DKG method converges faster when the number of input points is less than 100 in a two-dimensional parameter space. Because the input points correspond to computationally expensive micro/meso-scale computations, the DKG is favored for bridging scales in a multi-scale solver
Scaling in nuclear reactor system thermal-hydraulics
International Nuclear Information System (INIS)
D'Auria, F.; Galassi, G.M.
2010-01-01
Scaling is a reference 'key-word' in engineering and in physics. The relevance of scaling in the water cooled nuclear reactor technology constitutes the motivation for the present paper. The origin of the scaling-issue, i.e. the impossibility to get access to measured data in case of accident in nuclear reactors, is discussed at first. The so-called 'scaling-controversy' constitutes an outcome. Then, a critical survey (or 'scaling state-of-art';) is given of the attempts and of the approaches to provide a solution to the scaling-issue in the area of Nuclear Reactor System Thermal-Hydraulics (NRSTH): dimensionless design factors for Integral Test Facilities (ITF) are distinguished from scaling factors. The last part of the paper has a two-fold nature: (a) classifying the information about achievements in the area of thermal-hydraulics which are relevant to scaling: the concepts of 'scaling-pyramid' and the related 'scaling bridges' are introduced; (b) establishing a logical path across the scaling achievements (represented as a 'scaling puzzle'). In this context, the 'roadmap for scaling' is proposed: the objective is addressing the scaling issue when demonstrating the applicability of system codes in the licensing process of nuclear power plants. The code itself is referred hereafter as the 'key-to-scaling'. The database from the operation of properly scaled ITF and the availability of qualified system codes are identified as main achievements in NRSTH connected with scaling. The 'roadmap to scaling' constitutes a unified approach to scaling which aims at solving the 'scaling puzzle' created by researches performed during a half-a-century period.
Small Business Administration — SBA’s new ScaleUp America Initiative is designed to help small firms with high potential “scale up” and grow their businesses so that they will provide more jobs and...
Faster Parallel Traversal of Scale Free Graphs at Extreme Scale with Vertex Delegates
Pearce, Roger
2014-11-01
© 2014 IEEE. At extreme scale, irregularities in the structure of scale-free graphs such as social network graphs limit our ability to analyze these important and growing datasets. A key challenge is the presence of high-degree vertices (hubs), that leads to parallel workload and storage imbalances. The imbalances occur because existing partitioning techniques are not able to effectively partition high-degree vertices. We present techniques to distribute storage, computation, and communication of hubs for extreme scale graphs in distributed memory supercomputers. To balance the hub processing workload, we distribute hub data structures and related computation among a set of delegates. The delegates coordinate using highly optimized, yet portable, asynchronous broadcast and reduction operations. We demonstrate scalability of our new algorithmic technique using Breadth-First Search (BFS), Single Source Shortest Path (SSSP), K-Core Decomposition, and Page-Rank on synthetically generated scale-free graphs. Our results show excellent scalability on large scale-free graphs up to 131K cores of the IBM BG/P, and outperform the best known Graph500 performance on BG/P Intrepid by 15%
Faster Parallel Traversal of Scale Free Graphs at Extreme Scale with Vertex Delegates
Pearce, Roger; Gokhale, Maya; Amato, Nancy M.
2014-01-01
© 2014 IEEE. At extreme scale, irregularities in the structure of scale-free graphs such as social network graphs limit our ability to analyze these important and growing datasets. A key challenge is the presence of high-degree vertices (hubs), that leads to parallel workload and storage imbalances. The imbalances occur because existing partitioning techniques are not able to effectively partition high-degree vertices. We present techniques to distribute storage, computation, and communication of hubs for extreme scale graphs in distributed memory supercomputers. To balance the hub processing workload, we distribute hub data structures and related computation among a set of delegates. The delegates coordinate using highly optimized, yet portable, asynchronous broadcast and reduction operations. We demonstrate scalability of our new algorithmic technique using Breadth-First Search (BFS), Single Source Shortest Path (SSSP), K-Core Decomposition, and Page-Rank on synthetically generated scale-free graphs. Our results show excellent scalability on large scale-free graphs up to 131K cores of the IBM BG/P, and outperform the best known Graph500 performance on BG/P Intrepid by 15%
Scaling criteria for rock dynamic experiments
Energy Technology Data Exchange (ETDEWEB)
Crowley, Barbara K [Lawrence Radiation Laboratory, University of California, Livermore, CA (United States)
1970-05-01
A set of necessary conditions for performing scaled rock dynamics experiments is derived from the conservation equations of continuum mechanics. Performing scaled experiments in two different materials is virtually impossible because of the scaling restrictions imposed by two equations of state. However, performing dynamically scaled experiments in the same material is possible if time and distance use the same scaling factor and if the effects of gravity are insignificant. When gravity becomes significant, dynamic scaling is no longer possible. To illustrate these results, example calculations of megaton and kiloton experiments are considered. (author00.
Convergent Validity of Four Innovativeness Scales.
Goldsmith, Ronald E.
1986-01-01
Four scales of innovativeness were administered to two samples of undergraduate students: the Open Processing Scale, Innovativeness Scale, innovation subscale of the Jackson Personality Inventory, and Kirton Adaption-Innovation Inventory. Intercorrelations indicated the scales generally exhibited convergent validity. (GDC)
Ellis, John; Garcia, Marcos A. G.; Nanopoulos, Dimitri V.; Olive, Keith A.
2016-05-01
Supersymmetry is the most natural framework for physics above the TeV scale, and the corresponding framework for early-Universe cosmology, including inflation, is supergravity. No-scale supergravity emerges from generic string compactifications and yields a non-negative potential, and is therefore a plausible framework for constructing models of inflation. No-scale inflation yields naturally predictions similar to those of the Starobinsky model based on R+{R}2 gravity, with a tilted spectrum of scalar perturbations: {n}s∼ 0.96, and small values of the tensor-to-scalar perturbation ratio r\\lt 0.1, as favoured by Planck and other data on the cosmic microwave background (CMB). Detailed measurements of the CMB may provide insights into the embedding of inflation within string theory as well as its links to collider physics.
Ellis, John; Nanopoulos, Dimitri V.; Olive, Keith A.
2016-01-01
Supersymmetry is the most natural framework for physics above the TeV scale, and the corresponding framework for early-Universe cosmology, including inflation, is supergravity. No-scale supergravity emerges from generic string compactifications and yields a non-negative potential, and is therefore a plausible framework for constructing models of inflation. No-scale inflation yields naturally predictions similar to those of the Starobinsky model based on $R + R^2$ gravity, with a tilted spectrum of scalar perturbations: $n_s \\sim 0.96$, and small values of the tensor-to-scalar perturbation ratio $r < 0.1$, as favoured by Planck and other data on the cosmic microwave background (CMB). Detailed measurements of the CMB may provide insights into the embedding of inflation within string theory as well as its links to collider physics.
Large-scale exact diagonalizations reveal low-momentum scales of nuclei
Forssén, C.; Carlsson, B. D.; Johansson, H. T.; Sääf, D.; Bansal, A.; Hagen, G.; Papenbrock, T.
2018-03-01
Ab initio methods aim to solve the nuclear many-body problem with controlled approximations. Virtually exact numerical solutions for realistic interactions can only be obtained for certain special cases such as few-nucleon systems. Here we extend the reach of exact diagonalization methods to handle model spaces with dimension exceeding 1010 on a single compute node. This allows us to perform no-core shell model (NCSM) calculations for 6Li in model spaces up to Nmax=22 and to reveal the 4He+d halo structure of this nucleus. Still, the use of a finite harmonic-oscillator basis implies truncations in both infrared (IR) and ultraviolet (UV) length scales. These truncations impose finite-size corrections on observables computed in this basis. We perform IR extrapolations of energies and radii computed in the NCSM and with the coupled-cluster method at several fixed UV cutoffs. It is shown that this strategy enables information gain also from data that is not fully UV converged. IR extrapolations improve the accuracy of relevant bound-state observables for a range of UV cutoffs, thus making them profitable tools. We relate the momentum scale that governs the exponential IR convergence to the threshold energy for the first open decay channel. Using large-scale NCSM calculations we numerically verify this small-momentum scale of finite nuclei.
Acquisition of Telecommunications in the Navy from an Automatic Data Processing (ADP) Point of View.
1982-03-01
United States Air Force . F. DEFINITIONS AND ABBREVIATIONS The definitions and abbreviations list is attached as Appendix A. G. SUMMARY The different...responsible. Below is a list of Navy submitting authorities. [Ref. 12] Commander in Chief U.S. Naval Forces , Europe Commander in Chief U.S. Atlantic Fleet...the PPBS where OSD decisionmaking is keyed to the balancing of all programs within established DOD fiscal limits. Each majur AIS shall be submitted
Plague and Climate: Scales Matter
Ben Ari, Tamara; Neerinckx, Simon; Gage, Kenneth L.; Kreppel, Katharina; Laudisoit, Anne; Leirs, Herwig; Stenseth, Nils Chr.
2011-01-01
Plague is enzootic in wildlife populations of small mammals in central and eastern Asia, Africa, South and North America, and has been recognized recently as a reemerging threat to humans. Its causative agent Yersinia pestis relies on wild rodent hosts and flea vectors for its maintenance in nature. Climate influences all three components (i.e., bacteria, vectors, and hosts) of the plague system and is a likely factor to explain some of plague's variability from small and regional to large scales. Here, we review effects of climate variables on plague hosts and vectors from individual or population scales to studies on the whole plague system at a large scale. Upscaled versions of small-scale processes are often invoked to explain plague variability in time and space at larger scales, presumably because similar scale-independent mechanisms underlie these relationships. This linearity assumption is discussed in the light of recent research that suggests some of its limitations. PMID:21949648
International Symposia on Scale Modeling
Ito, Akihiko; Nakamura, Yuji; Kuwana, Kazunori
2015-01-01
This volume thoroughly covers scale modeling and serves as the definitive source of information on scale modeling as a powerful simplifying and clarifying tool used by scientists and engineers across many disciplines. The book elucidates techniques used when it would be too expensive, or too difficult, to test a system of interest in the field. Topics addressed in the current edition include scale modeling to study weather systems, diffusion of pollution in air or water, chemical process in 3-D turbulent flow, multiphase combustion, flame propagation, biological systems, behavior of materials at nano- and micro-scales, and many more. This is an ideal book for students, both graduate and undergraduate, as well as engineers and scientists interested in the latest developments in scale modeling. This book also: Enables readers to evaluate essential and salient aspects of profoundly complex systems, mechanisms, and phenomena at scale Offers engineers and designers a new point of view, liberating creative and inno...
Domestic Wastewater Reuse in Concrete Using Bench-Scale Testing and Full-Scale Implementation
Directory of Open Access Journals (Sweden)
Ayoup M. Ghrair
2016-08-01
Full Text Available Demand for fresh water by the construction sector is expected to increase due to the high increase in the growth of construction activities in Jordan. This study aims to evaluate the potential of scale-up of the application of treated domestic wastewater in concrete from bench-scale to a full-scale. On the lab scale, concrete and mortar mixes using Primary and Secondary Treated Wastewater (PTW, STW and Distilled Water (DW were cast and tested after various curing ages (7, 28, 120, and 200 days. Based on wastewater quality, according to IS 456-2000, the STW is suitable for mortar and concrete production. Mortar made with STW at curing time up to 200 days has no significant negative effect on the mortar’s compressive strength. Conversely, the PTW exceeded the maximum permissible limits of total organic content and E coli. for concrete mixing-water. Using PTW results, a significant increase in the initial setting time of up to 16.7% and a decrease in the concrete workability are observed. In addition, using PTW as mixing water led to a significant reduction in the compressive strength up to 19.6%. The results that came out from scaling up to real production operation of ready-mix concrete were in harmony with the lab-scale results.
van Duijvenbode, Neomi; Didden, Robert; van den Hazel, Teunis; Engels, Rutger C M E
2016-01-01
To investigate the reliability and validity of a Wechsler Abbreviated Scale of Intelligence-based Wechsler Adult Intelligence Scale - third edition (WAIS-III) short form (SF) in a sample of individuals with mild to borderline intellectual disability (MBID) (N = 117; M(IQ) = 71.34; SD(IQ) = 8.00, range: 52-85). A full WAIS-III was administered as a standard procedure in the diagnostic process. The results indicate an excellent reliability (r = 0.96) and a strong, positive correlation with the full WAIS-III (r = 0.89). The SF correctly identified ID in general and the correct IQ category more specifically in the majority of cases (97.4% and 86.3% of cases, respectively). In addition, 82.1% of the full scale IQ (FSIQ) estimates fell within the 95% confidence interval of the original score. We conclude that the SF is a reliable and valid measure to estimate FSIQ. It can be used in clinical and research settings when global estimates of intelligence are sufficient.
Ju, Yong Han; Sohn, So Young
2011-01-01
Injury analysis following a vehicle crash is one of the most important research areas. However, most injury analyses have focused on one-dimensional injury variables, such as the AIS (Abbreviated Injury Scale) or the IIS (Injury Impairment Scale), at a time in relation to various traffic accident factors. However, these studies cannot reflect the various injury phenomena that appear simultaneously. In this paper, we apply quantification method II to the NASS (National Automotive Sampling System) CDS (Crashworthiness Data System) to find the relationship between the categorical injury phenomena, such as the injury scale, injury position, and injury type, and the various traffic accident condition factors, such as speed, collision direction, vehicle type, and seat position. Our empirical analysis indicated the importance of safety devices, such as restraint equipment and airbags. In addition, we found that narrow impact, ejection, air bag deployment, and higher speed are associated with more severe than minor injury to the thigh, ankle, and leg in terms of dislocation, abrasion, or laceration. Copyright © 2010 Elsevier Ltd. All rights reserved.
Preliminary Identification of Coping Profiles Relevant to Surrogate Decision Making in the ICU.
Directory of Open Access Journals (Sweden)
Jorie M Butler
Full Text Available The Intensive Care Unit (ICU is a stressful environment for families of critically ill patients and these individuals are at risk to develop persistent psychological morbidity. Our study objective was to identify individual differences in coping with stress and information presentation preferences of respondents exposed to a simulated ICU experience.Participants were recruited from a university and two community populations. Participants completed questionnaires that measured demographic information and characteristics that may be relevant to an individual's ICU experience. Quality of life was measured by the EQ-5D, personality dimensions were examined with the abbreviated Big Five inventory, coping with stress was assessed with Brief COPE. Shared decision making preferences were assessed by the Degner Control Preferences Scale (CPS and information seeking style was assessed with the Miller Behavioral Style Scale (MBSS. Social support was examined using an abbreviated version of the Social Relationship Index. Participants also completed a vignette-based simulated ICU experience, in which they made a surrogate decision on behalf of a loved one in the ICU.Three hundred forty-three participants completed the study. Three distinct coping profiles were identified: adaptive copers, maladaptive copers, and disengaged copers. Profiles differed primarily on coping styles, personality, quality of their closest social relationship, and history of anxiety and depression. Responses to the simulated ICU decision making experience differed across profiles. Disengaged copers (15% were more likely to elect to refuse dialysis on behalf of an adult sibling compared to adaptive copers (7% or maladaptive copers (5% (p = 0.03. Notably, the MBSS and the CPS did not differ by coping profile.Distinct coping profiles are associated with differences in responses to a simulated ICU experience. Tailoring communication and support to specific coping profiles may represent an
Curtis, Gary P.; Kohler, Matthias; Kannappan, Ramakrishnan; Briggs, Martin A.; Day-Lewis, Frederick D.
2015-01-01
Scientifically defensible predictions of field scale U(VI) transport in groundwater requires an understanding of key processes at multiple scales. These scales range from smaller than the sediment grain scale (less than 10 μm) to as large as the field scale which can extend over several kilometers. The key processes that need to be considered include both geochemical reactions in solution and at sediment surfaces as well as physical transport processes including advection, dispersion, and pore-scale diffusion. The research summarized in this report includes both experimental and modeling results in batch, column and tracer tests. The objectives of this research were to: (1) quantify the rates of U(VI) desorption from sediments acquired from a uranium contaminated aquifer in batch experiments;(2) quantify rates of U(VI) desorption in column experiments with variable chemical conditions, and(3) quantify nonreactive tracer and U(VI) transport in field tests.
Dynamic inequalities on time scales
Agarwal, Ravi; Saker, Samir
2014-01-01
This is a monograph devoted to recent research and results on dynamic inequalities on time scales. The study of dynamic inequalities on time scales has been covered extensively in the literature in recent years and has now become a major sub-field in pure and applied mathematics. In particular, this book will cover recent results on integral inequalities, including Young's inequality, Jensen's inequality, Holder's inequality, Minkowski's inequality, Steffensen's inequality, Hermite-Hadamard inequality and Čebyšv's inequality. Opial type inequalities on time scales and their extensions with weighted functions, Lyapunov type inequalities, Halanay type inequalities for dynamic equations on time scales, and Wirtinger type inequalities on time scales and their extensions will also be discussed here in detail.
Posttraumatic Maladaptive Beliefs Scale: Evolution of the Personal Beliefs and Reactions Scale
Vogt, Dawne S.; Shipherd, Jillian C.; Resick, Patricia A.
2012-01-01
The Posttraumatic Maladaptive Beliefs Scale (PMBS) was developed to measure maladaptive beliefs about current life circumstances that may occur following trauma exposure. This scale assesses maladaptive beliefs within three domains: (a) Threat of Harm, (b) Self-Worth and Judgment, and (c) Reliability and Trustworthiness of Others. Items for the…
Lovejoy, S.; del Rio Amador, L.; Hébert, R.
2015-09-01
On scales of ≈ 10 days (the lifetime of planetary-scale structures), there is a drastic transition from high-frequency weather to low-frequency macroweather. This scale is close to the predictability limits of deterministic atmospheric models; thus, in GCM (general circulation model) macroweather forecasts, the weather is a high-frequency noise. However, neither the GCM noise nor the GCM climate is fully realistic. In this paper we show how simple stochastic models can be developed that use empirical data to force the statistics and climate to be realistic so that even a two-parameter model can perform as well as GCMs for annual global temperature forecasts. The key is to exploit the scaling of the dynamics and the large stochastic memories that we quantify. Since macroweather temporal (but not spatial) intermittency is low, we propose using the simplest model based on fractional Gaussian noise (fGn): the ScaLIng Macroweather Model (SLIMM). SLIMM is based on a stochastic ordinary differential equation, differing from usual linear stochastic models (such as the linear inverse modelling - LIM) in that it is of fractional rather than integer order. Whereas LIM implicitly assumes that there is no low-frequency memory, SLIMM has a huge memory that can be exploited. Although the basic mathematical forecast problem for fGn has been solved, we approach the problem in an original manner, notably using the method of innovations to obtain simpler results on forecast skill and on the size of the effective system memory. A key to successful stochastic forecasts of natural macroweather variability is to first remove the low-frequency anthropogenic component. A previous attempt to use fGn for forecasts had disappointing results because this was not done. We validate our theory using hindcasts of global and Northern Hemisphere temperatures at monthly and annual resolutions. Several nondimensional measures of forecast skill - with no adjustable parameters - show excellent
Scaling in nuclear reactor system thermal-hydraulics
Energy Technology Data Exchange (ETDEWEB)
D' Auria, F., E-mail: dauria@ing.unipi.i [Dipartimento di Ingegneria Meccanica, Nucleare e della Produzione, University of Pisa, Via Diotisalvi 2, 56126 Pisa (Italy); Galassi, G.M. [Dipartimento di Ingegneria Meccanica, Nucleare e della Produzione, University of Pisa, Via Diotisalvi 2, 56126 Pisa (Italy)
2010-10-15
Scaling is a reference 'key-word' in engineering and in physics. The relevance of scaling in the water cooled nuclear reactor technology constitutes the motivation for the present paper. The origin of the scaling-issue, i.e. the impossibility to get access to measured data in case of accident in nuclear reactors, is discussed at first. The so-called 'scaling-controversy' constitutes an outcome. Then, a critical survey (or 'scaling state-of-art';) is given of the attempts and of the approaches to provide a solution to the scaling-issue in the area of Nuclear Reactor System Thermal-Hydraulics (NRSTH): dimensionless design factors for Integral Test Facilities (ITF) are distinguished from scaling factors. The last part of the paper has a two-fold nature: (a) classifying the information about achievements in the area of thermal-hydraulics which are relevant to scaling: the concepts of 'scaling-pyramid' and the related 'scaling bridges' are introduced; (b) establishing a logical path across the scaling achievements (represented as a 'scaling puzzle'). In this context, the 'roadmap for scaling' is proposed: the objective is addressing the scaling issue when demonstrating the applicability of system codes in the licensing process of nuclear power plants. The code itself is referred hereafter as the 'key-to-scaling'. The database from the operation of properly scaled ITF and the availability of qualified system codes are identified as main achievements in NRSTH connected with scaling. The 'roadmap to scaling' constitutes a unified approach to scaling which aims at solving the 'scaling puzzle' created by researches performed during a half-a-century period.
Znamenny scale – fait accompli?
Directory of Open Access Journals (Sweden)
Alexei Yaropolov
2010-12-01
Full Text Available The author addresses one of the most sensitive topics of Znamenny chant: its scale. He tries to restore the “burned bridges” between ideographic and staff-notation of the Chant as he redefines and essentially generalizes the concept of scale as such. The possibility to artificially construct ad hoc many scales sounding sometimes very similar to the scale suggested by the modern staff-notation is a serious argument to regard the “staff-notation based” deciphering from the 17th century (dvoeznamenniki a pure game of chance. The constructed scales, presented in the paper, are different to “keyboard diatonica” and from one another and are never subject to the unified theorizing (unified nomenclature of degrees, etc. Critically commented is the practice to uncontrollably use the trivial pitch-symbols for deciphering, which ipso facto makes the probabilistic steps of unknown scales look as the ill-founded deviations from the diatonic scale steps, which are currently in use in the common musical education. This practice hinders the chance to acknowledge the right of the remote musical culture to rest on foundations that can be formulated both positively and explicitly, all the more so, as the usage of paleographic signs looks rather consistent. The resemblances and differences between musical cultures may be treated more liberally since no scale is seen a norm. The author is based on the writings of Russian musicologist and organologist Felix Raudonikas.
Directory of Open Access Journals (Sweden)
Mark D. Scherz
2017-02-01
Full Text Available The gecko genus Geckolepis, endemic to Madagascar and the Comoro archipelago, is taxonomically challenging. One reason is its members ability to autotomize a large portion of their scales when grasped or touched, most likely to escape predation. Based on an integrative taxonomic approach including external morphology, morphometrics, genetics, pholidosis, and osteology, we here describe the first new species from this genus in 75 years: Geckolepis megalepis sp. nov. from the limestone karst of Ankarana in northern Madagascar. The new species has the largest known body scales of any gecko (both relatively and absolutely, which come off with exceptional ease. We provide a detailed description of the skeleton of the genus Geckolepis based on micro-Computed Tomography (micro-CT analysis of the new species, the holotype of G. maculata, the recently resurrected G. humbloti, and a specimen belonging to an operational taxonomic unit (OTU recently suggested to represent G. maculata. Geckolepis is characterized by highly mineralized, imbricated scales, paired frontals, and unfused subolfactory processes of the frontals, among other features. We identify diagnostic characters in the osteology of these geckos that help define our new species and show that the OTU assigned to G. maculata is probably not conspecific with it, leaving the taxonomic identity of this species unclear. We discuss possible reasons for the extremely enlarged scales of G. megalepis in the context of an anti-predator defence mechanism, and the future of Geckolepis taxonomy.
Scaling: From quanta to nuclear reactors
Energy Technology Data Exchange (ETDEWEB)
Zuber, Novak, E-mail: rohatgi@bnl.go [703 New Mark Esplanade, Rockville, MD 20850 (United States)
2010-08-15
This paper has three objectives. The first objective is to show how the Einstein-de Broglie equation (EdB) can be extended to model and scale, via fractional scaling, both conservative and dissipative processes ranging in scale from quanta to nuclear reactors. The paper also discusses how and why a single equation and associated fractional scaling method generate for each process of change the corresponding scaling criterion. The versatility and capability of fractional scaling are demonstrated by applying it to: (a) particle dynamics, (b) conservative (Bernoulli) and dissipative (hydraulic jump) flows, (c) viscous and turbulent flows through rough and smooth pipes, and (d) momentum diffusion in a semi-infinite medium. The capability of fractional scaling to scale a process over a vast range of temporal and spatial scales is demonstrated by applying it to fluctuating processes. The application shows that the modeling of fluctuations in fluid mechanics is analogous to that in relativistic quantum field theory. Thus, Kolmogorov dissipation frequency and length are the analogs of the characteristic time and length of quantum fluctuations. The paper briefly discusses the applicability of the fractional scaling approach (FSA) to nanotechnology and biology. It also notes the analogy between FSA and the approach used to scale polymers. These applications demonstrate the power of scaling as well as the validity of Pierre-Gilles de Gennes' ideas concerning scaling, analogies and simplicity. They also demonstrate the usefulness and efficiency of his approach to solving scientific problems. The second objective is to note and discuss the benefits of applying FSA to NPP technology. The third objective is to present a state of the art assessment of thermal-hydraulics (T/H) capabilities and needs relevant to NPP.
Scaling: From quanta to nuclear reactors
International Nuclear Information System (INIS)
Zuber, Novak
2010-01-01
This paper has three objectives. The first objective is to show how the Einstein-de Broglie equation (EdB) can be extended to model and scale, via fractional scaling, both conservative and dissipative processes ranging in scale from quanta to nuclear reactors. The paper also discusses how and why a single equation and associated fractional scaling method generate for each process of change the corresponding scaling criterion. The versatility and capability of fractional scaling are demonstrated by applying it to: (a) particle dynamics, (b) conservative (Bernoulli) and dissipative (hydraulic jump) flows, (c) viscous and turbulent flows through rough and smooth pipes, and (d) momentum diffusion in a semi-infinite medium. The capability of fractional scaling to scale a process over a vast range of temporal and spatial scales is demonstrated by applying it to fluctuating processes. The application shows that the modeling of fluctuations in fluid mechanics is analogous to that in relativistic quantum field theory. Thus, Kolmogorov dissipation frequency and length are the analogs of the characteristic time and length of quantum fluctuations. The paper briefly discusses the applicability of the fractional scaling approach (FSA) to nanotechnology and biology. It also notes the analogy between FSA and the approach used to scale polymers. These applications demonstrate the power of scaling as well as the validity of Pierre-Gilles de Gennes' ideas concerning scaling, analogies and simplicity. They also demonstrate the usefulness and efficiency of his approach to solving scientific problems. The second objective is to note and discuss the benefits of applying FSA to NPP technology. The third objective is to present a state of the art assessment of thermal-hydraulics (T/H) capabilities and needs relevant to NPP.
Metabolic engineering of strains: from industrial-scale to lab-scale chemical production.
Sun, Jie; Alper, Hal S
2015-03-01
A plethora of successful metabolic engineering case studies have been published over the past several decades. Here, we highlight a collection of microbially produced chemicals using a historical framework, starting with titers ranging from industrial scale (more than 50 g/L), to medium-scale (5-50 g/L), and lab-scale (0-5 g/L). Although engineered Escherichia coli and Saccharomyces cerevisiae emerge as prominent hosts in the literature as a result of well-developed genetic engineering tools, several novel native-producing strains are gaining attention. This review catalogs the current progress of metabolic engineering towards production of compounds such as acids, alcohols, amino acids, natural organic compounds, and others.
Development and Validation of Academic Dishonesty Scale (ADS): Presenting a Multidimensional Scale
Bashir, Hilal; Bala, Ranjan
2018-01-01
The purpose of the study was to develop a scale measuring academic dishonesty of undergraduate students. The sample of the study constitutes nine hundred undergraduate students selected via random sampling technique. After receiving expert's opinions for the face and content validity of the scale, the exploratory factor analysis (EFA) and…
Generic maximum likely scale selection
DEFF Research Database (Denmark)
Pedersen, Kim Steenstrup; Loog, Marco; Markussen, Bo
2007-01-01
in this work is on applying this selection principle under a Brownian image model. This image model provides a simple scale invariant prior for natural images and we provide illustrative examples of the behavior of our scale estimation on such images. In these illustrative examples, estimation is based......The fundamental problem of local scale selection is addressed by means of a novel principle, which is based on maximum likelihood estimation. The principle is generally applicable to a broad variety of image models and descriptors, and provides a generic scale estimation methodology. The focus...
The silicon chip: A versatile micro-scale platform for micro- and nano-scale systems
Choi, Edward
Cutting-edge advances in micro- and nano-scale technology require instrumentation to interface with the external world. While technology feature sizes are continually being reduced, the size of experimentalists and their instrumentation do not mirror this trend. Hence there is a need for effective application-specific instrumentation to bridge the gap from the micro and nano-scale phenomena being studied to the comparative macro-scale of the human interfaces. This dissertation puts forward the idea that the silicon CMOS integrated circuit, or microchip in short, serves as an excellent platform to perform this functionality. The electronic interfaces designed for the semiconductor industry are particularly attractive as development platforms, and the reduction in feature sizes that has been a hallmark of the industry suggests that chip-scale instrumentation may be more closely coupled to the phenomena of interest, allowing finer control or improved measurement capabilities. Compatibility with commercial processes will further enable economies of scale through mass production, another welcome feature of this approach. Thus chip-scale instrumentation may replace the bulky, expensive, cumbersome-to-operate macro-scale prototypes currently in use for many of these applications. The dissertation examines four specific applications in which the chip may serve as the ideal instrumentation platform. These are nanorod manipulation, polypyrrole bilayer hinge microactuator control, organic transistor hybrid circuits, and contact fluorescence imaging. The thesis is structured around chapters devoted to each of these projects, in addition to a chapter on preliminary work on an RFID system that serves as a wireless interface model. Each of these chapters contains tools and techniques developed for chip-scale instrumentation, from custom scripts for automated layout and data collection to microfabrication processes. Implementation of these tools to develop systems for the
Fluctuation scaling, Taylor's law, and crime.
Directory of Open Access Journals (Sweden)
Quentin S Hanley
Full Text Available Fluctuation scaling relationships have been observed in a wide range of processes ranging from internet router traffic to measles cases. Taylor's law is one such scaling relationship and has been widely applied in ecology to understand communities including trees, birds, human populations, and insects. We show that monthly crime reports in the UK show complex fluctuation scaling which can be approximated by Taylor's law relationships corresponding to local policing neighborhoods and larger regional and countrywide scales. Regression models applied to local scale data from Derbyshire and Nottinghamshire found that different categories of crime exhibited different scaling exponents with no significant difference between the two regions. On this scale, violence reports were close to a Poisson distribution (α = 1.057 ± 0.026 while burglary exhibited a greater exponent (α = 1.292 ± 0.029 indicative of temporal clustering. These two regions exhibited significantly different pre-exponential factors for the categories of anti-social behavior and burglary indicating that local variations in crime reports can be assessed using fluctuation scaling methods. At regional and countrywide scales, all categories exhibited scaling behavior indicative of temporal clustering evidenced by Taylor's law exponents from 1.43 ± 0.12 (Drugs to 2.094 ± 0081 (Other Crimes. Investigating crime behavior via fluctuation scaling gives insight beyond that of raw numbers and is unique in reporting on all processes contributing to the observed variance and is either robust to or exhibits signs of many types of data manipulation.
Fluctuation scaling, Taylor's law, and crime.
Hanley, Quentin S; Khatun, Suniya; Yosef, Amal; Dyer, Rachel-May
2014-01-01
Fluctuation scaling relationships have been observed in a wide range of processes ranging from internet router traffic to measles cases. Taylor's law is one such scaling relationship and has been widely applied in ecology to understand communities including trees, birds, human populations, and insects. We show that monthly crime reports in the UK show complex fluctuation scaling which can be approximated by Taylor's law relationships corresponding to local policing neighborhoods and larger regional and countrywide scales. Regression models applied to local scale data from Derbyshire and Nottinghamshire found that different categories of crime exhibited different scaling exponents with no significant difference between the two regions. On this scale, violence reports were close to a Poisson distribution (α = 1.057 ± 0.026) while burglary exhibited a greater exponent (α = 1.292 ± 0.029) indicative of temporal clustering. These two regions exhibited significantly different pre-exponential factors for the categories of anti-social behavior and burglary indicating that local variations in crime reports can be assessed using fluctuation scaling methods. At regional and countrywide scales, all categories exhibited scaling behavior indicative of temporal clustering evidenced by Taylor's law exponents from 1.43 ± 0.12 (Drugs) to 2.094 ± 0081 (Other Crimes). Investigating crime behavior via fluctuation scaling gives insight beyond that of raw numbers and is unique in reporting on all processes contributing to the observed variance and is either robust to or exhibits signs of many types of data manipulation.
Scale issues in tourism development
Sinji Yang; Lori Pennington-Gray; Donald F. Holecek
1998-01-01
Proponents of Alternative Tourism overwhelmingly believe that alternative forms of tourism development need to be small in scale. Inasmuch as tourists' demand has great power to shape the market, the issues surrounding the tourism development scale deserve further consideration. This paper discusses the implications and effects of the tourism development scale on...
Simultaneous nested modeling from the synoptic scale to the LES scale for wind energy applications
DEFF Research Database (Denmark)
Liu, Yubao; Warner, Tom; Liu, Yuewei
2011-01-01
This paper describes an advanced multi-scale weather modeling system, WRF–RTFDDA–LES, designed to simulate synoptic scale (~2000 km) to small- and micro-scale (~100 m) circulations of real weather in wind farms on simultaneous nested grids. This modeling system is built upon the National Center f...
A scaling study of the step scaling function of quenched QCD with improved gauge actions
International Nuclear Information System (INIS)
Takeda, S.; Aoki, S.; Fukugita, M.; Ishikawa, K-I.; Ishizuka, N.; Iwasaki, Y.; Kanaya, K.; Kaneko, T.; Kuramashi, Y.; Okawa, M.; Taniguchi, Y.; Ukawa, A.; Yoshie, T.
2005-01-01
We study the scaling behavior of the step scaling function for SU(3) gauge theory, employing the Iwasaki gauge action and the Luescher-Weisz gauge action. In particular, we test the choice of boundary counter terms and apply a perturbative procedure for removal of lattice artifacts for the simulation results in the extrapolation procedure. We confirm the universality of the step scaling functions at both weak and strong coupling regions. We also measure the low energy scale ratio with the Iwasaki action, and confirm its universality
Scaling properties of foreign exchange volatility
Gençay, R.; Selçuk, F.; Whitcher, B.
2001-01-01
In this paper, we investigate the scaling properties of foreign exchange volatility. Our methodology is based on a wavelet multi-scaling approach which decomposes the variance of a time series and the covariance between two time series on a scale by scale basis through the application of a discrete
Multi-scale modeling of composites
DEFF Research Database (Denmark)
Azizi, Reza
A general method to obtain the homogenized response of metal-matrix composites is developed. It is assumed that the microscopic scale is sufficiently small compared to the macroscopic scale such that the macro response does not affect the micromechanical model. Therefore, the microscopic scale......-Mandel’s energy principle is used to find macroscopic operators based on micro-mechanical analyses using the finite element method under generalized plane strain condition. A phenomenologically macroscopic model for metal matrix composites is developed based on constitutive operators describing the elastic...... to plastic deformation. The macroscopic operators found, can be used to model metal matrix composites on the macroscopic scale using a hierarchical multi-scale approach. Finally, decohesion under tension and shear loading is studied using a cohesive law for the interface between matrix and fiber....
Integration of the effects of air quality measures in the SOLVE mix of measures
International Nuclear Information System (INIS)
Hesselmans, T.; Heijnis, F.
2008-01-01
SOLVE is the Dutch abbreviation for fast solutions for air and traffic and is a website by means of which provinces and municipalities in the Netherlands can gain insight into the best measures for traffic to improve the quality of the ambient air. Since halfway June 2008, the effects on air quality of approximately 35 traffic measures were included in the SOLVE mix of measures. The effects of traffic measures on emissions of particulate matter and nitrogen dioxide have been calculated. The effects are expressed in a decrease of the contribution of traffic indicated in a scale from A (very large decrease) to E (no decrease). The outcome depends on the location where the measure is implemented. [mk] [nl
Energy Technology Data Exchange (ETDEWEB)
Barancik, J.I.; Kramer, C.F.; Thode, H.C. Jr.; Kahn, C.J. [Brookhaven National Lab., Upton, NY (United States); Greensher, J.; Schechter, S. [Nassau County Dept. of Health, Mineola, NY (United States)
1992-11-01
On January 25, 1990 Avianca Flight 052 crashed without a conflagration after running out of fuel; 73 persons died, 85 survived. Epidemiological, biostatistical, and related analytical methods were used for the analysis of decedent and survivor injury patterns and for the purpose of examining selected EMS and hospital issues-relative to disaster planning and incident management and response. Medical examiner and hospital records for all decedents and survivors were identified, abstracted, and coded using the International Classification of Diseases with Clinical Modifications, 9th Edition (ICD 9-CM) to determine the nature of injuries and comorbid conditions. Injury severity values were determined using the 1985 Abbreviated Injury Scale with Epidemiologic Modifications (AIS 85-EM).
Kaneko, Makoto; Shirai, Tatsuya; Tsuji, Toshio
2000-01-01
This paper discusses the scale-dependent grasp.Suppose that a human approaches an object initially placed on atable and finally achieves an enveloping grasp. Under such initialand final conditions, he (or she) unconsciously changes the graspstrategy according to the size of objects, even though they havesimilar geometry. We call the grasp planning the scale-dependentgrasp. We find that grasp patterns are also changed according tothe surface friction and the geometry of cross section in additi...
Yamout, Karim Z; Heinrichs, Robin J; Baade, Lyle E; Soetaert, Dana K; Liow, Kore K
2017-03-01
The Minnesota Multiphasic Personality Inventory-2 (MMPI-2) is a psychological testing tool used to measure psychological and personality constructs. The MMPI-2 has proven helpful in identifying individuals with nonepileptic events/nonepileptic seizures. However, the MMPI-2 has had some updates that enhanced its original scales. The aim of this article was to test the utility of updated MMPI-2 scales in predicting the likelihood of non-epileptic seizures in individuals admitted to an EEG video monitoring unit. We compared sensitivity, specificity, and likelihood ratios of traditional MMPI-2 Clinical Scales against more homogenous MMPI-2 Harris-Lingoes subscales and the newer Restructured Clinical (RC) scales. Our results showed that the Restructured Scales did not show significant improvement over the original Clinical scales. However, one Harris-Lingoes subscale (HL4 of Clinical Scale 3) did show improved predictive utility over the original Clinical scales as well as over the newer Restructured Clinical scales. Our study suggests that the predictive utility of the MMPI-2 can be improved using already existing scales. This is particularly useful for those practitioners who are not invested in switching over to the newly developed MMPI-2 Restructured Form (MMPI-2 RF). Copyright © 2016 Elsevier Inc. All rights reserved.
Coulombic faulting from the grain scale to the geophysical scale: lessons from ice
Energy Technology Data Exchange (ETDEWEB)
Weiss, Jerome [Laboratoire de Glaciologie et Geophysique de l' Environnement, CNRS, 54 rue Moliere, BP 96, 38402 St Martin d' Heres Cedex (France); Schulson, Erland M, E-mail: weiss@lgge.obs.ujf-grenoble.f, E-mail: Erland.M.Schulson@Dartmouth.ED [Thayer School of Engineering, Dartmouth College, Hanover, NH, 03755 (United States)
2009-11-07
Coulombic faulting, a concept formulated more than two centuries ago, still remains pertinent in describing the brittle compressive failure of various materials, including rocks and ice. Many questions remain, however, about the physical processes underlying this macroscopic phenomenology. This paper reviews the progress made in these directions during the past few years through the study of ice and its mechanical behaviour in both the laboratory and the field. Fault triggering is associated with the formation of specific features called comb-cracks and involves frictional sliding at the micro(grain)-scale. Similar mechanisms are observed at geophysical scales within the sea ice cover. This scale-independent physics is expressed by the same Coulombic phenomenology from laboratory to geophysical scales, with a very similar internal friction coefficient ({mu} {approx} 0.8). On the other hand, the cohesion strongly decreases with increasing spatial scale, reflecting the role of stress concentrators on fault initiation. Strong similarities also exist between ice and other brittle materials such as rocks and minerals and between faulting of the sea ice cover and Earth's crust, arguing for the ubiquitous nature of the underlying physics.
Variational Multi-Scale method with spectral approximation of the sub-scales.
Dia, Ben Mansour
2015-01-07
A variational multi-scale method where the sub-grid scales are computed by spectral approximations is presented. It is based upon an extension of the spectral theorem to non necessarily self-adjoint elliptic operators that have an associated base of eigenfunctions which are orthonormal in weighted L2 spaces. We propose a feasible VMS-spectral method by truncation of this spectral expansion to a nite number of modes.
Maximum likely scale estimation
DEFF Research Database (Denmark)
Loog, Marco; Pedersen, Kim Steenstrup; Markussen, Bo
2005-01-01
A maximum likelihood local scale estimation principle is presented. An actual implementation of the estimation principle uses second order moments of multiple measurements at a fixed location in the image. These measurements consist of Gaussian derivatives possibly taken at several scales and/or ...
A scale invariance criterion for LES parametrizations
Directory of Open Access Journals (Sweden)
Urs Schaefer-Rolffs
2015-01-01
Full Text Available Turbulent kinetic energy cascades in fluid dynamical systems are usually characterized by scale invariance. However, representations of subgrid scales in large eddy simulations do not necessarily fulfill this constraint. So far, scale invariance has been considered in the context of isotropic, incompressible, and three-dimensional turbulence. In the present paper, the theory is extended to compressible flows that obey the hydrostatic approximation, as well as to corresponding subgrid-scale parametrizations. A criterion is presented to check if the symmetries of the governing equations are correctly translated into the equations used in numerical models. By applying scaling transformations to the model equations, relations between the scaling factors are obtained by demanding that the mathematical structure of the equations does not change.The criterion is validated by recovering the breakdown of scale invariance in the classical Smagorinsky model and confirming scale invariance for the Dynamic Smagorinsky Model. The criterion also shows that the compressible continuity equation is intrinsically scale-invariant. The criterion also proves that a scale-invariant turbulent kinetic energy equation or a scale-invariant equation of motion for a passive tracer is obtained only with a dynamic mixing length. For large-scale atmospheric flows governed by the hydrostatic balance the energy cascade is due to horizontal advection and the vertical length scale exhibits a scaling behaviour that is different from that derived for horizontal length scales.