2003-01-01
Eesti Telekomi nõukogu otsusest vabastada ametist EMT juhatuse esimees Peep Aaviksoo, uuest kandidaadist Valdo Kalmust ning EMT ja Elioni võimalikust ühinemisest. Diagramm: EMT turuosa libiseb Tele2-le. Vt. samas: EMT lahkuva juhi Peep Aaviksoo avalik kiri. Kommenteerivad Sami Seppänen, Üllar Jaaksoo, Monika Salu, Jaak Aaviksoo, Toomas Tamsar
Jaak Aaviksoo : Oborona i obrazovanije tak pohhozhi... / Jaak Aaviksoo ; interv. Jevgenija Garanzha
Aaviksoo, Jaak, 1954-
2007-01-01
Kaitseminister Jaak Aaviksoo vastab küsimustele, mis puudutavad riigi kaitsepoliitikat, uut riigikaitse plaani, Eesti-Vene suhteid, rahuvalve missioone, Kaitseliidu tegevust, ministeeriumi ja kaitseväe suhteid
Saare Paat arendab uusi kaatrimudeleid riigi toel / Mehis Tulk
Tulk, Mehis, 1967-
2005-01-01
Nasval tegutsev laevaehitusfirma Saare Paat saab oma kaatri Stormer uute mudelite väljaarendamiseks ja välisturgudel tutvustamiseks riigilt Ettevõtluse Arendamise Sihtasutuse (EAS) kaudu mitu miljonit krooni toetusraha
Peep Aaviksoo kukutas EMT-kesksus / Jaan Männik ; interv. Vallo Toomet
Männik, Jaan, 1945-
2003-01-01
EMT nõukogu esimees ja Eesti Telekomi juhatuse esimees Jaan Männik vastab küsimustele, mis on seotud Peep Aaviksoo lahkumisega Eesti Mobiiltelefoni juhi kohalt. Vt. samas: Aaviksoo selgitab lahkumise põhjusi. Peep Aaviksoo kiri. Kommenteerivad Radiolinja Eesti juhatuse esimees Sami Seppänen, Tele2 Eesti juhatuse esimees Üllar Jaaksoo, Ühispanga analüütik Sven Kunsing
Kõrghariduse tulevik / Jaak Aaviksoo
Aaviksoo, Jaak, 1954-
2001-01-01
Teaduseelarveks 50 miljonit dollarit ning 100 doktorikraadi kaitsmist aastas on kaks korda rohkem kui kogu Eesti tänane ressurss. Tartu Ülikooli rektor Jaak Aaviksoo seab selle ülikooli 10 aasta sihiks
Atonen ja Aaviksoo tegid eile esimese 3G kõne / Viktoria Korpan
Korpan, Viktoria, 1976-
2003-01-01
Majandusminister Meelis Atonen ja Eesti Mobiiltelefoni juht Peep Aaviksoo pidasid EMT tehnoloogiakeskuses esimese ametliku kõne 3G testvõrgus. Lisaks tavakõnele videokõnet ja kiiret andmesidet võimaldav teenus jõuab kommertskasutusse orienteeruvalt aastal 2005, lubas Aaviksoo
2010-01-01
Oma USA visiidi ajal kohtus kaitseminister Jaak Aaviksoo USA relvajõudude küberväejuhatuse ülema kindral Keith Alexander'iga ja sai ülevaate USA küberkaitsekorraldusest. Ministri ja USA Esindajatekoja järgmise koosseisu relvajõudude komitee esimehe Howard McKeon'i kohtumisel räägiti Euroopa ja Eesti praegusest julgeolekunägemusest. Kaitseministri plaanis oli ka kohtumine USA kaitseministri Robert Gates'iga
Aaviksoo vihje : Reivik kaotab töö / Raimo Poom
Poom, Raimo
2008-01-01
Ärisidemete tekkimine Aivar Reiviku juhitava aktsiaseltsi Volta ja Vabadussõja võidusamba ehitaja Sans Souci vahel lõpetab Reiviku lepingu kaitseministeeriumiga. Kommenteerib kaitseminister Jaak Aaviksoo
Kui hästi või halvasti ... / Jaak Aaviksoo, Piret Hartman, Heli Aru
Aaviksoo, Jaak, 1954-
2003-01-01
TÜ rektor J. Aaviksoo, Üliõpilaskondade Liidu juhatuse esimees P. Hartman ja Haridus- ja Teadusministeeriumi kõrghariduse talituse juhataja H. Aru vastavad küsimusele, kui hästi või halvasti on end õigustanud kõrghariduses aasta toiminud 3+2 süsteem
Mida sina täna õppisid? / Veikko Täär, Ain Aaviksoo, Ingrid Tõniste ... [jt.
2012-01-01
Oma õppimistest ja tulevikuplaanidest räägivad näitleja ja ettevõtja Veikko Täär, tervishoiuteadlane Ain Aaviksoo, tegevjuht Ingrid Tõniste, TV3 avalike suhete juht ja uudisteankur Anneli Adermann, arenduskonsultant Anu Puusaag, personaaltreener Katrin Pärt ja loodusarst Tiina Keldrima
Introduktionslæger som vejledere - hvorfor?
DEFF Research Database (Denmark)
Skaarup, Anne Marie; Ringsted, Charlotte Vibeke
2004-01-01
Statusartiklen har til hensigt at beskrive det pædagogiske rationale for at anvende introduktionslæger som vejledere, holdningen blandt introduktionslæger og speciallæger til at bruge introduktionslæger som vejledere, og hvilke ulemper der kan identificeres, og hvordan de eventuelt kan overvindes...
Borch-Pedersen, Kristina; Lindbäck, Toril; Madslien, Elisabeth H; Kidd, Shani W; O'Sullivan, Kristin; Granum, Per Einar; Aspholm, Marina
2016-07-15
When nutrients are scarce, Bacillus species form metabolically dormant and extremely resistant spores that enable survival over long periods of time under conditions not permitting growth. The presence of specific nutrients triggers spore germination through interaction with germinant receptors located in the spore's inner membrane. Bacillus licheniformis is a biotechnologically important species, but it is also associated with food spoilage and food-borne disease. The B. licheniformis ATCC 14580/DSM13 genome exhibits three gerA family operons (gerA, gerK, and ynd) encoding germinant receptors. We show that spores of B. licheniformis germinate efficiently in response to a range of different single l-amino acid germinants, in addition to a weak germination response seen with d-glucose. Mutational analyses revealed that the GerA and Ynd germination receptors function cooperatively in triggering an efficient germination response with single l-amino acid germinants, whereas the GerK germination receptor is essential for germination with d-glucose. Mutant spores expressing only GerA and GerK or only Ynd and GerK show reduced or severely impaired germination responses, respectively, with single l-amino acid germinants. Neither GerA nor Ynd could function alone in stimulating spore germination. Together, these results functionally characterize the germination receptor operons present in B. licheniformis We demonstrate the overlapping germinant recognition patterns of the GerA and Ynd germination receptors and the cooperative functionalities between GerA, Ynd, and GerK in inducing germination. To ensure safe food production and durable foods, there is an obvious need for more knowledge on spore-forming bacteria. It is the process of spore germination that ultimately leads to food spoilage and food poisoning. Bacillus licheniformis is a biotechnologically important species that is also associated with food spoilage and food-borne disease. Despite its importance, the
Varga, Richard S
2004-01-01
TheGer? sgorin CircleTheorem, averywell-known resultin linear algebra today, stems from the paper of S. Ger? sgorin in 1931 (which is reproduced in AppendixD)where,givenanarbitraryn×ncomplexmatrix,easyarithmetic operationsontheentriesofthematrixproducendisks,inthecomplexplane, whose union contains all eigenvalues of the given matrix. The beauty and simplicity of Ger? sgorin’s Theorem has undoubtedly inspired further research in this area, resulting in hundreds of papers in which the name “Ger? sgorin” appears. The goal of this book is to give a careful and up-to-date treatment of various aspects of this topic. The author ?rst learned of Ger? sgorin’s results from friendly conversations with Olga Taussky-Todd and John Todd, which inspired me to work in this area.Olgawasclearlypassionateaboutlinearalgebraandmatrixtheory,and her path-?nding results in these areas were like a magnet to many, including this author! It is the author’s hope that the results, presented here on topics related to Ger? sgorin...
2003-01-01
Küsimusele "missugune oleks nende panus ja plaan esimese aasta jooksul ühiskondlikus leppes fikseeritud eesmärkide saavutamiseks" vastavad Tartu Ülikooli rektor Jaak Aaviksoo, EOK asepresident Jüri Tamm, Eestimaa Talupidajate Keskliidu peadirektor Kaul Nurm, Eesti Kirikute Nõukogu täitevsekretär Eerik Jõks, Eesti Ühistegelise Liidu juhatuse esimees Urmas Laht, Eesti Väike- ja Keskettevõtjate Assotsiatsiooni juhataja Riina Danilson ning Reformierakonna pressinõunik Peep Lillemägi. Samas ka karikatuur
Gastroesophageal reflux (GER) and respiratory disease in children
International Nuclear Information System (INIS)
Shazia, F.
2002-01-01
Full text: The aim of this study is: to identify any possible relationship between recurrent lower respiratory tract infection and GER, to identify any possible relationship between asthma and GER, to determine the prevalence of GER in children suffering from RLRTI and bronchial asthma, and to evaluate the sensitivity and accuracy of different GER diagnostic modalities. Thirty children with recurrent lower respiratory tract infection and bronchial asthma were evaluated for possible presence of the GER. Radionuclide gastroesophageal scintigraphy was performed in all these 30 patients (age range 6 months - 10 years). Patients also underwent ultrasonography and/or barium swallow or fluoroscopy on separate day. Patients were grouped according to presenting coinplaints and investigative modalities. Group A was the patients of RLRTI, which underwent GER scintigraphy, barium studies and ultrasonography. Group B patients were patients with bronchial asthma who underwent all 3 investigations. Group C was patients with RLRTI who under went GER scintigraphy and barium studies only. Patients with bronchial asthma who underwent barium studies and GER scintigraphy were included in group D. Group E and F were patients with RLRTI and bronchial asthma who underwent ultrasonography and GER scintigraphy only respectively. For each group, reflux index was calculated in all positive patients. GER reflux of varying degrees was observed in 20 % patients. The severity of the clinical symptoms was directly proportional to the severity of gastroesophageal reflux. Reflux index was positively correlating with clinical symptoms as well. When compared with other investigative modalities employed GER scintigraphy was found to be more superior in terms of sensitivity and specificity. Objective assessment of gastroesophageal reflux with the help of GER scintigraphy is feasible and is superior to other modalities and it should be employed much more frequently as an initial investigative procedure
2010-01-01
Küsimusele vastavad Tartu Ülikooli eelmine rektor Jaak Aaviksoo, Eesti Üliõpilaskondade Liidu esimees Maris Mälzer, Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg ja Tallinna Tehnikaülikooli rektor Peep Sürje
Acid Reflux (GER & GERD) in Infants
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
Tandlæger og personer med en spiseforstyrrelse
DEFF Research Database (Denmark)
Gehrt, Charlotte Astrid; Christensen, Lisa Bøge; Klinker, Sabine
2016-01-01
Mødet mellem tandlæge og patient med spiseforstyrrelse Introduktion og formål: Det er velkendt, at tandlæger kan spille en rolle i forhold til tidlig identifikation af en spiseforstyrrelse. Der erimidlertid begrænset viden om, hvilke forventninger tandlæger og personer med en spiseforstyrrelse har...... til mødet med hinanden i klinikken, og hvordan dette opleves. Undersøgelsens formål var derfor at få viden om mødet mellem tandlæger og personer med en spiseforstyrrelse. Materialer og metoder: Undersøgelsen var en tværsnitsundersøgelse baseret på to spørgeskemaer udarbejdet til henholdsvis tandlæger...... og personer med en spiseforstyrrelse. I alt 1.405 tandlæger deltog, mens 260 personer med en spiseforstyrrelse besvarede spørgeskemaet. Resultater: Tandlægerne havde større selvrapporteret viden om orale komplikationer ved en spiseforstyrrelse end om spiseforstyrrelser generelt. Størstedelen af...
Brunt, Jason; Carter, Andrew T; Pye, Hannah V; Peck, Michael W
2018-05-04
Clostridium botulinum is an anaerobic spore forming bacterium that produces the potent botulinum neurotoxin that causes a severe and fatal neuro-paralytic disease of humans and animals (botulism). C. botulinum Group II is a psychrotrophic saccharolytic bacterium that forms spores of moderate heat resistance and is a particular hazard in minimally heated chilled foods. Spore germination is a fundamental process that allows the spore to transition to a vegetative cell and typically involves a germinant receptor (GR) that responds to environmental signals. Analysis of C. botulinum Group II genomes shows they contain a single GR cluster (gerX3b), and an additional single gerA subunit (gerXAO). Spores of C. botulinum Group II strain Eklund 17B germinated in response to the addition of L-alanine, but did not germinate following the addition of exogenous Ca 2+ -DPA. Insertional inactivation experiments in this strain unexpectedly revealed that the orphan GR GerXAO is essential for L-alanine stimulated germination. GerX3bA and GerX3bC affected the germination rate but were unable to induce germination in the absence of GerXAO. No role could be identified for GerX3bB. This is the first study to identify the functional germination receptor of C. botulinum Group II.
DEFF Research Database (Denmark)
Toft, Anne Elisabeth
2017-01-01
I 55 fotografier søger Kurt Rodahl Hoppe at indfange den helt særlige stemning, der kan opleves på steder, hvor bøger på ejendommelig vis har samlet sig selv. Fotografen har fået adgang til en række af private bogsamlinger samt biblioteker og antikvariater. Bogen indledes med tre meget forskellig...
Leksikon over ordbøger og leksika
DEFF Research Database (Denmark)
Pálfi, Loránd-Levente
, psykologi, svejseteknik osv.? Denne bog giver svaret. Leksikon over ordbøger og leksika er den første af sin art på dansk. I omtrent 700 artikler (inkl. henvisningsartikler) omtales her over 1.900 forskellige danske ordbøger og leksika primært udgivet i tidsrummet 1990–2010. Bogen er tænkt som et praktisk...
Malematš Vanemuise laval / Gerli Padar ; interv. Sirje Pärismaa
Padar, Gerli, 1979-
2006-01-01
2. juunil esietendus Vanemuises ABBA-meeste Benny Anderssoni ja Björn Ulvaeuse kirjutatud muusikal "Chess", lavastaja Georg Malvius, osades Gerli Padar, Janika Sillamaa, Lauri Liiv, Koit Toome. Intervjuu naispeaosalise Gerli Padariga
Czech Academy of Sciences Publication Activity Database
Fiedler, Miroslav; Hall, F.J.; Marsli, R.
2013-01-01
Roč. 438, č. 1 (2013), s. 598-603 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : geometric multiplicity * algebra ic multiplicity * Geršgorin disc Subject RIV: BA - General Mathematics Impact factor: 0.983, year: 2013
Virtual Reality: Is It Real Or Not? Sanal Gerçeklik: Gerçek Mi, Değil Mi?
Directory of Open Access Journals (Sweden)
S. Serap Kurbanoğlu
1996-03-01
Full Text Available In this paper virtual reality technology and how libraries might be affected by this technology are examined. Virtual reality sets out to address a problem. The problem is that of user-friendliness of computer systems. Needless to say, the current generation of computers still involves a barrier between human and machine. This is keyboard or mouse on the human side, and the screen on the computer side. If computers are really going to become a par t of everyone's normal day to day experiences, they must allow users to visualise information in a way familiar to them, not the way the computers forces them to. Virtual reality provides such a way. With the increasing amount s of information available in electronic form, it is clear that virtual reality technology will have a profound impact on libraries. Bu makalede sanal gerçeklik teknolojisi ve kütüphanelerin sanal gerçeklik teknolojisinden nası l etkilenebilecekleri konusuna değinilmektedir. Sanal gerçeklik teknolojisi insan-makine etkileşiminde günümüz bilgisayarlarında hâlâ var olan bilgisayar ekranı , klavye veya fare gibi, insanların kendilerini doğal ortamda hissetmelerini engelleyen unsurlar ı ortadan kaldırmayı hedeflemektedir. Eğer bilgisayarlar günün birinde günlük yaşamın bir parças ı haline gelecekse kullanıcıların bilgiyi aşina oldukları biçimde görmelerini sağlamak zorunda kalacaklardır. İşte sanal gerçeklik teknolojisi bunu sağlayacaktır. Günümüzde elektronik formda elde edilebilen bilginin giderek artmas ı sanal gerçeklik teknolojisinin gelecekteki uygulama alanlarından birisinin de kütüphaneler olacağına kuşku bırakmamaktadır.
Role of the gerA operon in L-alanine germination of Bacillus licheniformis spores
Directory of Open Access Journals (Sweden)
Løvdal Irene S
2012-03-01
Full Text Available Abstract Background The genome of Bacillus licheniformis DSM 13 harbours three neighbouring open reading frames showing protein sequence similarities to the proteins encoded from the Bacillus subtilis subsp. subtilis 168 gerA operon, GerAA, GerAB and GerAC. In B. subtilis, these proteins are assumed to form a germinant receptor involved in spore germination induced by the amino acid L-alanine. Results In this study we show that disruption of the gerAA gene in B. licheniformis MW3 hamper L-alanine and casein hydrolysate-triggered spore germination, measured by absorbance at 600 nm and confirmed by phase contrast microscopy. This ability was restored by complementation with a plasmid-borne copy of the gerA locus. Addition of D-alanine in the casein hydrolysate germination assay abolished germination of both B. licheniformis MW3 and the complementation mutant. Germination of both B. licheniformis MW3 and the gerA disruption mutant was induced by the non-nutrient germinant Ca2+-Dipicolinic acid. Conclusions These results demonstrate that the B. licheniformis MW3 gerA locus is involved in germination induced by L-alanine and potentially other components present in casein hydrolysate.
Role of the gerA operon in L-alanine germination of Bacillus licheniformis spores
2012-01-01
Background The genome of Bacillus licheniformis DSM 13 harbours three neighbouring open reading frames showing protein sequence similarities to the proteins encoded from the Bacillus subtilis subsp. subtilis 168 gerA operon, GerAA, GerAB and GerAC. In B. subtilis, these proteins are assumed to form a germinant receptor involved in spore germination induced by the amino acid L-alanine. Results In this study we show that disruption of the gerAA gene in B. licheniformis MW3 hamper L-alanine and casein hydrolysate-triggered spore germination, measured by absorbance at 600 nm and confirmed by phase contrast microscopy. This ability was restored by complementation with a plasmid-borne copy of the gerA locus. Addition of D-alanine in the casein hydrolysate germination assay abolished germination of both B. licheniformis MW3 and the complementation mutant. Germination of both B. licheniformis MW3 and the gerA disruption mutant was induced by the non-nutrient germinant Ca2+-Dipicolinic acid. Conclusions These results demonstrate that the B. licheniformis MW3 gerA locus is involved in germination induced by L-alanine and potentially other components present in casein hydrolysate. PMID:22420404
DEFF Research Database (Denmark)
Kural, René
2008-01-01
Supermarked, klatreklub, hotel, kontor, moské, bolig, restaurant, arbejdsformidling, diskotek, galleri eller koncertsal? Mulighederne er mange, når man besøger de mange lande omkring Danmark, der har taget folkekirker ud af brug og indrettet dem til andre formål. Herhjemme skal vi først nu til at...
The eletermiation of GER using gastroesophageal image in technique
International Nuclear Information System (INIS)
Zhou Guowei; Shang Kezhong; Han Pinfang; Ma Jixiao
1995-01-01
The Diagnosis of gastroesophageal reflux (GER) using radionuclide imaging is a simple, sensitive, non-invasive and quantitative technique. The authors reported the results of 18 normal persons and 84 cases of suspected GER patients examined by this technique. No reflux was found in normal group, there were 78.6% detectability in patients group, while the detectability X-ray examination were 70.2% in same group of patients. 23 cases were undergoing endoscopic examination, only 6 cases had revealed the presence of reflux, thereby eletectability was only 26.0%
L-alanine-induced germination in Bacillus licheniformis -the impact of native gerA sequences.
Madslien, Elisabeth H; Granum, Per Einar; Blatny, Janet M; Lindbäck, Toril
2014-04-22
L-alanine, acting through the GerA receptor, was recently found to be an efficient germinant in Bacillus licheniformis ATCC14580/DSM13. In this study, we show that several of 46 examined B. licheniformis strains germinate remarkably slower than the type strain when exposed to L-alanine. These strains are not necessarily closely related, as determined by MLST (multi-locus sequence typing). Three of the slow-germinating strains were further examined in order to see whether nucleotide substitutions in the gerA sequences were responsible for the slow L-alanine germination. This was performed by complementing the transformable type strain derivate MW3ΔgerAA with gerA variants from the three slow-germinating strains; NVH1032, NVH1112 and NVH800. A wide selection of B. licheniformis strains was evaluated for L-alanine-induced germination efficiency. Our results show that gerA substitutions could only partially explain why spores of some B. licheniformis strains responded slower than others in the presence of L-alanine.
A detailed study of gerJ mutants of Bacillus subtilis.
Warburg, R J; Buchanan, C E; Parent, K; Halvorson, H O
1986-08-01
A total of nine gerJ mutants have now been isolated in Bacillus subtilis. All are defective in their spore germination properties, being blocked at an intermediate (phase grey) stage. The dormant spores are sensitive to heating at 90 degrees C and two of the mutants (generated by transposon insertion) produce spores sensitive at 80 degrees C. The spores of these two more extreme mutants had a visibly defective cortex when studied by electron microscopy, as did some of the other mutants. During sporulation, the acquisition of spore resistance properties and the appearance of the sporulation-specific penicillin-binding protein PBP5* were delayed. A strain probably carrying a lacZ fusion to the gerJ promoter demonstrated increased expression between t2 and t4. We propose that the gerJ locus is involved in the control of one or more sporulation-specific genes.
Loots, C.; Smits, M.; Omari, T.; Bennink, R.; Benninga, M.; van Wijk, M.
2013-01-01
Background Posture has been shown to influence the number of transient lower esophageal sphincter relaxation (TLESRs) and gastroesophageal reflux (GER), however, the physiology explaining the influence of right lateral position (RLP), and left lateral position (LLP) is not clear. The aim of this
Leksikon over ordbøger og leksika
DEFF Research Database (Denmark)
Pálfi, Loránd-Levente
Findes der en dansk-mongolsk ordbog? Eller en dansk-swahili ordbog? Hvilke sprog findes der i det hele taget danske ordbøger for? Og hvilke opslagsværker findes der på dansk om astrologi, astronomi, biologi, filosofi, fluebinding, fysik, historie, islam, kristendom, krydsord, matematik, okkultisme...
International Nuclear Information System (INIS)
Yang Xixiu; Li Lusheng; Chi Liuying; Zhao Xin; Mao Hongyu; Zhu Weiwei; Wang Jun
2007-01-01
Objective: To investigate the relationship between changes of blood levels of motilin gastrin and development of GER in children with bronchial asthma. Methods: Altogether 98 children with various forms of bronchial asthma were studied, in which 40 patients were complicated with symptomatic GER. Serum gastrin and plasma motilin levels were measured with RIA in all these 98 children and 30 controls. Barium swallow was performed in 76 children (including all the 40 with symptomatic GER) and anatomic GER was demonstrated in 31 patients (all with symptomatic GER except 4 in young infants who could not tell about symptom). No anatomic GER was shown in children without GER symptoms. Results: The blood levels of motilin and gastrin in all patients with symptomatic GER (barium swallow positive or not) were significantly lower than those in patients without GER symptoms and controls (P<0. 001). The hormone levels in asthmatic children without GER symptoms were still significantly lower than those in controls (P<0. 01). Conclusion: Plasma motilin and serum gastrin levels were markedly decreased in asthmatic children, especially in those with symptomatic and/or anatomic GER. Lowered motilin and gastrin levels might lead to development of GER and GER could further aggravate the attack of asthma. (authors)
Analysis of the Effects of a gerP Mutation on the Germination of Spores of Bacillus subtilis
2012-11-01
REPORT Analysis of the effects of a gerP mutation on the germination of spores of Bacillus subtilis 14. ABSTRACT 16. SECURITY CLASSIFICATION OF... Bacillus subtilis spores with a gerP mutation triggered spore germination via nutrient germinant receptors (GRs) slowly, although this defect was...gerP, Bacillus subtilis , dipicolinic acid Xuan Y. Butzin, Anthony J. Troiano, William H. Coleman, Keren K. Griffiths, Christopher J. Doona, Florence E
2008-01-01
Kommentaaride autorid ja sisu: Sissejuhatus / Raul Narits, Lauri Madise, Heinrich Schneider. Preambul / Raul Narits, Heinrich Schneider. I ptk. / Kalle Merusk, Taavi Annus, Madis Ernits, Heiki Lindpere, Lauri Madise. II ptk. / Oliver Kask, Madis Ernits, Taavi Annus, Peeter Roosma, Rait Maruste, Eerik Kergandberg, Ivo Pilving, Uno Lõhmus, Merilin Kiviorg, Einar Vene, Ülle Madise. III ptk. / Oliver Kask. IV ptk. / Lauri Madise, Aaro Mõttus, Jüri Põld, Tiina Runthal. V ptk. / Eerik-Juhan Truuväli, Ülle Madise, Jüri Põld, Urmas Reinsalu. VI ptk. / Kalle Merusk, Jüri Põld. VII ptk. / Eerik-Juhan Truuväli, Jüri Liventaal, Jüri Põld. VIII ptk. / Lasse Lehis. IX ptk. / Kristi Land, Heiki Lindpere, Lauri Madise, Heiki Pisuke. X ptk. / Oliver Kask, Enn Markvart, Jüri Põld. XI ptk. / Ülle Madise, Janek Laidvee, Heinrich Schneider. XII ptk. / Berit Aaviksoo, Mihkel Allik, Enn Markvart, Raul Narits, Aare Reenumägi, Peeter Roosma. XIII ptk. / Raul Narits, Uno Lõhmus, Madis Ernits, Jüri Põld. XIV ptk. / Vallo Olle, Arno Almann, Jüri Liventaal, Ülle Madise. XV ptk. / Eerik-Juhan Truuväli, Aaro Mõttus. Eesti Vabariigi põhiseaduse rakendamise seadus / Oliver Kask, Raul Narits, Peeter Roosma. Eesti Vabariigi põhiseaduse täiendamise seadus / Berit Aaviksoo, Julia Laffranque, Ülle Madise, Jüri Põld. Eesti Vabariigi põhiseadus 1990-2008 : bibliograafia (seisuga september 2008) / koost. Maia Ruttu
Luthers salmer i vækkelsesbevægelsernes sang- og salmebøger 1890-2000
DEFF Research Database (Denmark)
Balslev-Clausen, Peter
2011-01-01
Artiklen gør rede for brugen af Luthers salmer i danske vækkelsesbevægelsers og ungdomsorganisationers sangbøger 1890-2000......Artiklen gør rede for brugen af Luthers salmer i danske vækkelsesbevægelsers og ungdomsorganisationers sangbøger 1890-2000...
Børnebøger: Den mangfoldige familie
DEFF Research Database (Denmark)
Petersen, Anne
2010-01-01
Børn i familier med to mødre, med deleforældre og børn, der er kommet til verden ved hjælp af reagensglasbefrugtning får nu fortalt deres historie i billedbøger. Familiebegrebet er udvidet og børnelitteraturen fortæller med børns perspektiv. Adoption og andre familieformer er også i fokus, ligeso...
Von Fouqué über Oehlenschläger bis Andersen
DEFF Research Database (Denmark)
de Mylius, Johan
2010-01-01
Centralromantisk myte i dens udformning hos Friedrich de la Motte Fouqué (1811), i Oehlenschlägers forkortede bearbejdelse og oversættelse (Eventyr af forskjellige Digtere, 1816) og HCAs "Den lille Havfrue" (1837)....
Alternative Antriebe für Automobile: Hybridsysteme, Brennstoffzellen, alternative Energieträger
Stan, Cornel
Über die Realisierungsmöglichkeiten zukünftiger Antriebskonzepte - von Hybridsystemen Elektro-/Verbrennungsmotor über Brennstoffzellen bis zu alternativen Energieträgern wie Wasserstoff oder Alkohol - werden fundierte Kriterien der Qualität eines Antriebs entscheiden. Leistungsdichte, Drehmomentverlauf, Beschleunigungscharakteristik, spezifischer Energieverbrauch sowie Emission chemischer Stoffe und Geräusche sind dafür wichtige Merkmale zur Qualitätsbeurteilung. Die Verfügbarkeit und die Speicherfähigkeit vorgesehener Energieträger, die technische Komplexität, Kosten, Sicherheit, Infrastruktur und Service werden die Randbedingungen für die Einführung realisierbarer Konzepte alternativer Antriebe für Automobile stellen.
Wireless Power für mobile Geräte
Waffenschmidt, E.
2011-01-01
Um die mobile Geräte wie z.B. Mobiltelefone, Music-Player, Digitalkameras Kommunikationsmittel mit Energie zu versorgen, wird gerade fürMassenanwendungen in letzter Zeit häufig induktive kontaktlose Energieübertragung vorgeschlagen. In diesem Artikel werden nun Limitierungen in Hinblick auf die
Richard H. Thaler: Wirtschaftsnobelpreisträger 2017
Bruttel, Lisa Verena; Stolley, Florian
2017-01-01
Der diesjährige Nobelpreisträger Richard H. Thaler ist einer breiteren Öffentlichkeit vor allem durch sein mit Cass R. Sunstein gemeinsam verfasstes Buch zum Nudging bekannt geworden. Tatsächlich hat er in den vergangenen 40 Jahren die Entwicklung der Verhaltensökonomie entscheidend mitgeprägt und vorangebracht. Thaler hat die Annahmen hinter dem Modell des Homo oeconomicus untersucht und die Abweichungen menschlichen Verhaltens von den Rationalitätsannahmen auf zwei wesentliche Ursachen zurü...
Børnebøger : Døden er en del af livet
DEFF Research Database (Denmark)
Petersen, Anne
2010-01-01
Der findes mange kvalitetsbøger, som giver børn en litterær hjælpende hånd til at håndtere de store eksistentielle spørgmål om døden, og som kan lette sorgen. Bøgerne er ofte lune og usentimentale, men kan være højtidelige. På den fine måde.......Der findes mange kvalitetsbøger, som giver børn en litterær hjælpende hånd til at håndtere de store eksistentielle spørgmål om døden, og som kan lette sorgen. Bøgerne er ofte lune og usentimentale, men kan være højtidelige. På den fine måde....
Inflammatory state of periaortic adipose tissue in mice under obesogenic dietary regimens
Directory of Open Access Journals (Sweden)
Laureane Nunes Masi
2016-12-01
Full Text Available High-fat diet or high-sugar diet causes obesity and a chronic low-grade inflammation that leads to the development of diabetes and cardiovascular diseases. Inflammation of the surrounding fat of thoracic aorta namely periaortic adipose tissue (PAAT has been associated with increased prevalence of vascular diseases in obesity. C57Bl/6 male mice (12 weeks of age fed a whole grain-based commercial diet (WGD, refined carbohydrate diet (RCD, refined carbohydrate diet plus sweetened condensed milk ad libitum (RCD + CM or high-fat diet (HFD for eight weeks were studied. Serum fatty acid (FA composition was evaluated by gas chromatography. The cellularity (as indicated by DNA and protein contents and the inflammatory state (as indicated by the contents of TNF-α, IL-6, IL-1β, IL-10, VCAM-1, ICAM-1, leptin and adiponectin measured by ELISA of the PAAT and thoracic aorta (TA were evaluated. Both obesogenic regimens (RCD + CM and HFD increased the content of total fatty acids (FA in serum and the cellularity of the PAAT compared to WGD. RCD + CM increased serum monounsaturated fatty acid (MUFA levels and HFD increased serum saturated fatty acid (SFA levels compared to WGD. RCD (one of the diets used as control and RCD + CM increased the levels of TNF-α, IL-1β, IL-10 and VCAM-1 in the PAAT compared to WGD. Mice fed with HFD showed decreased contents of TNF-α, VCAM-1 and IL-10 in the PAAT compared to animals fed RCD. The RCD raised the levels of SFA in serum, cellularity and inflammatory state in the PAAT compared to WGD. In conclusion, the effects of obesogenic dietary regimens on PAAT can be interpreted differently when the results are compared with WGD or RCD. We found marked changes in the PAAT and no significant modifications in TA indicating this adipose tissue as the major starting point of vascular diseases.
NASA's Automated Rendezvous and Docking/Capture Sensor Development and Its Applicability to the GER
Hinkel, Heather; Cryan, Scott; DSouza, Christopher; Strube, Matthew
2014-01-01
This paper will address how a common Automated Rendezvous and Docking/Capture (AR&D/C) sensor suite can support Global Exploration Roadmap (GER) missions, and discuss how the model of common capability development to support multiple missions can enable system capability level partnerships and further GER objectives. NASA has initiated efforts to develop AR&D/C sensors, that are directly applicable to GER. NASA needs AR&D/C sensors for both the robotic and crewed segments of the Asteroid Redirect Mission (ARM). NASA recently conducted a commonality assessment of the concept of operations for the robotic Asteroid Redirect Vehicle (ARV) and the crewed mission segment using the Orion crew vehicle. The commonality assessment also considered several future exploration and science missions requiring an AR&D/C capability. Missions considered were asteroid sample return, satellite servicing, and planetary entry, descent, and landing. This assessment determined that a common sensor suite consisting of one or more visible wavelength cameras, a three-dimensional LIDAR along with long-wavelength infrared cameras for robustness and situational awareness could be used on each mission to eliminate the cost of multiple sensor developments and qualifications. By choosing sensor parameters at build time instead of at design time and, without having to requalify flight hardware, a specific mission can design overlapping bearing, range, relative attitude, and position measurement availability to suit their mission requirements with minimal nonrecurring engineering costs. The resulting common sensor specification provides the union of all performance requirements for each mission and represents an improvement over the current systems used for AR&D/C today. NASA's AR&D/C sensor development path could benefit the International Exploration Coordination Group (ISECG) and support the GER mission scenario by providing a common sensor suite upon which GER objectives could be achieved while
Mongkolthanaruk, Wiyada; Cooper, Gareth R.; Mawer, Julia S. P.; Allan, Raymond N.; Moir, Anne
2011-01-01
Spores of Bacillus subtilis require the GerAA, GerAB, and GerAC receptor proteins for l-alanine-induced germination. Mutations in gerAA, both random and site directed, result in phenotypes that identify amino acid residues important for receptor function in broad terms. They highlight the functional importance of two regions in the central, integral membrane domain of GerAA. A P324S substitution in the first residue of a conserved PFPP motif results in a 10-fold increase in a spore's sensitivity to alanine; a P326S change results in the release of phase-dark spores, in which the receptor may be in an “activated” or “quasigerminated” state. Substitutions in residues 398 to 400, in a short loop between the last two likely membrane-spanning helices of this central domain, all affect the germination response, with the G398S substitution causing a temperature-sensitive defect. In others, there are wider effects on the receptor: if alanine is substituted for conserved residue N146, H304, or E330, a severe defect in l-alanine germination results. This correlates with the absence of GerAC, suggesting that the assembly or stability of the entire receptor complex has been compromised by the defect in GerAA. In contrast, severely germination-defective mutants such as E129K, L373F, S400F, and M409N mutants retain GerAC at normal levels, suggesting more local and specific effects on the function of GerAA itself. Further interpretation will depend on progress in structural analysis of the receptor proteins. PMID:21378197
Shanmugaraju, Sankarasekaran; McAdams, Deirdre; Pancotti, Francesca; Hawes, Chris S; Veale, Emma B; Kitchen, Jonathan A; Gunnlaugsson, Thorfinnur
2017-09-13
We report here a novel one-pot synthetic strategy for the synthesis of a family of N-alkyl-1,8-naphthalimide based Tröger's bases via a nucleophilic substitution reaction of a common 'precursor' (or a 'synthon') N-aryl-1,8-naphthalimide Tröger's base heated at 80 °C in neat aliphatic primary amine, in overall yield of 65-96%. This methodology provides an efficient and one-step facile route to design 1,8-naphthalimide derived Tröger's base structures in analytically pure form without the use of column chromatography purification, that can be used in medicinal chemistry and as supramolecular scaffolds. We also report the formation of the corresponding anhydride, and the crystallographic analysis of two of the resulting products, that of the N-phenyl-4-amino-1,8-naphthalimide and the anhydride derived Tröger's bases.
Práticas de enfermeiros na gerência do cuidado em enfermagem e saúde: revisão integrativa
Directory of Open Access Journals (Sweden)
José Luís Guedes dos Santos
2013-04-01
Full Text Available Estudo com objetivo de evidenciar e analisar as práticas dos enfermeiros na gerência do cuidado descritas na produção científica brasileira e internacional, por meio de uma revisão integrativa. Foram pesquisados artigos publicados entre 2005 e 2010, nas bases LILACS, SciELO, BDENF e CINAHL, a partir dos descritores Gerência e Administração, associados a Cuidado e Enfermagem, e os termos Nursing Management e Nursing Care, totalizando 27 publicações. A gerência do cuidado realizada pelo enfermeiro relaciona-se diretamente à busca pela qualidade assistencial e de melhores condições de trabalho, por meio de ações como: realização do cuidado, gerência de recursos humanos e materiais, liderança, planejamento da assistência, capacitação da equipe de enfermagem, coordenação da produção do cuidado e avaliação das ações de enfermagem.
Saare Paadi eelkäija äriplaan valmis salvrätikule
2008-01-01
Ilmunud ka: Postimees : na russkom jazõke : v duhhe innovatsii 24. juuli lk. 4. Paadiehitusfirma Saare Paat juhataja Peeter Sääse sõnul on ettevõttel plaanis uue jahi tootmine, milleks soovitakse taotleda toetust Ettevõtluse Arendamise Sihtasutuselt. Lisa: AS Saare Paat. Kommenteerib Stig Nordblad
Teaching Management Information Systems as a General Education Requirement (GER) Capstone
Hoanca, Bogdan
2012-01-01
Although many IS programs nationwide use capstone courses in the major, this paper reports on the use of an upper division Management Information Systems (MIS) class as a general education requirements (GER) capstone. The class is a core requirement for all majors in the Bachelor of Business Administration (BBA) program at the University of Alaska…
Anna Pantelia
2013-01-01
17 September 2013 - Estonian Minister of Education and Research J. Aaviksoo signing the guest book with CERN Director-General R- Heuer; visiting the TOTEM facility with TOTEM Collaboration Spokesperson S. Giani; in the LHC tunnel at Point 5 with International Relations Adviser T. Kurtyka and visiting the CMS cavern with CMS Collaboration Spokesperson J. Incandela. International Relations Adviser R. Voss present.
TiGER: a database for tissue-specific gene expression and regulation.
Liu, Xiong; Yu, Xueping; Zack, Donald J; Zhu, Heng; Qian, Jiang
2008-06-09
Understanding how genes are expressed and regulated in different tissues is a fundamental and challenging question. However, most of currently available biological databases do not focus on tissue-specific gene regulation. The recent development of computational methods for tissue-specific combinational gene regulation, based on transcription factor binding sites, enables us to perform a large-scale analysis of tissue-specific gene regulation in human tissues. The results are stored in a web database called TiGER (Tissue-specific Gene Expression and Regulation). The database contains three types of data including tissue-specific gene expression profiles, combinatorial gene regulations, and cis-regulatory module (CRM) detections. At present the database contains expression profiles for 19,526 UniGene genes, combinatorial regulations for 7,341 transcription factor pairs and 6,232 putative CRMs for 2,130 RefSeq genes. We have developed and made publicly available a database, TiGER, which summarizes and provides large scale data sets for tissue-specific gene expression and regulation in a variety of human tissues. This resource is available at 1.
TiGER: A database for tissue-specific gene expression and regulation
Directory of Open Access Journals (Sweden)
Zack Donald J
2008-06-01
Full Text Available Abstract Background Understanding how genes are expressed and regulated in different tissues is a fundamental and challenging question. However, most of currently available biological databases do not focus on tissue-specific gene regulation. Results The recent development of computational methods for tissue-specific combinational gene regulation, based on transcription factor binding sites, enables us to perform a large-scale analysis of tissue-specific gene regulation in human tissues. The results are stored in a web database called TiGER (Tissue-specific Gene Expression and Regulation. The database contains three types of data including tissue-specific gene expression profiles, combinatorial gene regulations, and cis-regulatory module (CRM detections. At present the database contains expression profiles for 19,526 UniGene genes, combinatorial regulations for 7,341 transcription factor pairs and 6,232 putative CRMs for 2,130 RefSeq genes. Conclusion We have developed and made publicly available a database, TiGER, which summarizes and provides large scale data sets for tissue-specific gene expression and regulation in a variety of human tissues. This resource is available at 1.
Directory of Open Access Journals (Sweden)
Marreco, Maria Inês de Moraes
2012-01-01
Full Text Available Neste trabalho começa-se por definir o que se entende por conto. O artigo procura desenvolver uma breve reflexão em torno deste modo de narrar. O texto pretende fazer uma leitura dos contos A velha e Uma orelha, de Teolinda Gersão, tomando a ironia como fio condutor dessas narrativas. Nesses contos, o imaginário da escritora portuguesa, tecido pela ironia é alimentado pelo desejo de enfrentar a realidade humana, transgredindo convenções. O conflito se instala entre a fantasia e a realidade. Finalmente, analisar-se-á a correspondência mantida entre a velha e Isaura, tendo em conta a velhice, a morte, o abandono e a representação
Modelo de integração do WAP no apoio à gerência de redes TCP/IP
Carvalho, Cristhian Flamariom Gomes de
2002-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Ciência da Computação. Com o crescimento do uso de redes de computadores e do aumento da complexidade das aplicações envolvidas, a importância do uso de mecanismos e sistemas de gerenciamento de redes vem aumentando ao longo dos últimos anos. Várias arquiteturas e ferramentas de gerência de redes foram desenvolvidas, se destacando o modelo SNMP e, atualmente, o modelo de gerênc...
Directory of Open Access Journals (Sweden)
Peter Ay
2009-05-01
Full Text Available Review of the edited volume: Manfred Schulz (ed.: Entwicklungsträger in der DR Kongo. Entwicklungen in Politik, Wirtschaft, Religion, Zivilgesellschaft und Kultur, Wien: Lit-Verlag 2007(= Spektrum 100; Berliner Reihe zu Gesellschaft, Wirtschaft und Politik in Entwicklungsländern 2007, ISBN 978-3825804251,755 pages. Besprechung des Sammelbandes: Manfred Schulz (Hrsg.: Entwicklungsträger in der DR Kongo. Entwicklungen in Politik, Wirtschaft, Religion, Zivilgesellschaft und Kultur, Wien: Lit-Verlag 2007 (= Spektrum 100; Berliner Reihe zu Gesellschaft, Wirtschaft und Politik in Entwicklungsländern, ISBN 978-3825804251, 755 Seiten.
Abe, Kimihiro; Shimizu, Shin-Ya; Tsuda, Shuhei; Sato, Tsutomu
2017-09-12
Gene rearrangement is a widely-shared phenomenon in spore forming bacteria, in which prophage(-like) elements interrupting sporulation-specific genes are excised from the host genome to reconstitute the intact gene. Here, we report a novel class of gene-intervening elements, named gin, inserted in the 225 bp gerE-coding region of the B. cereus ATCC10987 genome, which generates a sporulation-specific rearrangement. gin has no phage-related genes and possesses three site-specific recombinase genes; girA, girB, and girC. We demonstrated that the gerE rearrangement occurs at the middle stage of sporulation, in which site-specific DNA recombination took place within the 9 bp consensus sequence flanking the disrupted gerE segments. Deletion analysis of gin uncovered that GirC and an additional factor, GirX, are responsible for gerE reconstitution. Involvement of GirC and GirX in DNA recombination was confirmed by an in vitro recombination assay. These results broaden the definition of the sporulation-specific gene rearrangement phenomenon: gene-intervening elements are not limited to phage DNA but may include non-viral genetic elements that carry a developmentally-regulated site-specific recombination system.
Gerli Padar läheb Eurovisioonile. Eurolaulu valiti 1,3 miljoni miljoni eest
2007-01-01
3. veebr. toimunud laulukonkursi Eurolaul 2007 võitis . Gerli Padar lauluga "Partners in Crime" (helilooja Hendrik Sal-Saller, sõnad Berit Veiber), teisele kohale jäi "Romeo ja Julia" Hele Kõre ja Kristjan Kasearu esituses, kolmandale Laura looga "Sunflowers". Telefonihääletusest ETV saates Eurolaul 2007
Sangla, Katrin
2002-01-01
Küsitletakse soengukunsti maailmameistrivõistlustel Hair World 2002 Las-Vegases osalenud juuksur Tamara Korjaginat, jumestuskunstnik Katrin Sanglat ja moekunstnik Gerly Tinni võistluse kohta. Saavutasid võiskondlikus arvestuses kolmanda koha
Toplumcu gerçekçilik ve Sabahattin Ali'nin hikâye kişileri
Hasdedeoğlu, Mehmet Onur
2008-01-01
Bu çalısmanın konusu, günümüzde devrini tamamlamıs olan toplumcu gerçekçilik akımının ilkeleri dorultusunda, Sabahattin Ali'nin hikâye kisilerini tanımaktır. Ulasılması hedeflenen amaç, edebiyatın çesitli türlerinde eserler vermis olmasına karsın daha çok hikâyeci kimligiyle öne çıkan Sabahattin Ali'nin, hikâyelerinde yarattıgı kahramanları inceleme yoluyla, temsilcisi oldugu toplumcu gerçekçilik akımı içerisindeki yerini belirlemektir. Çalısmanın çekirdegini olusturan ?Sabahattin Ali'nin Hik...
An attempt to define contemporary religious representations and practices: Danièle Hervieu-Léger
Directory of Open Access Journals (Sweden)
Yu V Yatsutsenko
2014-12-01
Full Text Available The contemporary social reality is marked by a considerable change of religious views and practices: the religion itself becomes a worldview option; the religious individuals are more autonomous from the religious institutions; individuals get an opportunity to construct and approve different beliefs; the religious identity transmission mechanisms weaken; the privatized religious ethics is legitimized outside the religious institutions. Danièle Hervieu-Léger’s theory presents one of the ways for the sociological conceptualization of the problems mentioned. The concept ‘bricolage’ is used by Hervieu-Léger as a technical explanation of the religious life deinstitutionalization. We define the bricolage as an individual practice that overcomes system-imposed modes and means of production, as an activity based on a random set of available elements. Hervieu-Léger notes that the main feature of the contemporary religiosity is the bricolage freedom, i.e. the freedom to construct an individual religious ethics. However, such a mode of social control does not necessarily lead to religious negligence or radical individualism. French sociologist believes that the generational transfers of religious identity are weakening and the in-out decisions in religious communities are becoming easier. According to Hervieu-Léger, such a movement itself becomes the main behavioral motif for contemporary religious agents for it is responsible not only for the individual religious pursuit, but for the collective construction and exchange of the religious experience.
Mikrodenetleyici Denetimli Televizyon Deney Seti Tasarımı ve Gerçekleştirilmesi
Directory of Open Access Journals (Sweden)
Serdar ÇİÇEK
2009-03-01
Full Text Available Bu çalışmada, teknik ve mesleki eğitim veren fakülteler, yüksekokullar, endüstri meslek liseleri, çıraklık ve yaygın eğitim merkezleri, meslek kursu veren belediyeler ve özel eğitim merkezleri vb. kurumlardaki görüntü sistemleri, televizyon tekniği, televizyon teknik servisliği gibi televizyon sisteminin ve televizyon arıza-onarım-bakım konularının işlendiği derslerde, derslerin pratik uygulama kısmında kullanılmak üzere bir televizyon deney seti tasarlanmış ve gerçekleştirilmiştir. Bu deney seti ile öğrenciler/ kursiyerler derste edindiği teorik bilgiler ışığında televizyon sistemlerini daha iyi kavrayabilecek, televizyon arızalarını bulma becerisini uygulamalı olarak geliştirebilecektir. Deney setine ek olarak televizyon ile bağlantılı bir ölçüm panosu da gerçekleştirilmiştir. Böylece televizyon üzerinde istenen ölçümler rahatça yapılabilmektedir. Geliştirilen deney setinde, kullanıcının birden fazla hatayı aynı anda gerçekleştirerek hata bulma adımlarını geliştirmesi mümkündür.
Medya İletilerinin Gerçeği Yansıtma Düzeylerinin Öğrenci Görüşlerine Göre Tespiti
Directory of Open Access Journals (Sweden)
Fatih GÜNER
2014-09-01
Full Text Available Çocukların 12 yaşına kadar gerçek dünya ve medya dünyası arasında fark göremediği gerçeği göz önüne aldığında, ülkemizdeki 5. ve 6. sınıf öğrencilerine medya eğitiminin verilemiyor olması düşündürücüdür. Bu durum, ülkemizde seçimlik ders kapsamında medya okuryazarlığı eğitimi alan 7. ve 8. sınıf öğrencilerinin, “gerçeklik” sorununu taşıdığı bilinen televizyon dizilerinin sıkı takipçileri oldukları gerçeği ile birleşince böyle bir çalışmanın ortaokul öğrencileri ile yapılma gereksinimi ortaya çıkmaktadır. Bu çalışma, medyadaki “gerçeklik” sorunundan hareketle öğrencilerin medya iletilerinin gerçeği yansıtma düzeylerine yönelik görüşlerini derinlemesine incelemeyi amaçlamaktadır. Çalışma, 2013- 2014 öğretim yılında, Çanakkale’de 4 ortaokulda, toplam 20 öğrencinin katılımıyla gerçekleştirilmiştir. Araştırmada, tarama türünde nitel araştırma deseni kullanılmış, görüşmeler yoluyla veriler toplanmıştır. Çalışmada, katılımcıların en sık kullandıkları medya aracının televizyon, en güvenilir buldukları medya aracının gazete olduğu görülmektedir. Çalışmada medya dünyasının sahte, kurmaca bir dünya olduğunu ifade edemeyen katılımcılar çoğunluktadır. Katılımcıların büyük çoğunluğunun, medya iletisi olan televizyon dizilerinin, gerçeği yansıttığına yönelik görüş bildirdikleri görülmektedir.
2013-08-21
... ``L[eacute]ger: Modern Art and the Metropolis,'' imported from abroad for temporary exhibition within... objects at the Philadelphia Museum of Art, Philadelphia, Pennsylvania, from on or about October 10, 2013...
[Experimental testing of Pflüger's reflex hypothesis of menstruation in late 19th century].
Simmer, H H
1980-07-01
Pflüger's hypothesis of a nerve reflex as the cause of menstruation published in 1865 and accepted by many, nonetheless did not lead to experimental investigations for 25 years. According to this hypothesis the nerve reflex starts in the ovary by an increase of the intraovarian pressure by the growing follicles. In 1884 Adolph Kehrer proposed a program to test the nerve reflex, but only in 1890, Cohnstein artificially increased the intraovarian pressure in women by bimanual compression from the outside and the vagina. His results were not convincing. Six years later, Strassmann injected fluids into ovaries of animals and obtained changes in the uterus resembling those of oestrus. His results seemed to verify a prognosis derived from Pflüger's hypothesis. Thus, after a long interval, that hypothesis had become a paradigma. Though reasons can be given for the delay, it is little understood, why experimental testing started so late.
Securitización en el desierto: Una respuesta al terrorismo en Malí y en Níger, 2009 - 2013.
Guerrero Escobar, Laura Catalina
2014-01-01
Este es un estudio sobre las dinámicas de seguridad en Malí durante el periodo de 2009 a 2013. La investigación busca explicar de qué manera se ha dado un proceso de securitización de los grupos insurgentes frente a la amenaza generada por la proliferación de grupos armados no estatales en el territorio comprendido entre Malí y Níger. Se toma a Níger con el ánimo de ver la existencia de un subcomplejo regional de seguridad entre este país y Malí. De esta manera se afirma que el aumento de las...
International Nuclear Information System (INIS)
Ali, Aamir; Jakobsen, Morten
2011-01-01
We have investigated the accuracy of Rüger's approximation for PP reflection coefficients in HTI media (relative to an exact generalization of Zoeppritz to anisotropy derived by Schoenberg and Protazio) within the context of seismic fracture characterization. We consider the inverse problem of seismic amplitude-versus-angle and azimuth (AVAZ) inversion with respect to fracture density and azimuthal fracture orientation, as well as the forward problem of calculating PP reflection coefficients for different contrasts and anisotropy levels. The T-matrix approach was used to relate the contrast and anisotropy level to the parameters of the fractures (in the case of a single set of vertical fractures). We have found that Rüger's approximation can be used to recover the true fracture density with small uncertainty if, and only if, the fracture density and contrast are significantly smaller than the values that are believed to occur in many practically interesting cases of fractured (carbonate) reservoirs. In one example involving a minimal contrast and a fracture density in the range 0.05–0.1, Rüger's approximation performed satisfactorily for inversion, although the forward modelling results were not very accurate at high incident angles. But for fracture densities larger than 0.1 (which we believe may well occur in real cases), Rüger's approximation did not perform satisfactorily for forward or inverse modelling. However, it appears that Rüger's approximation can always be used to obtain estimates of the azimuthal fracture orientation with small uncertainty, even when the contrast and anisotropy levels are extremely large. In order to illustrate the significance of our findings within the context of seismic fracture characterization, we analysed a set of synthetic seismic AVAZ data associated with a fault facies model where the fracture density decreases exponentially with distance from the fault core, and a set of real seismic AVAZ data involving offset
Directory of Open Access Journals (Sweden)
Oktay YİVLİ
2013-09-01
Full Text Available In narrations of magical reality, real and unreal, ordinary andextraordinary, authentic and imaginary elements exist together withoutany conflict. Magical Realism flourishes especially in the twentiethcentury Latin American Literature. This sense results from the struggleof comprehending and narrating new reality as opposed to fantasticfictions and tales. In his novel called Kayıp Hayaller Kitabı, Hasan AliToptaş included the techniques and elements used in the samples ofmagical realism, such as de-familiarization, singularity, indefiniteness,dead people and multiple narrators.As be different fantastic in magical realism fictional people havebeen to become inured to in a world which is together realty and magic,just about accepted it as a natural media. Formal notice of magicalrealism from fantastic is that it selects spaces from realty world notimaginary world.In his novel called Kayıp Hayaller Kitabı, external reality isn’talways reflected one to one. The narration differentiates from classicnarrative structure reality in terms of presentations. Event descriptionsseen, heard and dreamed are presented in an imaginary order. In thenovel, the nature of entities and objects are given as changed Thus ittries to catch to catch another dimension of reality. The people in thenovel doubt from their own realities. What is real, what is not realbecome confused.After all these features, the novel studied should be considered asa magical realistic novel and should be evaluated as use aesthetics ofmagical realism. Büyülü gerçekçi anlatılarda gerçekle gerçek dışı, olağanla olağan olmayan, düşsel ile sahici ögeler aynı dünyanın içinde herhangi bir çatışmaya girmeden yaşarlar. Büyülü gerçekçilik özellikle yirminci yüzyıl Latin Amerikan edebiyatında gelişip serpilmiştir. Bu anlayış fantastikten ve masaldan ayrı olarak yeni gerçekliği kavramanın ve anlatmanın bir çabası olarak ortaya çıkmıştır. Hasan Ali
Energy Technology Data Exchange (ETDEWEB)
Tirkkonen, J [Tampere Univ. (Finland). Dept. of Regional Studies; Wilenius, M [Helsinki Univ. (Finland). Inst. for Cooperative Studies
1997-12-31
One of the aims of SILMU, the Finnish Research Programme for Climate Change, was to produce information for decision-makers concerning climate change and its mitigation. One integrative project for this purpose was PAATE, an inquiry into the present state and future possibilities of interaction between researchers and decision-makers. The aims of the PAATE project can be summarised as follows: (1) to conduct a survey of the state of climate change research and climate policy in Finland, (2) to develop the interaction between climate research, policy makers and different societal organisations, (3) to acquire methodological experiences on the realisation of projects of this type, (4) to provide material for the final report of the SILMU project and for further action, and (5) to promote the rational development of climate policy. Methodologically, the PAATE project used the Delphi technique employed chiefly in futurological research. A method based on expert knowledge, the Delphi technique assesses the possibilities and conditions of future development through e.g. panel discussions between experts. Also the experiences of the similar project conducted in Netherlands were utilised
Energy Technology Data Exchange (ETDEWEB)
Tirkkonen, J. [Tampere Univ. (Finland). Dept. of Regional Studies; Wilenius, M. [Helsinki Univ. (Finland). Inst. for Cooperative Studies
1996-12-31
One of the aims of SILMU, the Finnish Research Programme for Climate Change, was to produce information for decision-makers concerning climate change and its mitigation. One integrative project for this purpose was PAATE, an inquiry into the present state and future possibilities of interaction between researchers and decision-makers. The aims of the PAATE project can be summarised as follows: (1) to conduct a survey of the state of climate change research and climate policy in Finland, (2) to develop the interaction between climate research, policy makers and different societal organisations, (3) to acquire methodological experiences on the realisation of projects of this type, (4) to provide material for the final report of the SILMU project and for further action, and (5) to promote the rational development of climate policy. Methodologically, the PAATE project used the Delphi technique employed chiefly in futurological research. A method based on expert knowledge, the Delphi technique assesses the possibilities and conditions of future development through e.g. panel discussions between experts. Also the experiences of the similar project conducted in Netherlands were utilised
DEFF Research Database (Denmark)
Jørgensen, Emmy Brandt
2009-01-01
Artiklen er et lille indlæg om, hvordan man har anvendt Florence Nightingale i danske lærebøger for sygeplejersker som en legitimeringsfigur i forbindelse med forandringer inden for det danske hospitalsvæsen. Perioden, der behandles, er tiden før og efter skiftet til den kliniske medicin i Danmark...
Berlage, S; Grüßner, S; Lack, N; Franz, H B G
2015-01-01
Severe and very rare obstetric complications (e.g. eclampsia, postpartum haemorrhage or uterine rupture), typically culminate in a chaotic, uncontrollable sequence of events. Outcome for mother and child depends on whether doctors and midwives are able to quickly take correct decisions and initiate optimal treatment. GerOSS (German Obstetric Surveillance System) aims at generating deeper insight into relevant risk factors to improve diagnosis and treatment of severe complications during pregnancy and delivery. As such it is primarily conceived as a system for quality improvement and less as a register. Another focus is the provision of an information and communication platform for dissemination of these insights. Finally, incidences of selected rare obstetric events may be derived. These rare events are monitored for two to five years in Lower Saxony, Bavaria and Berlin. Quantitative analyses of aggregate data are complemented with in depth case based anonymised evaluations by experts. The temporal sequence of measures taken as well as the management of care is inspected. Participants receive a feedback of comments on the synopsis of individual cases. Aggregate data results are published and made available through the GerOSS platform. A scientific advisory committee ensures the link with the professional scientific bodies. A comparison within INOSS (International Network of Obstetric Survey Systems) allows additional insights into the treatment of obstetric rare diseases and complications. More reliable estimates of the incidence of such events can be computed and compared within a larger database. Following the implementation in three federal states in Germany in 2010, participation in GerOSS-Project has increased to 100% of all hospitals with a delivery unit in Lower Saxony, 30% in Bavaria and 80% in Berlin. Feasibility of the project is shown by successful implementation of GerOSS. Quantitative analyses enable construction of risk profiles (e.g. for the
Directory of Open Access Journals (Sweden)
Julia K. Clark
2015-03-01
Full Text Available The environment of the mountain-steppe-taiga of northern Mongolia is often characterized as marginal because of the high altitude, highly variable precipitation levels, low winter temperatures, and periodic droughts coupled with severe winter storms (known as dzuds. Despite these conditions, herders have inhabited this landscape for thousands of years, and hunter-gatherer-fishers before that. One way in which the risks associated with such a challenging and variable landscape are mitigated is through social networks and inter-family cooperation. We present an agent-based simulation, Ger Grouper, to examine how households have mitigated these risks through cooperation. The Ger Grouper simulation takes into account locational decisions of households, looks at fission/fusion dynamics of households and how those relate to environmental pressures, and assesses how degrees of relatedness can influence sharing of resources during harsh winters. This model, coupled with the traditional archaeological and ethnographic methods, helps shed light on the links between early Mongolian pastoralist adaptations and the environment. While preliminary results are promising, it is hoped that further development of this model will be able to characterize changing land-use patterns as social and political networks developed.
Aprimorando a Gerência e o Desenvolvimento de Software com Metodologias Ágeis
Directory of Open Access Journals (Sweden)
Mauricio Andreazza Sganderla
2016-07-01
Full Text Available Este artigo aborda a melhoria da gerência e construção de software utilizando as metodologias ágeis eXtreme Programming e Scrum. São aplicadas as melhores práticas de ambas as metodologias em uma equipe de desenvolvimento de software, em um ambiente em que não havia nenhum processo bem definido de desenvolvimento de software. A escolha pelo uso das metodologias ágeis foi definida, pois atende ao dinamismo do cenário atual, requisitos voláteis, ambiente mais colaborativo e menos burocrático, tendo como objetivo principal o software em funcionamento e que realmente traga retorno ao cliente.
Hacking interdit découvrez les techniques des hackers pour mieux vous protéger
Gomez-Urbina, Alexandre
2010-01-01
Aujourd'hui, impossible de surfer sur Internet sans protection efficace ! Mais même avec des logiciels appropriés, nul n'est à l'abri du danger ! Virus, usurpations d'adresse IP, troyens, intrusions dans votre système, attaques par phishing : l'imagination des pirates est sans limite ! La seule solution est de vous protéger efficacement et pour cela, un moyen : connaître les techniques des hackers pour mieux déjouer leurs pièges ! Un internaute averti en vaut deux !
Energy Technology Data Exchange (ETDEWEB)
Afman, M.; Bijleveld, M. [CE Delft, Delft (Netherlands); Mulder, M. [Mrabella Mulder Waste Water Management, Utrecht (Netherlands)
2012-03-15
Alternative processes are available for both wastewater treatment at sewage works and drinking water preparation at water production plants. Some of these involve greater use of chemicals and auxiliary materials, and an important issue is therefore how the energy savings achieved with a particular option compare with the energy required to produce the auxiliaries in question. Against this background a study was carried out to assess the energy consumption of auxiliaries production. For the auxiliaries most frequently used the following were determined: (1) the energy impact of production, expressed as the Gross Energy Requirements (GER) of the materials in question, broken down into renewable versus non-renewable energy; and (2) the environmental impact of production, expressed as a single indicator according to the ReCiPe methodology. The report also provides 'user recommendations' for the calculated values (what they should and should not be used for) and an explanation of the methodology used. The study dovetails with the STOWA research programme 'The Energy Plant', a study exploring the potential for reducing the energy consumption of sewage works to such an extent as to make them net suppliers of energy [Dutch] Voor de behandeling van afvalwater in een rioolwaterzuiveringsinstallatie (RWZI) en de bereiding van drinkwater bij waterproductiebedrijven bestaan alternatieve processen. Sommige processen zorgen voor een hogere dosering van chemicaliën en hulpstoffen in het zuiveringsproces. Een belangrijk aandachtspunt hierbij is of de energiebesparing die behaald wordt met een zuiveringsvariant, opweegt tegen de energie-impact van de productie van de benodigde hulpstoffen. Om deze reden is een studie uitgevoerd gericht op het energieverbruik van de productie van de hulpstoffen. Van de meest gebruikte hulpstoffen zijn bepaald: (1) de energie-impact van de productie van de hulpstoffen, uitgedrukt in de GER-waarde (bruto primaire energie) van de
Uma proposta para gerência do conhecimento ao longo do processo de desenvolvimento de produto
Andrade, Maria Teresinha Tamanini
2005-01-01
As organizações vêm criando mecanismos para gerenciar suas diversas fontes de conhecimento, permitindo que este flua através de suas diversas áreas e se multiplique pelo aprendizado organizacional. Neste contexto, atividades dedicadas a promover a criação, registro e compartilhamento do conhecimento, a denominada Gerência do Conhecimento, fazem-se necessárias, de forma que o capital intelectual das organizações seja gerenciado eficientemente e com a participação de todos. Além disso, os proce...
Arıcı, Volkan Aydın
2013-01-01
Araştırmada sanal gerçeklik programlarının sunmuş olduğu üç boyutlu görsel malzemelerin, ilköğretim 7. sınıf öğrencilerinin fen ve teknoloji dersindeki astronomi konusundaki başarılarına ve kalıcılıklarına etkisini araştırmak amaçlanmıştır. Bu amaç doğrultusunda ilköğretim 7. Sınıf öğrencilerinin zihinlerinde astronomi konularını daha iyi yapılandırabilmek amacıyla sanal gerçeklik programlarına uygun etkinlik yaprakları geliştirilmiştir. Hazırlanan etkinlik yaprakları sanal gerçeklik programl...
Sakslased kolisid jahtide tootmise kodumaale tagasi / Toivo Tänavsuu
Tänavsuu, Toivo
2004-01-01
Saksamaa suurimaid jahitootjaid Kiel Classic lõpetas paatide tootmise Eestis, kuna firma siinne allhankepartner Saare Paat ei pidanud väidetavalt tähtaegadest kinni ning tootis viletsa kvaliteediga jahte
Sensitivity of diamond-capped impedance transducer to Tröger's base derivative.
Stehlik, Stepan; Izak, Tibor; Kromka, Alexander; Dolenský, Bohumil; Havlík, Martin; Rezek, Bohuslav
2012-08-01
Sensitivity of an intrinsic nanocrystalline diamond (NCD) layer to naphthalene Tröger's base derivative decorated with pyrrole groups (TBPyr) was characterized by impedance spectroscopy. The transducer was made of Au interdigitated electrodes (IDE) with 50 μm spacing on alumina substrate which were capped with the NCD layer. The NCD-capped transducer with H-termination was able to electrically distinguish TBPyr molecules (the change of surface resistance within 30-60 kΩ) adsorbed from methanol in concentrations of 0.04 mg/mL to 40 mg/mL. An exponential decay of the surface resistance with time was observed and attributed to the readsorption of air moisture after methanol evaporation. After surface oxidation the NCD cap layer did not show any leakage due to NCD grain boundaries. We analyzed electronic transport in the transducer and propose a model for the sensing mechanism based on surface ion replacement.
Bereng, Reitumetse Esther
2017-01-01
Abstract: Over the years, copious research has been done on variety of voluntary sustainable development initiatives including Corporate Social Responsibility. This research takes a different route to Corporate Social Responsibility, by looking into this voluntary initiative through the spectrum of the United Nations Global Compact. It looks into the United Nations Global Compact as a mechanism for Corporate Social Responsibility in order to find out the true motives behind Krüger A/S engagin...
Directory of Open Access Journals (Sweden)
Anders Nattestad
2004-05-01
Full Text Available
Første gang publiceret i UNEV nr. 3: Internet Video: Teknik og pædagogik mødes på nettet, april - juni 2004, red. Jens Dørup. ISSN 1603-5518.
Artiklen omhandler erfaringer med brug af digital video til at lære kirurgiske procedurer for tandlægestuderende og tandlæger under efteruddannelse. Der beskrives 4 års tekniske og pædagogiske erfaringer med in-house produktion af digitale videooptagelser af operationer, som tilgås on-demand. Endvidere beskrives streaming af video til efteruddannelse i forbindelse med et arrangement, hvor video fra kæbeoperationer blev transmitteret live fra Tandlægeskolen i København til Bella Centret, hvor 250 tandlæger overværede seancen på storskærm. Det blev valgt at bruge eksisterende udstyr, herunder eksisterende Internet forbindelser uden forsøg på at reservere båndbredde. Afslutningsvis tegnes nogle perspektiver for fremtidige anvendelsesmuligheder både teknisk og pædagogisk.
Giordani, Luiz Otávio
2002-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Ciência da Computação. Os SGBDD - Sistemas de Gerência de Banco de Dados Distribuídos resultam da união de duas tecnologias: A tecnologia dos SGBDs - Sistemas de Gerência de Banco de Dados; e da tecnologia das Redes de Computadores. Um SGBD tem o objetivo de gerenciar o armazenamento e a recuperação dos dados, escondendo do usuário a forma com que os dados são armazenados e rec...
Milleks laulupeotuld vedanud laevad veel sobivad? / Tiit Pruuli ; laulusõnad Jaan Tätte
Pruuli, Tiit, 1965-
2009-01-01
Laulupeotuld kandnud veesõidukitest: viikingipaat "Turm", kakuami-paat, kale "Paula", lootsik "Hermiine Rääbis", lodi "Jõmmu", puulaev "Elisabeth II" ja jahta "Runbjarn". Lisatud Jaan Tätte laulu "Tuulevaiksel ööl" sõnad
Naised valikute ees / Ave Paavo
Paavo, Ave
2006-01-01
Mõedaku spordibaasi juhataja Anu Kilk, äritarkvarafirma Oracle Eesti, Läti, Leedu finantsjuht Anne Oja-Aru, restoranide Balthasar, Karl Friedrich, Paat ja trahteri Postipoiss üldjuht Ritta Roosaar oma tööalastest valikutest
Viira, Aigi
1999-01-01
Teatrifestivali Draama 99 preemiad : lavastajapreemiad: Elmo Nüganen ("Kuritöö ja karistus"), Priit Pedajas ("Mao tee kalju peal"), naisnäitleja preemiad : Merle Jääger ("Omavahelisi jutuajamisi tädi Elliga"), Anne Reeman ("Kolmekrossiooper"), meesnäitleja preemia : Indrek Sammul ("Kuritöö ja karistus"), kõrvalosatäitja preemiad : Anu Lamp (" Kolmekrossiooper " ja "Kuritöö ja karistus"), Peeter Tammearu ("Kolmekrossiooper", "Kuritöö ja karistus"), kunstnikupreemia : Vladimir Anshon ("Kolmekrossiooper"), žürii eripreemiad : Merle Karusoo ("Küüdipoisid"), Rein Agur ("Cymbeline")
Wang, Zhenggong; Ren, Huiting; Zhang, Shenxiang; Zhang, Feng; Jin, Jian
2018-03-09
Carbon molecular sieve (CMS)-based membranes have attracted great attention because of their outstanding gas-separation performance. The polymer precursor is a key point for the preparation of high-performance CMS membranes. In this work, a microporous polyimide precursor containing a Tröger's base unit was used for the first time to prepare CMS membranes. By optimizing the pyrolysis procedure and the soaking temperature, three TB-CMS membranes were obtained. Gas-permeation tests revealed that the comprehensive gas-separation performance of the TB-CMS membranes was greatly enhanced relative to that of most state-of-the-art CMS membranes derived from polyimides reported so far. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Mis on parem - Zaporozhets või Mercedes? / Andres Langemets
Langemets, Andres, 1948-
2007-01-01
Vastukaja Mikko Lagerspetzi artiklile 5. dets. Postimehes, mis oli omakorda vastukaja Jaak Aaviksoo artiklile 19. nov. Postimehes. Sotsioloogiast, sotsiaalteadlastest ja sotsioloogilistest küsitlustest
Abdulhamid, Mahmoud A.
2017-10-12
A newly designed carbocyclic pseudo Tröger\\'s base diamine (CTB) monomer, 2,8-dimethyl-3,9-diamino-5,6,11,12-tetrahydro-5,11-methanodibenzo[a,e][8]annulene (CTBDA) and its isomeric analogue 2,8-dimethyl-(1,7)(4,10)(3,9)-diamino-5,6,11,12-tetrahydro-5,11-methanodibenzo[a,e][8]annulene (iCTBDA), were designed for the synthesis of microporous 6FDA-based polyimides (6FDA-CTBDA and 6FDA-iCTBDA). Both polyimides were soluble, exhibited excellent thermal stability of ∼490 °C, and had high surface areas of 587 m2 g−1 (6FDA-CTBDA) and 562 m2 g−1 (6FDA-iCTBDA). A 6FDA-based polyimide derived from 4,10-dimethyl-3,9-diamino-6H,12H-5,11-methanodibenzo[b,f][1,5]-diazocine (6FDA-TBDA) was made for comparison to investigate the effects of the basic tertiary nitrogen functionality in the Tröger\\'s base diamine on the polymer properties relative to the carbocyclic 6FDA-CTBDA analogue. 6FDA-TBDA displayed lower gas permeabilities but moderately higher gas-pair permselectivities than 6FDA-CTBDA. The enhanced permselectivity of 6FDA-TBDA resulted exclusively from higher diffusion-based selectivity. Direct gas sorption measurements demonstrated that the basicity in the Tröger\\'s base bridge moiety enhanced the sorption capacity of CO2 only slightly and had no effect on the CO2/CH4 solubility selectivity in 6FDA-TBDA vs. 6FDA-CTBDA.
Projeto gerência de trabalho e inclusão social de usuários de saúde mental
Salis, Ana Cecília Alvares
2013-01-01
Como proposta pioneira de inclusão social pela via do trabalho, o projeto Gerência de Trabalho apresenta-se como modelo de uma nova prática de cuidados no campo da saúde mental, e tem como objetivo estabelecer as condições de acesso e de permanência de pessoas com transtorno mental no mercado formal de trabalho. Partindo de diretrizes específicas, esse projeto não só investe na ampliação de possibilidades democráticas de inclusão social a usuários de saúde mental como também abre um novo camp...
Directory of Open Access Journals (Sweden)
Marcelo Costa Fernandes
2016-10-01
Full Text Available Objetivo: Analisar as facilidades e dificuldades das enfermeiras gerentes na implementação da gerência do cuidado no ambiente hospitalar. Métodos: Trata-se de um estudo descritivo, com abordagem qualitativa realizado no período de outubro a novembro de 2012, em um hospital público de nível terciário da cidade de Fortaleza-CE. A coleta de dados foi feita através de entrevista semiestruturada, a técnica utilizada para a interpretação dos dados foi à análise de conteúdo. Resultados: Foram encontrados como fatores facilitadores no desenvolvimento da gerência do cuidado o apoio da líder do setor de enfermagem do hospital e a relação dialética entre os membros da equipe. Como fatores impeditivos observaram-se a estrutura física do hospital e a falta de pessoal. Conclusão: O estudo busca sensibilizar a discussão sobre a gerência do cuidado, pois a articulação entre as atividades gerenciais e de cuidado, é importante para inovação e renovação do processo de trabalho do enfermeiro.
Big(ger Data as Better Data in Open Distance Learning
Directory of Open Access Journals (Sweden)
Paul Prinsloo
2015-02-01
Full Text Available In the context of the hype, promise and perils of Big Data and the currently dominant paradigm of data-driven decision-making, it is important to critically engage with the potential of Big Data for higher education. We do not question the potential of Big Data, but we do raise a number of issues, and present a number of theses to be seriously considered in realising this potential. The University of South Africa (Unisa is one of the mega ODL institutions in the world with more than 360,000 students and a range of courses and programmes. Unisa already has access to a staggering amount of student data, hosted in disparate sources, and governed by different processes. As the university moves to mainstreaming online learning, the amount of and need for analyses of data are increasing, raising important questions regarding our assumptions, understanding, data sources, systems and processes. This article presents a descriptive case study of the current state of student data at Unisa, as well as explores the impact of existing data sources and analytic approaches. From the analysis it is clear that in order for big(ger data to be better data, a number of issues need to be addressed. The article concludes by presenting a number of theses that should form the basis for the imperative to optimise the harvesting, analysis and use of student data.
Eestis toimub esimene vanemaealiste uuring / Merle Paats
Paats, Merle
2010-01-01
18. novembril Eestis alanud SHARE uuringust (Survey of Health, Ageing and Retirement in Europe), mille käigus saadakse ülevaade 50-aastaste ja vanemate elanike tervislikust seisundist ja toimetulekust. Tegemist on rahvusvahelise uuringuga, mida samal ajal korraldavad 19 Euroopa riiki. Eestis korraldab SHARE uuringut Statistikaamet koos sotsiaalministeeriumi, Tallinna Ülikooli, Tervise Arengu Instituudi ning Eesti Gerontoloogia ja Geriaatria Assotsiatsiooniga
Rector's office as of 31 December 2006
2007-01-01
Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
2007-01-01
Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
GARCIA, A. N.
2015-01-01
Este trabalho propõe uma análise do clima organizacional existente na Gerência de Controle Ambiental do Instituto Estadual de Meio Ambiente e Recursos Hídricos GCA/IEMA, após um período caracterizado por inúmeras discussões a respeito de plano de carreiras e aumento salarial. Para fundamentar tal análise realizou-se a caracterização da cultura do IEMA junto aos colaboradores da instituição e a identificação de fatores relevantes à análise do clima organizacional junto aos colaboradores dos s...
Tallinna Sakala keskuse projekt kütab kirgi / Aivo Vahemets
Vahemets, Aivo
2004-01-01
Raine Karbi projekteeritud hoone ümberehituse projekt telliti Inglismaalt büroost Burrow&Cave, OÜ Arhitektuuriagentuuri projektist loobuti. Eesti Arhitektide Liidu esinaise Margit Mutso ja arhitektuurinõukogu esimehe Peep Aaviksoo kommentaar
Harnden, Toby
2011-01-01
Raamatu "Dead Men Risen" autor räägib oma blogis Eesti kaitseministri Jaak Aaviksoo ja president Toomas Hendrik Ilvese reageeringutest teosele, kus on juttu ka Afganistanis teeninud Eesti kaitseväelastest
Teder, Teet
2011-01-01
Toby Harndeni raamatust "Dead Men Risen", kus on juttu ka Afganistanis teeninud Eesti kaitseväelastest. Kaitseminister Jaak Aaviksoo ja president Toomas Hendrik Ilvese reageeringutest. Vt. ka lk. 10: Uudam, Laur. Eetikapomm
2011-01-01
16. detsembril Tartus toimunud Eesti-Läti koostöökonverentsist võtsid osa ka mõlema riigi peaministrid Andrus Ansip ja Valdis Dombrovskis. Kohal olid ka haridusministrid Jaak Aaviksoo ja Roberts Kilis
Samaja bolshaja stroiploshtshadka v Estonii / Konstantin Morenko
Morenko, Konstantin
2004-01-01
Tallinna linnavalitsus korraldas ümarlaua linna rannaalade hetkeseisu ja arenguvõimaluste hindamiseks, mille töös osalesid ka Euroopa tuntud linnaplaneerimise konsultandid. Arvamust avaldavad Peep Aaviksoo, Lutz Schleich, Giorgio Risicaris ja Stefan Boltz
Vene kriis kukutas Norma juhid / Raul Ranne
Ranne, Raul
1998-01-01
AS Norma vallandas ettevõtte tegevjuhi Peep Aaviksoo, sest ei olnud rahul ettevõtte tegevusega Venemaal. Tabelid: Norma aktsia on kukkunud, Norma kuukasum miinuses. Ilmunud ka: Delovõje Vedomosti, 9. sept. 1998, lk. 10
The performance of Dräger Oxylog ventilators at simulated altitude.
Flynn, J G; Singh, B
2008-07-01
Ventilated patients frequently require transport by air in a hypobaric environment. Previous studies have demonstrated significant changes in the performance of ventilators with changes in cabin pressure (altitude) but no studies have been published on the function of modem ventilators at altitude. This experiment set out to evaluate ventilatory parameters (tidal volume and respiratory rate) of three commonly used transport ventilators (the Dräger Oxylog 1000, 2000 and 3000) in a simulated hypobaric environment. Ventilators were assessed using either air-mix (60% oxygen) or 100% oxygen and tested against models simulating a normal lung, a low compliance (Acute Respiratory Distress Syndrome) lung and a high-resistance (asthma) lung. Ventilators were tested at a range of simulated altitudes between sea level and 3048 m. Over this range, tidal volume delivered by the Oxylog 1000 increased by 68% and respiratory rate decreased by 28%. Tidal volume delivered by the Oxylog 2000 ventilator increased by 29% over the same range of altitudes but there was no significant change in respiratory rate. Tidal volume and respiratory rate remained constant with the Oxylog 3000 over the same range of altitudes. Changes were consistent with each ventilator regardless of oxygen content or lung model. It is important that clinicians involved in critical care transport in a hypobaric environment are aware that individual ventilators perform differently at altitude and that they are aware of the characteristics of the particular ventilator that they are using.
Eestikeelne doktoriõpe ähvardab kaduda / Eva Kübar
Kübar, Eva
2005-01-01
Eestikeelse doktoriõppe võimalikku kadumist kommenteerivad Tallinna Tehnikaülikooli õppeprorektor Jakob Kübarsepp, Tartu Ülikooli rektor Jaak Aaviksoo, Eesti Põllumajandusülikooli õppeprorektor Hardi Tullus ja Tallinna Ülikooli rektor Mati Heidmets
Vabadussõja võidusammas valmib Tšehhi klaasitehases / Dannar Leitmaa, Urmas Jaagant
Leitmaa, Dannar, 1982-
2008-01-01
Eesti kaitseminister Jaak Aaviksoo ja Tšehhi klaasivabriku Sans Souci esindaja Martin Chab allkirjastasid lepingu, mille kohaselt tšehhid projekteerivad, valmistavad ja püstitavad 15. oktoobriks Tallinna Vabaduse väljakule võidusamba
Igavene eksport : [luuletused] / Kauksi Ülle
Kauksi Ülle, pseud., 1962-
2005-01-01
Sisu: Igavene eksport / võru keelest eesti keelde tõlkinud Aare Pilv ; "Sinno uika ma..." ; "Piaq vasta..." / võru keelest udmurdi keelde tõlkinud Irina Orehhova, Svetlana Ljubimova ; Paat ; Jummalhoitku / võru keelest udmurdi keelde tõlkinud Irina Orehhova, Pjotr Zahharov ; Säitsme vele sõsar / udmurdi keelde tõlkinud Pjotr Zahharov
Rector's office as of 31 December 2005
2006-01-01
TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
2006-01-01
TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
Sügisõhtu : [luuletused] / Kersti Merilaas
Merilaas, Kersti, pseud., 1913-1986
1998-01-01
Sisu: Sügisõhtu ; Hulguse laul ; Öö ; Mina magan ; Suletud luugid ; Viimne paat ; Usalda oma silmi ; Punane moon ; Rannapääsuke ; Mägiste Märt ; Võõrdumus ; "Minna midagi nõudmata..." ; Lihtne lauluke ; Kohtupäev ; Diogenes ; Kui põletasin need kirjad ; Laul ; Need vanad astjad ; Hobune ; Käolina ; Usutunnistus ; Nägemus
Taas teadmusühiskonna infopoliitikast / Silvi Metsar
Metsar, Silvi
2004-01-01
RRis toimunud II infopoliitika foorumil "Riiklik infopoliitika - müüt või tegelikkus" arutleti, kas Eestis on infoühiskond, milline on riiklik infopoliitika jne. Teiste seas osalesid Anu Toots, Tiiu Valm, Peeter Tulviste, Jaak Aaviksoo, Raul Malmstein
2006-01-01
TÜ teadustöötajaist ja õppejõududest on 2/3 doktorikraadiga. TÜ rektor Jaak Aaviksoo ja teadusprprektor Ain Heinaru valiti Euroopa kõrghariduspoliitika juhtorganitesse. Sotsiaalteaduskonna prof. Wolfgang Drechsler sai Saksa-Eesti akadeemiliste suhete arendamise eest Saksamaa Liitvabariigi Teeneteristi
Kirss, Tiina, 1957-
2005-01-01
aktusega Tartu Collegéis 27. novembril 2005. Ülikooli rektor Jaak Aaviksoo analüüsis oma kõnes TÜ arenguvõimalusi ja päevamuresid, Tiina Kirss esitas sissevaate ülikooli ajalukku, muusikalises osas esinesid Kaili ja Riho Maimets
USA moos määrib Eesti naabritest mõjukamaks / Raimo Poom
Poom, Raimo
2007-01-01
Sel sügisel on toimunud mitu Eesti ja USA poliitikute kohtumist. Peaminister Andrus Ansipi ja kaitseminister Jaak Aaviksoo USA-visiitide korraldamisega kursis olevad ametnikud ei nõustu, et kohtumiste taga oleks olnud USA lobitöö Iraagi missiooni pikendamiseks
Klaasist võidusammas tuleb kõigi kirgede kiuste
2008-01-01
Tallinna Harjumäele kavandatava Vabadussõja võidusamba projekteerib, valmistab ja püstitab Tšehhi klaasifirma Sans Souci oktoobri keskpaigaks. Monument on plaanis avada 28. novembril 2008. Kommenteerib Jaak Aaviksoo. Vaata ka juhtkirja "Ässitajad arhitektid" lk. 2
Eesti rahvusliku tahte triumf? / Tarmo Jüristo
Jüristo, Tarmo
2010-01-01
Autor analüüsib kaitseminister Jaak Aaviksoo Tartu rahu aastapäevale pühendatud kõnet, milles kaitseminister viitas tahtmatult 1934. aasta propagandafilmile "Tahte triumf" ("Triumph des Willens"), mis kujutas Adolf Hitleri saabumist natsionaalsotsialistliku partei Nürnbergi konverentsile
Esimene vanemaealiste uuring Eestis / Merle Paats, Jaana Rahno
Paats, Merle
2010-01-01
Novembris algavast SHARE uuringust (Survey of Health, Ageing and Retirement in Europe), mida korraldatakse 19 Euroopa riigis ning mille sihtrühm on vanemaealised ehk 50-aastased ja vanemad inimesed. Eestis korraldab uuringut statistikaamet koostöös sotsiaalministeeriumi, Tallinna Ülikooli ja Tervise Arengu Instituudiga
İktidarın İzlediği Siyasetin Kamuflaj Örtüsü: Medya ve Gerçekliğin Yeniden Üretimi
Directory of Open Access Journals (Sweden)
Barış Yetkin
2016-10-01
Full Text Available Çeşitli nedenlerden dolayı kimi zaman, siyaset ve haber retoriğinin birbiriyle örtüştüğü ya da benzeştiği görülür. Siyasal iktidar ve medya ortak çıkarlar etrafında, çerçevemle, metaforlaştırma, örtmece benzeri söylem stratejileri uygularlar. Kasıtlı ya da kasıtsız olarak devreye sokulan tüm bu stratejiler, bireylerin hesaplama sistemini sekteye uğratma ve bilinçlerinin manipüle edilmesi işlevine sahiptir. Tüm bunlar, nihai olarak, ideolojik amaçlarına ulaşmak isteyen iktidar sahiplerinin ya da iktidara aday olanların siyasal kamuflaj uygulamalarını desteklerler.Bu kapsam içinde yer alan çalışmada, Bu kapsam içinde yer alan çalışmada, iktidar-medya ilişkileri tarafından gerçekliğin imal edilmesi ve bu sahte gerçekliklerde ideolojinin söylemi kullanarak gizlenebildiği incelenmektedir. Siyasal iletişimin bütününü temsil eden üretilen metinlerde örtmecelerin kullanımı ve kamuflajın uygulanışını betimsel olarak belirlemeye çalışılmıştır.
USA kaitseminister Robert Gates süüdistas liitlasvägesid oskamatuses / Evelyn Kaldoja
Kaldoja, Evelyn, 1980-
2008-01-01
USA kaitseminister Robert Gates väitis ajalehes The Los Angeles Times avaldatud intervjuus, et Lõuna-Afganistani olukord on halvenenud seal võitlevate USA liitlasvägede puuduliku väljaõppe tõttu. Liitlasriikide reageeringuid. Arvamust avaldavad Jaak Aaviksoo, Kaarel Kaas
Øger et anhængertræk risikoen for piskesmæld i bagendekollisioner?
DEFF Research Database (Denmark)
Olesen, Anne Vingaard; Lahrmann, Harry Spaabæk
passagerer. En bagendekollision er imidlertid også i nyere biler forbundet med en vis risiko for piskesmæld. Litteraturen estimerer en risiko på mindst 15% for at få mén efter en bagendekollision (Sterner, 2004). Hypotesen i dette studie er, at et anhængertræk påmonteret den påkørte bil vil interagere...... negativt med kollisionszonen og medføre, at bagagerummet helt eller delvist ikke krøller sammen. Effekten af trækkrogen ville derfor blive en øget risiko for piskesmæld ud over, hvad der allerede er kendt ved bagendekollisioner. Et svensk studie nævner en forøget risiko på 22% (Krafft et al., 2000). Ud...... for en køns- og aldersmatchet kontrolbefolkning. Vi fandt umiddelbart ikke evidens for, at piskesmældsofre er dårligere socialt stillet end andre. Diskussion Dette studie viser, at et anhængertræk på påkørte bil i en bagendekollision ikke øger risikoen for piskesmæld – heller ikke efter korrektion...
Directory of Open Access Journals (Sweden)
Regina Célia Ermel
2003-06-01
Full Text Available O objetivo deste artigo é identificar como o trabalho de gerência tem sido abordado nas publicações científicas. Tomou-se como objeto a produção bibliográfica sobre gerência produzida entre 1989 a 1999. A coleta de dados envolveu a busca nas bases de dados Medline e Lilacs. Os trabalhos encontrados foram analisados segundo a técnica de Análise de Conteúdo, proposta por Bardin. Os resultados mostraram que 38% das publicações abordavam a dimensão organizacional da gerência; 34% abordavam a dimensão técnica; 9% a dimensão política e 19% articulavam duas ou mais dessas dimensões. A análise da literatura nos indica a necessidade de desenvolver produções científicas que discutam a gerência como um trabalho político, técnico e organizacional.El objetivo de este articulo é identificar cómo el trabajo de gerencia ha sido estudiado en las publicaciones científicas. El objecto de análisis fue la producción bibliografica acerca de la gerencia entre los años de 1989 a 1999. La búsqueda fue hecha en las bases de datos Medline e Lilacs. Ls trabajos encuentrados fueron analisados segun la técnica de Analisis de Contenido, propuesta por Bardin. Los resultados mostraram que 38% das publicaciones abordaban la dimensión organizacional de la gerencia; 34% abordaban la dimensión técnica; 9% abordaban la dimensión política e 19% articulaban dos o más de estas dimensiones. El análisis de la literatura indicó la necesidad de desarrollarse producciones científicas que discutan la gerencia como un trabajo político-técnico y organizacional.The objective of this paper is to identify how the management work has been studied in scientific publications. The bibliography of management produced in 1989 to 1999 was analyzed. The date was collected in Medline and Lilacs data bases. The scientific publications founded, were analysed second the technique of Contents' Analysis, proposal by Bardin. The results showed that 38% described
Tagurpidi pööratud poliitika / Ivar Tallo
Tallo, Ivar, 1964-
2009-01-01
Autor näeb vastuolu seoses vaidlusega kaitseväelaste õiguse üle määrata enda hukkumishüvitise saaja: konservatiivse IRL-i minister Jaak Aaviksoo kaitseb sõdurite valikuvabadust ning liberaalist Reformierakonna minister Jürgen Ligi tahaks sõdurite eest otsustada
Ilves lennutati käepigistuseks hiiglaslikule sõjalaevale / Rasmus Kagge
Kagge, Rasmus, 1977-
2007-01-01
President Toomas Hendrik Ilves, Riigikogu esimees Ene Ergma, kaitseväe juht Ants Laaneots, kaitseminister Jaak Aaviksoo ja mitu parlamendiliiget külastasid Vahemeres seilavat maailma esimest tuumajõu abil liikuvat lennukikandjat USS Enterprise. Vabariigi Presidendi visiit Ameerika Ühendriikide sõjalaevastiku lennukikandjale USS Enterprise
Riigijuhtide riskialdis õhulend / Oliver Rand
Rand, Oliver, 1971-
2007-01-01
President Toomas Hendrik Ilves, Riigikogu esimees Ene Ergma, kaitseminister Jaak Aaviksoo, kaitseväe juhataja Ants Laaneots, Riigikogu riigikaitsekomisjoni esimees Mati Raidma koos kaaskonnaga lendasid USA lennukikandjale USS Enterprise ühes lennukis. Riigi võtmeisikute üheskoos reisimisega kaasnevatest turvariskidest. Vt. samas: Mujal karmimad meetmed
Jaagant, Urmas
2009-01-01
Tšehhi firma Sans Souci ei suutnud Vabadussõja võidusamba ristiosa valgustust rahuldaval määral tööle saada. Uue valguslahenduse leidmiseks on kaitseminister Jaak Aaviksoo palunud algatada riigihanke. Vabadussamba autori Rainer Sternfeldi arvamus tšehhide kehva töö kohta
Directory of Open Access Journals (Sweden)
Hilal Aktamış
2012-11-01
Full Text Available Bu araştırmada üç boyutlu görsel tasarımları içeren sanal gerçeklik programlarının, ilköğretim 7. sınıf öğrencilerinin fen ve teknoloji dersi astronomi konusundaki başarılarına ve kalıcılıklarına etkisini araştırmak amaçlanmıştır. Bu kapsamda ilköğretim 7. sınıf öğrencilerinin zihinlerinde astronomi konularını daha iyi yapılandırabilmesi için sanal gerçeklik programlarına uygun etkinlik yaprakları geliştirilmiş ve Aydın ilinde sosyoekonomik bakımdan alt düzeydeki bir İlköğretim okulunda yer alan yedinci sınıf öğrencilerine uygulanmıştır. Araştırmanın çalışma grubunu deney grubunda 30, kontrol grubunda 30 öğrenci olmak üzere toplam 60 öğrenci oluşturmaktadır. Araştırmada kullanılan 20 maddelik Astronomi Başarı Testi'nin cronbach alfa güvenirlik katsayısı .76 olarak hesaplanmış ve çalışma grubundaki öğrencilere uygulama öncesi ön test, uygulama sonrası son test ve uygulamadan üç ay sonra kalıcılık testi olarak uygulanmıştır. Uygulama sonucuna göre sanal gerçeklik programları kullanılarak yapılan öğretim sonucunda deney grubunun akademik başarısının kontrol grubuna göre daha fazla arttığı görülmüştür. Sanal gerçeklik programları kullanılarak yapılan öğretimin öğrencilerin akademik başarılarını arttırmada daha etkili olduğu ortaya çıkmıştır.
Külmetav haigekassa / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2008-01-01
Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi. Graafik: Haigekassa kulude suhteline muutus
Zamerzajushtshaja Bolnitshnaja kassa / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2008-01-01
Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi
Aaviksoo võistleb Donald Trumpiga
2007-01-01
Peep Aaviksoole ja tema äripartneritele kuuluv IPC Investment tegeleb Rumeenias lisaks kinnisvarainvesteeringutele ka ehitusmaterjalide tootmisega. USA kinnisvaramagnaat Donald Trump on otsustanud riiki investeerida miljard eurot
Directory of Open Access Journals (Sweden)
Gamze ÜLKER TÜMLÜ
2014-09-01
Full Text Available Toplumu etkileyen ve toplumdan etkilenen sinema, sosyal yaşamın gerçekliğini farklı açılardan ele alırken farklı disiplinler içerisinde yeniden hayat bulmaktadır. Bu disiplinlerden biri olan psikoloji alanında sinema yapıtları terapötik bir öğe olarak kullanılabilmektedir. Nitekim, bu çalışmada toplumu etkileyip, aynı zamanda toplumdan etkilendiği düşünülen sinema yapıtlarından “Issız Adam” filminin, terapötik bir öğe olarak Gerçeklik terapisi kavramlarıyla ilişkilendirilerek farklı bir bakış açısı ile sunulması amaçlanmıştır. Bu amaçla, filmin esas kahramanlarından Alper ve Ada’nın temel ihtiyaçları olan sevgi ve ait olma, özgürlük, eğlence, güç ve hayatta kalma ihtiyaçlarını doyurma yollarında aldıkları sorumluluk dâhilindeki seçimleri ele alınmıştır. Ayrıca bu seçimlerin onların kalite dünyalarında nasıl anlam bulduğu ve onları pişmanlık yaratan ya da doyum sağlayan bir yaşama nasıl götürdüğü Gerçeklik terapisi açısından ortaya konulmuştur. Sonuç olarak, bu çalışmanın, Gerçeklik terapisi ile ilgili kuramsal bilgiyi destekleyip bu yaklaşımın kavramlarının öğretimine örnek oluşturarak, psikolojik danışman eğitiminde kullanılmak üzere akademisyenlere ve öğrencilere kaynak oluşturacağı düşünülmektedir. / Cinema both affects society and is affected by society. The cinema exploring reality of social life in different points of view appears in different discipline. Cinema is used as a therapeutic component in the discipline of psychology, too. The aim of this study is to introduce the ‘Issız Adam’ movie in terms of the Reality Therapy. Thus, the selections of Alper and Ada, who are the actor and actress of the film, were analyzed with reference to how they fulfill the need of love and belonging, survivor, power, freedom, fun. Similarly, it was shown that how Alper and Ada’s selections make sense in their quality
Directory of Open Access Journals (Sweden)
Pedro Manuel O. J. Neves
2006-06-01
Full Text Available Multiple-choice laboratory tests were achieved to compare feeding preference of Diabrotica speciosa (Ger. to leaves of broccoli (Brassica oleraceae L. var. italica from natural, conventional and organic farming systems. Natural farming systems included incorporation of the elephant grass Pennisetum purpureum Schumacher cv. Napier (50 ton/ha, Bokashi compost (1.5 ton/ha and spray of EM 4 (Natural 1, or the incorporation of the Bokashi compost (1.5 ton /ha and spray of EM 4 (Natural 2, and in the conventional, NPK + borax were incorporated in the planting + dressing N and organic compost (1 kg/ plant was incorporated in the organic system. Organic compost was prepared using crop residues of corn (Zea mays L., soybean [Glycine max (L. Mer.], and cattle manure. Leaf discs were collected and placed in cages in multiple-choice tests. Beetles preferred mostly broccoli leaves from conventional farming system than leaves from Natural (1 and 2 and Organic farming systems. Feeding on leaves from Natural 1, Natural 2 and Organic farming system were 68, 67 and 57% of the feeding on leaves from Conventional farming system.Testes de múltipla escola foram realizados para comparar a preferência alimentar de Diabrotica speciosa (Ger. por folhas de brócolos (Brassica oleraceae L. var. italica cultivado em sistema natural, convencional e orgânico. No sistema natural de cultivo houve a incorporação de capim elefante Pennisetum purpureum Schumacher cv. Napier (50 ton/ha, composto Bokashi (1,5 ton/ha e pulverização de EM 4 (Natural 1, ou a incorporação do composto Bokashi (1,5 ton/ha e pulverização do EM 4 (Natural 2, no sistema convencional houve a incorporação do NPK + borax + N em cobertura, e no sistema orgânico incorporouse composto orgânico (1 kg/planta. O composto orgânico foi preparado utilizando-se resíduos de milho (Zea mays L. e soja [Glycine max (L. Mer.] e esterco de gado. Folhas foram retiradas das plantas das quais foram separados
Gerência participativa: uma proposta para mudança de ambiente no serviço de enfermagem
Directory of Open Access Journals (Sweden)
Lourdes Emília Ruviaro Novakoski
1992-09-01
Full Text Available O presente estudo envolve um conjunto de reflexões sobre a cultura e sua repercussão no modelo organizacional e no estilo de gerência. Aplicando-se dois instrumentos de coleta de informações: um questionário para exame da cultura e um roteiro de entrevista, foram obtidos dados complementares quanto à situação interna e organização do Serviço de Enfermagem. Os resultados evidenciaram que a situação real é entremeada por um clima diretivo e neutro, com centralização do poder e pouca participação dos subordinados no processo decisório; enquanto que a situação desejada corresponde a um ambiente com espírito de equipe, certa flexibilidade e mobilidade e, transparência nos canais de comunicação. A partir do diagnóstico, buscou-se uma estratégia de ação que possibilitasse renovação da cultura e desenvolvimento da capacidade gerencial numa organização flexível e descentralizada.
Estonian living in safest of times / Ella Karapetyan
Karapetyan, Ella
2010-01-01
Peaminister Andrus Ansip ütles kevadisi riigikaitsekursuseid avades, et tema hinnangul elab Eesti julgeoleku seisukohalt oma ajaloo ilmselt kõige turvalisemat etappi, olles NATO ja Euroopa Liidu liige. Kursuste avamistseremooniast võtsid osa ka kaitseminister Jaak Aaviksoo, välisminister Urmas Paet, siseminister Marko Pomerants ja kaitseväe juhataja kindralleitnant Ants Laaneots
Varjamine: samba salalepingud tõid tšehhidele lisamiljoneid / Raimo Poom
Poom, Raimo
2010-01-01
Kaitseminister Jaak Aaviksoo ja Tšehhi klaasifirma sõlmisid 2009. a. lepingu muutmise lepingu koos paljude uute lisadega. Lepingu lisas nõudis kaitseminister kollase tooniga risti ringiosa paneelide väljavahetamist, kuid tookord teatas ministeerium, et paneelid vastavad esialgsel hinnangul kokkulepitule. Ministeeriumi avalike suhete osakonna juhataja Martin Jaško ja vandeadvokaat Martin Tamme selgitusi
Elamusi ujuvast linnast / Krister Kivi
Kivi, Krister, 1975-
2007-01-01
Reportaaž Eesti presidendi Toomas Hendrik Ilvese külaskäigust maailma pikimale ja maailma esimesele tuumajõul töötavale lennukikandjale USS Enterprise. Delegatsiooni kuulusid veel Riigikogu esimees Ene Ergma, kaitseväe juht Ants Laaneots, kaitseminister Jaak Aaviksoo, Riigikogu liikmed Sven Mikser ja Mati Raidma ning USA suursaadik Eestis Stanley Davis Phillips
1989-12-01
34-% -o2F -152F -15.2f -15,2F -15.2F" x )’ deprh_under _sub sub _depth acourse) (rerpri) ( serq smzar_ conracrs ( /isr ( lisr (ger_dara) (ger_dara...isr ( ger _dar a) ( ger _ dara)) ( lisr (ger_dara) (ger_dara)) ( lisr (ger_dara) (ger_dara)) (/isr (ger_dara) (ger_dara)) ( lisr (ger_dara...ger_dara)) ( lisr ( ger _dar a) ( ger _ dara)) ( lisr (ger_dara) (ger_dara)) ( lisr (ger_dara) (ger_dara)))) (princ sonar _conracrs) (princ "Conracr
RELIGIOUS QUESTION AND SECULAR STATE: CRISIS OF REGULATION BY DANI LE HERVIEU-L GER
Directory of Open Access Journals (Sweden)
S. V. Trophimov
2017-01-01
Full Text Available The proposed paper outlines concepts of the Religious individualism in modern Western society analyzed by the French sociologist Danièle Hervieu-Léger in “Religion in movement (1999”. Author proposes an assessment of the religious situation in the French society at the end of the XX century and discuss some examples. Particular attention is given to crisis of secular regulation of the religious in the modern society. The weakening of the regulatory capacity of religious institutions leads to a weakening of the secular state. Religious institutions should be able to implement the regime of the truth of faith, which makes the institutional power of the superior guarantor of common faith principles shared by all believers of the denomination. The system of “copying” the structures of the Catholic Church of the XVIII century adopted by the secular state, today is not more correspond nor religious organizations in general, neither even the modern structures of the organization of the Catholic Church in France, that become a problem for a state-confessional relation. Modern institutional disorganization in the religious field, contributing to the destabilization of the French model of secularism, weakened by political cultural and economic liberalization that undermine its principles values that historically based secular system itself. Institutional crisis of the truths of faith approval favours an increase in the number of belief systems of individual communities. The problem can not be solved a priori, legally separating the traditional, “recognized by law” and other religions. The changing religious situation the state must find a new model of interaction with religious groups and organizations. The material is useful for comparative studies of the religious situation in Russia and Western Europe.
AYTULUN, Gözde
2015-01-01
Bu çalışmanın temel amacı, ergenlik dönemindeki seyircilerin dizikarakterleriyle geliştirdikleri parasosyal etkileşim ile internette gerçek benlik,kendilik algısı ve sosyal kaygı arasındaki ilişkiyi incelemektir. Bu çalışmada,cinsiyet ve yaşlarına göre sınıflandırılan bireyler, parasosyal etkileşim, internettegerçek benlik, kendilik algısı ve sosyal kaygı değişkenlerinden aldıkları puanlaraçısından da karşılaştırılmışlardır. Son olarak da, parasosyal etkileşimle ilişkili olanve paras...
Energy Technology Data Exchange (ETDEWEB)
Croezen, H.; Bijleveld, M. [CE Delft, Delft (Netherlands); Mulder, M. [Mrabella Mulder Waste Water Management, Utrecht (Netherlands)
2012-09-15
Phosphorus recovery from wastewater is a topical issue and a process being applied increasingly in the Netherlands. As part of NL Agency's energy efficiency programme CE Delft has calculated the energy benefits of two alternative recovery options compared with conventional production routes. The Gross Energy Requirement (GER) was calculated for the following routes: struvite recovery from rejection water versus conventional fertilizer production and phosphorus recovery from sludge incineration ash at Thermphos versus phosphorus production from phosphate ore at Thermphos. Compared with the conventional routes, the two recovery routes yield energy gains. The project was carried out in cooperation with Mirabella Mulder Wastewater Management, with support from Thermphos [Dutch] Fosforterugwinning uit afvalwater is een onderwerp dat in de belangstelling staat en meer en meer in Nederland wordt toegepast. In het kader van het energie-efficiëntieprogramma van Agentschap NL heeft CE Delft berekend wat de energetische winst is van twee terugwinroutes ten opzichte van de huidige gangbare productieroutes. De Gross Energy Requirement is berekend voor de volgende routes: struvietwinning uit rejectiewater versus reguliere kunstmestproductie en winning van fosfor uit zuiveringsslibas bij Thermphos versus productie van fosfor uit fosfaaterts bij Thermphos. Vergeleken met de reguliere routes leveren beide terugwinroutes energiewinst op. Het project werd uitgevoerd in samenwerking met Mirabella Mulder Wastewater Management en met inbreng van Thermphos.
Ghanem, Bader
2016-04-30
Two novel Tröger\\'s base-based di-o-substituted diamine monomers were synthesized and used to prepare two intrinsically microporous 6FDA-based polyimides (PIM-PI-TB-1 and PIM-PI-TB-2) with high molecular weight, high thermal stability and excellent solubility in common organic solvents. Compared to previously reported methods for preparing TB-based diamines, which are based on reduction of dimerized nitro-substituted anilines or condensation of phenylenediamine derivatives with dianhydrides, the novel protocol can be used to prepare different functionalized TB-based diamine monomers from a wide variety of aniline derivatives. PIM-PI-TB-1 (made from 6FDA and dibromo-tetramethyl-substituted TB diamine) and PIM-PI-TB-2 (made from 6FDA and tetramethyl-substituted TB diamine) are intrinsically microporous polymers with high BET surface areas of 440 m2/g and 580 m2/g, respectively. Pure-gas permeability coefficients of He, H2, N2, O2, CH4, and CO2 were measured at 35 °C and 2 bar for fresh and 180 days aged films. Both TB-based polyimides exhibited high gas permeability with moderate selectivity. The gas permeability dropped significantly coupled with a moderate increase in selectivity after long-term physical aging of 180 days.
Ghanem, Bader; Alaslai, Nasser Y.; Miao, Xiaohe; Pinnau, Ingo
2016-01-01
Two novel Tröger's base-based di-o-substituted diamine monomers were synthesized and used to prepare two intrinsically microporous 6FDA-based polyimides (PIM-PI-TB-1 and PIM-PI-TB-2) with high molecular weight, high thermal stability and excellent solubility in common organic solvents. Compared to previously reported methods for preparing TB-based diamines, which are based on reduction of dimerized nitro-substituted anilines or condensation of phenylenediamine derivatives with dianhydrides, the novel protocol can be used to prepare different functionalized TB-based diamine monomers from a wide variety of aniline derivatives. PIM-PI-TB-1 (made from 6FDA and dibromo-tetramethyl-substituted TB diamine) and PIM-PI-TB-2 (made from 6FDA and tetramethyl-substituted TB diamine) are intrinsically microporous polymers with high BET surface areas of 440 m2/g and 580 m2/g, respectively. Pure-gas permeability coefficients of He, H2, N2, O2, CH4, and CO2 were measured at 35 °C and 2 bar for fresh and 180 days aged films. Both TB-based polyimides exhibited high gas permeability with moderate selectivity. The gas permeability dropped significantly coupled with a moderate increase in selectivity after long-term physical aging of 180 days.
NATO "röövib" Eestilt kogu jõueliidi / Tuuli Koch
Koch, Tuuli
2008-01-01
Bukarestis toimuvatel NATO tippkohtumisega seotud üritustel esindavad Eestit president Toomas Hendrik Ilves, peaminister Andrus Ansip, välisminister Urmas Paet, kaitseminister Jaak Aaviksoo ja kaitseväe juhataja kindralmajor Ants Laaneots. Poliitikute päevakavast. President T. H. Ilves esineb NATO temaatikaga tegelevate noorteorganisatsioonide esindajate konverentsil ning mõttekoja German Marshall Fund korraldataval konverentsil "The Bucharest Conference". Vabariigi President töövisiidil Bukarestis 1.-3.04.2008
Kültürel Miras için Zenginleştirilmiş Gerçeklik Uygulamaları
Directory of Open Access Journals (Sweden)
Erkan Bostancı
2011-03-01
Full Text Available Bu makale bilgisayar grafiği alanının iki ilgi çekici konusu üzerinde yapılan güncel çalışmaların bir incelemesini sunmaktadır. Geniş çalışma alanları olan Zenginleştirilmiş Gerçeklik ve İzleme alanlarında yapılan yeni çalışmalar incelenirken, özellikle de makalede bahsedilen sebeplerden dolayı kültürel miras üzerine yapılan çalışmalar vurgulanmıştır. Belirtilen uygulama türü için birçok kaynağa sahip olan ülkemizde yeni bir çalışma alanı başlamasına yardımcı olmak amacıyla bu iki çalışma alanından birçok yöntem ve örnek uygulama yüzeysel fakat açık bir dille anlatılmıştır. Bu uygulamalarda genel olarak karşılaşılan sorunlar ortaya konulup, olası çözüm önerileri sunulmuştur. Ülkemizde yapılan ilgili çalışmalardan da örnekler verildikten sonra geliştirilen örnek "Masaüstü Tarih" çalışmasıyla da anlatım pekiştirilerek somut bir örnek ortaya konmuştur.
Aday Díaz, Osmany; Barroso Medina, Francisco J; Díaz Mujica, Félix; Martín Tríada, Esther Lilia; Pérez Vicente, Luis; Alfonso Terry, Isabel; Pérez Milián, José; Barroso Melillo, Javier
2010-01-01
Se identificaron síntomas de roya naranja (Puccinia kuehnii (Krüger) Butler) en áreas experimentales de la Estación Territorial de Investigaciones de la Caña de Azúcar de Villa Clara, región central de Cuba, y se confirmó su presencia mediante diagnóstico del Laboratorio Central de Cuarentena Vegetal. Se examinaron 562 variedades, de ellas 31 comerciales, 424 progenitores, seis patrones de resistencia a roya marrón y otras en estudios de selección. La infección por P. kuehnii se detectó en 58...
Terve mõistusega ahnuse vastu / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2005-01-01
Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele
de Oliveira, Sergius A R; Lucio, Lorena M C; Modolo, Norma S P; Hayashi, Yoko; Braz, Mariana G; de Carvalho, Lídia R; Braz, Leandro G; Braz, José Reinaldo C
2017-01-01
During anesthesia, as compared with intensive care, the time of the tracheal intubation is much shorter. An inhaled gas minimum humidity of 20 mgH2O.L-1 is recommended to reduce the deleterious effects of dry gas on the airways during anesthesia with tracheal intubation. The Fabius GS Premium® anesthesia workstation (Dräger Medical, Lübeck, Germany) has a built-in hotplate to heat gases in the breathing circuit. A heat and moisture exchanger (HME) is used to further heat and humidify the inhaled gas. The humidity of the gases in the breathing circuit is influenced by the ambient temperature. We compared the humidity of the inhaled gases from a low-flow Fabius anesthesia workstation with or without thermal insulation (TI) of the breathing circuit and with or without an HME. We conducted a prospective randomized trial in 41 adult female patients who underwent elective abdominal surgery. The patients were allocated into four groups according to the devices used to ventilate their lungs using a Dräger Fabius anesthesia workstation with a low gas flow (1 L.min-1): control, with TI, with an HME or with TI and an HME (TIHME). The mean temperature and humidity of the inhaled gases were measured during 2-h after connecting the patients to the breathing circuit. The mean inhaled gas temperature and absolute humidity were higher in the HME (29.2±1.3°C; 28.1±2.3 mgH2O·L-1) and TIHME (30.1±1.2°C; 29.4±2.0 mgH2O·L-1) groups compared with the control (27.5±1.0°C; 25.0±1.8 mgH2O·L-1) and TI (27.2±1.1°C; 24.9±1.8 mgH2O·L-1) groups (P = 0.003 and Phumidity level of inhaled gases to avoid damage to the tracheobronchial epithelia during anesthesia. TI of the breathing circuit does not increase the humidity of the inhaled gases, whereas inserting an HME increases the moisture of the inhaled gases closer to physiological values.
Diversity of the Germination Apparatus in Clostridium botulinum Groups I, II, III and IV
Directory of Open Access Journals (Sweden)
Jason Brunt
2016-10-01
Full Text Available Clostridium botulinum is a highly dangerous pathogen that forms very resistant endospores that are ubiquitous in the environment, and which, under favourable conditions germinate to produce vegetative cells that multiply and form the exceptionally potent botulinum neurotoxin. To improve the control of botulinum neurotoxin-forming clostridia, it is important to understand the mechanisms involved in spore germination. Here we present models for spore germination in C. botulinum based on comparative genomics analyses, with C. botulinum Groups I and III sharing similar pathways, which differ from those proposed for C. botulinum Groups II and IV. All spores germinate in response to amino acids interacting with a germinant receptor, with four types of germinant receptor identified (encoded by various combinations of gerA, gerB and gerC genes (gerX. There are three gene clusters with an ABC-like configuration; ABC gerX1, ABABCB gerX2 and ACxBBB gerX4, and a single CA-B gerX3 gene cluster. Subtypes have been identified for most germinant receptors types, and the individual GerX subunits of each cluster show similar grouping in phylogenetic trees. C. botulinum Group I contained the largest variety of gerX subtypes, with three gerX1, three gerX2 and one gerX3 subtypes, while C. botulinum Group III contained two gerX1 types and one gerX4. C. botulinum Groups II and IV contained a single germinant receptor, gerX3 and gerX1, respectively. It is likely that all four C. botulinum Groups include a SpoVA channel involved in DPA release. The cortex lytic enzymes present in C. botulinum Groups I and III appear to be CwlJ and SleB, while in C. botulinum Groups II and IV, SleC appears to be important.
Directory of Open Access Journals (Sweden)
José Luís Guedes dos Santos
2013-04-01
Full Text Available Estudo com objetivo de evidenciar e analisar as práticas dos enfermeiros na gerência do cuidado descritas na produção científica brasileira e internacional, por meio de uma revisão integrativa. Foram pesquisados artigos publicados entre 2005 e 2010, nas bases LILACS, SciELO, BDENF e CINAHL, a partir dos descritores Gerência e Administração, associados a Cuidado e Enfermagem, e os termos Nursing Management e Nursing Care, totalizando 27 publicações. A gerência do cuidado realizada pelo enfermeiro relaciona-se diretamente à busca pela qualidade assistencial e de melhores condições de trabalho, por meio de ações como: realização do cuidado, gerência de recursos humanos e materiais, liderança, planejamento da assistência, capacitação da equipe de enfermagem, coordenação da produção do cuidado e avaliação das ações de enfermagem.Este estudio tuvo como objetivo evidenciar y analizar las prácticas de los enfermeros en la gerencia del cuidado descrita en la producción científica en Brasil e internacionalmente, a través de una revisión integradora. Fueron examinados artículos publicados entre 2005 y 2010, en las bases de datos LILACS, SciELO, BDENF y CINAHL, con los descriptores Gerencia and Administración, asociados con Cuidado y Enfermería, y los términos Nursing Management y Nursing Care, totalizando 27 publicaciones. La gerencia del cuidado realizada por el enfermero está directamente relacionada con la búsqueda de calidad de la atención y mejores condiciones de trabajo, a través de acciones tales como: la realización de la asistencia, la gestión de los recursos humanos y materiales, el liderazgo, la planificación de la asistencia, la capacitación del equipo de enfermería, coordinación de la producción del cuidado y evaluación de las acciones de enfermería.This study aimed to highlight and analyze the nurses' practices in care management described in the scientific production in Brazil and
Directory of Open Access Journals (Sweden)
Arie F Blank
2012-12-01
Full Text Available O gerânio (Pelargonium graveolens é uma erva aromática e seu óleo essencial é comumente utilizado na constituição de fármacos e cosméticos no mundo. A planta adapta-se bem às condições climáticas do nordeste brasileiro, mas são escassos os dados sobre seu rendimento quantitativo e qualitativo. O objetivo do trabalho foi avaliar a influência de espaçamento de plantas e intervalos de colheita em gerânio na produção de biomassa e de óleo essencial. Foram testados três espaçamentos de plantio (50x50, 50x60 e 50x80 cm e três intervalos de colheita (8, 12 e 16 semanas. Os maiores valores totais de massa fresca e seca de folhas e caules (2679,04 g m-2; 424,62 g m-2; 1035,08 g m-2; 136,85 g m-2, respectivamente e rendimento de óleo essencial (7,56 mL m-2, que são características de interesse direto para o mercado, foram obtidos em intervalo de colheita de oito semanas e no espaçamento de 50x50 cm. Nas demais variáveis analisadas, houve pouca diferenciação entre os tratamentos, contudo, períodos longos de colheita são menos produtivos, pois houve queda nos valores de todas as variáveis nas ultimas colheitas de cada intervalo. Assim, melhores resultados de quantidade e qualidade para o gerânio foram obtidos com intervalo de 8 semanas e no espaçamento 50x50 cm.Geranium (Pelargonium graveolens is an aromatic herb and its essential oil is commonly used in the creation of drugs and cosmetics worldwide. The plant is well adapted to the climatic conditions of the Brazilian northeast, but there are few data on its quantitative and qualitative yield. The aim of this study was to evaluate the influence of plant spacing and harvest intervals of geranium on the production of biomass and essential oil. Three different plant spacings (50x50, 50x60 and 50x80 cm and three harvest intervals (8, 12 and 16 weeks were tested. The highest values of total fresh and dry weight of leaves and stems (2679.04 g m-2; 424.62 g m-2; 1035.08 g m-2
Eesti väärib paremat / Jaak Aaviksoo
Aaviksoo, Jaak, 1954-
2006-01-01
Ilmunud ka: Virumaa Teataja, Põhjarannik, Severnoje Poberezhje, Meie Maa, Vooremaa 3. okt. lk. 11,2,2,2,2, Sakala, Pärnu Postimees, Sõnumitooja 4. okt. lk. 2,15,2, Lõunaleht 5. okt. lk. 2, Kuulutaja, Vali Uudised 6. okt. lk. 6,2, Järva Teataja 7. okt. lk. 2. Autori sõnul on Eestis tajutav usalduskriis, mille põhjuseks on eetiliste piiride kadumine meie poliitilistest otsustest. Ta toob välja kolm arenguprioriteeti riigi edasiseks arenguks
Exacerbations of COPD and symptoms of gastroesophageal reflux: a systematic review and meta-analysis
Directory of Open Access Journals (Sweden)
Thiago Mamoru Sakae
2013-06-01
Full Text Available OBJECTIVE: To examine the relationship between gastroesophageal reflux (GER and COPD exacerbations. METHODS: We conducted a systematic search of various electronic databases for articles published up through December of 2012. Studies considered eligible for inclusion were those dealing with COPD, COPD exacerbations, and GER; comparing at least two groups (COPD vs. controls or GER vs. controls; and describing relative risks (RRs and prevalence ratios-or ORs and their respective 95% CIs (or presenting enough data to allow further calculations for the association between GER and COPD-as well as exacerbation rates. Using a standardized form, we extracted data related to the study design; criteria for GER diagnosis; age, gender, and number of participants; randomization method; severity scores; methods of evaluating GER symptoms; criteria for defining exacerbations; exacerbation rates (hospitalizations, ER visits, unscheduled clinic visits, prednisone use, and antibiotic use; GER symptoms in COPD group vs. controls; mean number of COPD exacerbations (with symptoms vs. without symptoms; annual frequency of exacerbations; GER treatment; and severity of airflow obstruction. RESULTS: Overall, GER was clearly identified as a risk factor for COPD exacerbations (RR = 7.57; 95% CI: 3.84-14.94, with an increased mean number of exacerbations per year (mean difference: 0.79; 95% CI: 0.22-1.36. The prevalence of GER was significantly higher in patients with COPD than in those without (RR = 13.06; 95% CI: 3.64-46.87; p < 0.001. CONCLUSIONS: GER is a risk factor for COPD exacerbations. The role of GER in COPD management should be studied in greater detail.
Identification of a Novel Lipoprotein Regulator of Clostridium difficile Spore Germination.
Directory of Open Access Journals (Sweden)
Kelly A Fimlaid
2015-10-01
Full Text Available Clostridium difficile is a Gram-positive spore-forming pathogen and a leading cause of nosocomial diarrhea. C. difficile infections are transmitted when ingested spores germinate in the gastrointestinal tract and transform into vegetative cells. Germination begins when the germinant receptor CspC detects bile salts in the gut. CspC is a subtilisin-like serine pseudoprotease that activates the related CspB serine protease through an unknown mechanism. Activated CspB cleaves the pro-SleC zymogen, which allows the activated SleC cortex hydrolase to degrade the protective cortex layer. While these regulators are essential for C. difficile spores to outgrow and form toxin-secreting vegetative cells, the mechanisms controlling their function have only been partially characterized. In this study, we identify the lipoprotein GerS as a novel regulator of C. difficile spore germination using targeted mutagenesis. A gerS mutant has a severe germination defect and fails to degrade cortex even though it processes SleC at wildtype levels. Using complementation analyses, we demonstrate that GerS secretion, but not lipidation, is necessary for GerS to activate SleC. Importantly, loss of GerS attenuates the virulence of C. difficile in a hamster model of infection. Since GerS appears to be conserved exclusively in related Peptostreptococcaeace family members, our results contribute to a growing body of work indicating that C. difficile has evolved distinct mechanisms for controlling the exit from dormancy relative to B. subtilis and other spore-forming organisms.
Tamanna, Sadeka; Campbell, Douglas; Warren, Richard; Ullah, Mohammad I
2016-09-15
Nocturnal gastroesophageal reflux (nGER) is common among patients with obstructive sleep apnea (OSA). Previous studies demonstrated that continuous positive airway pressure (CPAP) reduces symptoms of nGER. However, improvement in nGER symptoms based on objective CPAP compliance has not been documented. We have examined the polysomnographic characteristics of patients with nGER and OSA and looked for association of OSA severity and CPAP compliance with improvement in nGER symptoms. We interviewed 85 veterans with OSA to assess their daytime sleepiness (Epworth Sleepiness scale [ESS]) and nGER symptom frequency after their polysomnography and polysomnographic data were reviewed. At 6 months' follow-up, ESS score, nGER score, and CPAP machine compliance data were reassessed. Data from 6 subjects were dropped from final analysis due to their initiation of new medication for nGER symptom since the initial evaluation. Sixty-two of 79 (78%) patients complained of nGER symptoms during initial visit. At baseline, nGER score was correlated with sleep efficiency (r = 0.43), and BMI correlated with the severity of OSA (r = 0.41). ESS and nGER improved (p CPAP compliant patients. A minimum CPAP compliance of 25% was needed to achieve any benefit in nGER improvement. Nocturnal gastroesophageal reflux is common among patients with OSA which increases sleep disruption and worsens the symptoms of daytime sleepiness. CPAP therapy may help improve the symptoms of both nocturnal acid reflux and daytime sleepiness, but adherence to CPAP is crucial to achieve this benefit. © 2016 American Academy of Sleep Medicine.
Gastroesophageal reflux is not associated with dental erosion in children.
Wild, Yvette K; Heyman, Melvin B; Vittinghoff, Eric; Dalal, Deepal H; Wojcicki, Janet M; Clark, Ann L; Rechmann, Beate; Rechmann, Peter
2011-11-01
Dental erosion is a complication of gastroesophageal reflux (GER) in adults; in children, it is not clear if GER has a role in dental pathologic conditions. Dietary intake, oral hygiene, high bacterial load, and decreased salivary flow might contribute independently to GER development or dental erosion, but their potential involvement in dental erosion from GER is not understood. We investigated the prevalence of dental erosion among children with and without GER symptoms, and whether salivary flow rate or bacterial load contribute to location-specific dental erosion. We performed a cross-sectional study of 59 children (ages, 9-17 y) with symptoms of GER and 20 asymptomatic children (controls); all completed a questionnaire on dietary exposure. Permanent teeth were examined for erosion into dentin, erosion locations, and affected surfaces. The dentist was not aware of GER status, and the gastroenterologist was not aware of dental status. Stimulated salivary flow was measured and salivary bacterial load was calculated for total bacteria, Streptococcus mutans, and Lactobacilli. Controlling for age, dietary intake, and oral hygiene, there was no association between GER symptoms and dental erosion by tooth location or affected surface. Salivary flow did not correlate with GER symptoms or erosion. Erosion location and surface were independent of total bacteria and levels of Streptococcus mutans and Lactobacilli. Location-specific dental erosion is not associated with GER, salivary flow, or bacterial load. Prospective studies are required to determine the pathogenesis of GER-associated dental erosion and the relationship between dental caries to GER and dental erosion. Copyright © 2011 AGA Institute. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Ornelas, José N.
2014-01-01
Full Text Available O presente ensaio é um reflexão sobre a construção no romance Paisagem com mulher e mar ao fundo de Teolinda Gersão do imaginário político, social e cultural português durante o período do regime fascista de Oliveira Salazar e a forma como ele justifica e serve de suporte ideológico à retórica imperialista/colonialista de Portugal. O ensaio também demonstra como o ditador O. S. (codificação de Oliveira Salazar usa o poder coercivo de uma linguagem que se fundamenta em mitos, símbolos, cerimónias, exposições e rituais para controlar, silenciar e reprimir o povo português e paralisar a nação. Finalmente, analisa-se a desmitificação e a subversão do poder tirânico que o líder politico exerce no seu reino, o mar, símbolo de morte e de estagnação, e a substituição do reino do mar pelo da terra, símbolo de vida e de criatividade
Directory of Open Access Journals (Sweden)
Tobias G. Wenzl
2011-01-01
Full Text Available The aim of this paper was to investigate the temporal association of gastroesophageal reflux (GER and body movement in infants. GER were registered by combined impedance-pH, documentation of body movement was done by video. Videorecording time (Vt was divided into “resting time” and “movement time” and analyzed for occurrence of GER. Association was defined as movement 1 minute before/after the beginning of a GER. Statistical evaluation was by Fisher's exact test. In 15 infants, 341 GER were documented during Vt (86 hours. 336 GER (99% were associated with movement, only 5 episodes (1% occured during resting time. Movement was significantly associated with the occurrence of GER (<.0001. There is a strong temporal association between GER and body movement in infants. However, a clear distinction between cause and effect could not be made with the chosen study design. Combined impedance-pH has proven to be the ideal technique for this approach.
Ferhat İle Şirin Hikâyesi’nde Büyülü Gerçekçilik Magical Realism In The Tale Of Ferhat And Şirin
Directory of Open Access Journals (Sweden)
Mehmet Emin BARS
2012-12-01
depths of oral literature. In our study, in the writing work, placed in Seyfettin Özege bookcase in Atatürk University Central Library by the name of the tale of Ferhat and Şirin, the being of the style of magical realism is going to be studied. Halk hikâyeleri, göçebelikten yerli hayata geçişin ilk mahsullerindendir. Genellikle aşk ve kahramanlık konularını işlerler. Kaynağını Türk, Arap-İslam ve Hint-İran kültüründen alan bu ürünler, büyük ölçüde âşıklar ve meddahlar tarafından anlatılan nazım nesir karışık anlatımlardır. Türk halk hikâyeleri milletimizin roman ihtiyacını karşılayan eserlerdir. Ferhat ile Şirin hikâyesi de uzun yıllar halkın bu ihtiyacını karşılamıştır. Ferhat ile Şirin hikâyesi İran edebiyatının mesnevi konuları arasında önemli yer tutar. Hüsrev ü Şirin adıyla da bilinen hikâye divan edebiyatında da mesnevi konusu olarak işlenmiştir. Hikâye halk edebiyatında Ferhat ile Şirin adıyla anılmıştır. Ferhat ile Şirin hikâyesi, Hüsrev ü Şirin mesnevisinin bir parçasıdır. Hüsrev ü Şirin mesnevisinin konusu Sasani hükümdarlarından Hüsrev Perviz’in hayatına ve aşk maceralarına dayanmaktadır. Hikâye yüksek zümre edebiyatında olduğu gibi halk edebiyatında da ele alınmış ve geniş halk kitleleri tarafından beğenilerek dinlenmiştir. Hikâye yazılı metinlerden sözlü edebiyata geçişte bazı değişikliklere uğramış, birçok varyantı meydana gelmiş, hikâyenin tarihî ve coğrafî çerçevesi de değişerek bir kısmı Anadolu’ya adapte edilmiştir. Büyülü gerçekçilik terimi ise, ilk olarak Alman sanat eleştirmeni ve tarihçisi Franz Roh tarafından, 1925’te dönemin Alman ressamlarının, konuları ve temaları hayal ürünü, fantastik ve rüyamsı niteliğe sahip çalışmalarını anlatmak amacıyla kullanılmıştır. Terim, edebiyatta ilk olarak, İtalyan yazar ve eleştirmen Massimo Bontempelli tarafından kullanılmıştır. Bu
Li, Jiehui; Brackbill, Robert M; Jordan, Hannah T; Cone, James E; Farfel, Mark R; Stellman, Steven D
2016-09-01
Little is known about the direction of causality among asthma, posttraumatic stress disorder (PTSD), and onset of gastroesophageal reflux symptoms (GERS) after exposure to the 9/11/2001 World Trade Center (WTC) disaster. Using data from the WTC Health Registry, we investigated the effects of early diagnosed post-9/11 asthma and PTSD on the late onset and persistence of GERS using log-binomial regression, and examined whether PTSD mediated the asthma-GERS association using structural equation modeling. Of 29,406 enrollees, 23% reported GERS at follow-up in 2011-2012. Early post-9/11 asthma and PTSD were each independently associated with both the persistence of GERS that was present at baseline and the development of GERS in persons without a prior history. PTSD mediated the association between early post-9/11 asthma and late-onset GERS. Clinicians should assess patients with post-9/11 GERS for comorbid asthma and PTSD, and plan medical care for these conditions in an integrated fashion. Am. J. Ind. Med. 59:805-814, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Puranik, Ameya D; Nair, Gopinathan; Aggarwal, Rajiv; Bandyopadhyay, Abhijit; Shinto, Ajit; Zade, Anand
2013-04-01
The study aimed at developing a scoring system for scintigraphic grading of gastro-esophageal reflux (GER), on gastro-esophageal reflux scintigraphy (GERS) and comparison of clinical and scintigraphic scores, pre- and post-treatment. A total of 39 cases with clinically symptomatic GER underwent 99mTc sulfur colloid GERS; scores were assigned based on the clinical and scintigraphic parameters. Post domperidone GERS was performed after completion of treatment. Follow up GERS was performed and clinical and scintigraphic parameters were compared with baseline parameters. Paired t-test on pre and post domperidone treatment clinical scores showed that the decline in post-treatment scores was highly significant, with P value reflux and also for following children post-treatment.
Directory of Open Access Journals (Sweden)
Sanjeev Sridharan
2016-09-01
Full Text Available Background: Mainstreaming of gender, equity, and human rights (GER is an important focus of the World Health Organization (WHO and other UN organizations. This paper explores the role of action plans in mainstreaming GER. This paper is informed by a theory-driven evaluation lens. Design: A theory of change framework explored the following seven dimensions of how action plans can implement mainstreaming of GER: awareness of the foundations of GER; understanding of context; planning to impact GER; implementation for GER; monitoring, evaluation, and learning; planning for sustainability; agenda setting and buy-in. The seven dimensions were used to analyze the action plans. Reviewers also explored innovations within each of the action plans for the seven dimensions. Results: GER mainstreaming is more prominent in the foundation, background, and planning components of the plan but becomes less so along the theory of change including implementation; monitoring and evaluation; sustainability; and agenda setting and buy-in. Conclusions: Our analysis demonstrates that much more can be done to incorporate GER considerations into the action planning process. Nine specific recommendations are identified for WHO and other organizations. A theory-driven approach as described in the paper is potentially helpful for developing clarity by which action plans can help with mainstreaming GER considerations.
Directory of Open Access Journals (Sweden)
L. Mello-Fujita
2008-02-01
Full Text Available Gastroesophageal reflux (GER is common in asthma patients and can contribute to sleep disruption. The aim of the present study was to determine the time-related distribution of GER events together with their impact on sleep in asthmatic subjects with GER disease symptoms. The inclusion criteria were: 18-65 years, controlled moderate to severe asthma and GER-compatible clinical evidence. The exclusion criteria were: chronic obstructive lung disease, smoking, infections of the upper airways, use of oral corticosteroids, other co-morbidities, pregnancy, sleep-related disorders, night-time shift work, and the use of substances with impact on sleep. Asthmatic patients with nocturnal symptoms were excluded. All-night polysomnography and esophageal pH monitoring were recorded simultaneously. Of the 147 subjects selected, 31 patients and 31 controls were included. Seventeen patients were classified as DeMeester positive and 14 as DeMeester negative. Both groups displayed similar outcomes when general variables were considered. Sleep stage modification one minute prior to GER was observed in the DeMeester-positive group. Awakening was the most frequent occurrence at GER onset and during the 1-min period preceding 38% of the nocturnal GER. Sleep stage 2 was also prevalent and preceded 36% of GER events. In the DeMeester-negative group, awakening was the most frequent response before and during GER. Modifications in sleep stages, arousals or awakenings were associated with 75% of the total GER events analyzed during the period of one minute before and after the fall of esophageal pH below 4 in the DeMeester-positive group. These data provide evidence that sleep modifications precede the GER events in asthmatic patients.
Organisering af basal uddannelse i laparoskopisk kirurgi
DEFF Research Database (Denmark)
Lund, Lars; Høj, Lars; Poulsen, Johan
2010-01-01
evalueringsmetode er anvendt objective structured clinical examination (OSCE-test) og objective structured assessment of technical skills (OSATS-test). Resultater: Af de 106 læger er der færdigtrænet 80 læger på modul 1 og 2. Deltagernes fordeling på specialer var ved modul 1: kirurgi 47 læger, urologi 14 læger og...
Geschichte der Lexikographie mit Deutsch und Dänisch
DEFF Research Database (Denmark)
Bergenholtz, Henning; Mogensen, Jens Erik
1995-01-01
kvantitativt og kvalitativt højdepunkt, som først delvist blev genopnået for tysk-danske ordbøger omkring 1900 og for dansk-tyske ordbøger i 1990erne. Derudover er særligt de første dansk-tyske ordbøger meget spændende, idet de samtidig var konciperet til brug som monolingvale danske ordbøger, da der dengang...
Directory of Open Access Journals (Sweden)
Catherine Parayre
2012-05-01
Full Text Available « Ecrire à la suite de » est un procédé d’écriture courant dans la littérature, qu’il s’agisse de mettre en relief l’intertextualité de l’œuvre (par exemple, en incluant des citations, de s’adonner à un travail basé sur l’intermédialité (par exemple, dans un texte rédigé à partir de photographies ou encore d’écrire à quatre mains, lorsqu’un des deux auteurs ajoute son texte à celui du partenaire d’écriture. Ne faisant pas exception, les littératures francophones du Canada pratiquent tout aussi fréquemment cette écriture de l’après. Le présent article en examinera quelques exemples dans des œuvres de nature introspective : La lumière et l’heure : poèmes et carnets (2004 d’Andrée Lacelle, avec des tableaux de Réjine Halimi ; Lithochronos ou le premier vol de la pierre (1999 d’Andrée Christensen et Jacques Flamand, avec des photographies de Christensen ; et L’incendiaire (2008 de Paul Savoie et Dyane Léger. L’analyse montrera que l’écriture « à la suite de », aussi variées qu’en soient les manifestations, non seulement met en évidence la présence de l’auteur dans ces textes, mais a aussi pour résultat, dans ces œuvres méditatives, de dédramatiser et d’amenuiser l’intensité de la réflexion existentielle.
Bicalho, Gustavo P; Braz, Leandro G; de Jesus, Larissa S B; Pedigone, Cesar M C; de Carvalho, Lídia R; Módolo, Norma S P; Braz, José R C
2014-10-01
An inhaled gas absolute humidity of 20 mg H2O·L is the value most considered as the threshold necessary for preventing the deleterious effects of dry gas on the epithelium of the airways during anesthesia. Because children have small minute ventilation, we hypothesized that the humidification of a circle breathing system is lower in children compared with adults. The Primus anesthesia workstation (Dräger Medical, Lübeck, Germany) has a built-in hotplate to heat the patient's exhaled gases. A heat and moisture exchanger (HME) is a device that can be used to further humidify and heat the inhaled gases during anesthesia. To evaluate the humidifying properties of this circle breathing system during pediatric anesthesia, we compared the temperature and humidity of inhaled gases under low or high fresh gas flow (FGF) conditions and with or without an HME. Forty children were randomly allocated into 4 groups according to the ventilation of their lungs by a circle breathing system in a Dräger Primus anesthesia workstation with low (1 L·min) or high (3 L·min) FGF without an HME (1L and 3L groups) or with an HME (Pall BB25FS, Pall Biomedical, East Hills, NY; HME1L and HME3L groups). The temperature and absolute humidity of inhaled gases were measured at 10, 20, 40, 60, and 80 minutes after connecting the patient to the breathing circuit. The mean inhaled gas temperature was higher in HME groups (HME1L: 30.3°C ± 1.1°C; HME3L: 29.3°C ± 1.2°C) compared with no-HME groups (1L: 27.0°C ± 1.2°C; 3L: 27.1°C ± 1.5°C; P [HME3L: 23 ± 2 mg H2O·L] > [1L: 17 ± 1 mg H2O·L] > [3L: 14 ± 1 mg H2O·L]; P pediatric circle breathing system, the use of neither high nor low FGF provides the minimum humidity level of the inhaled gases thought to reduce the risk of dehydration of airways. Insertion of an HME increases the humidity and temperature of the inhaled gases, bringing them closer to physiological values. The use of a low FGF enhances the HME efficiency and
International Nuclear Information System (INIS)
Asakura, Yasushi; Imai, Yukinori; Ota, Shinichi; Fujiwara, Kenji; Miyamae, Tatsuya
2005-01-01
The aim of this study is to evaluate the usefulness of gastroesophageal reflux (GER) scintigraphy using the knee-chest (KC) position for the diagnosis of gastroesophageal reflux disease (GERD). The study subjects were 37 patients with GERD and 8 healthy volunteers (control group). Endoscopically observed esophageal mucosal breaks were evaluated with the Los Angeles classification. For GER scintigraphy, the subjects ingested liquid yogurt labeled with 99m Tc-diethylene triamine pentaacetic acid ( 99m Tc-DTPA) and water. Imaging was performed in the supine and KC position, and GER was graded as 1-4 according to the extent of GER assessed by scintigraphy. GER scintigraphy revealed no reflux in the control group (specificity: 100%). In the supine position, gastroesophageal reflux was observed in 49% of the patients with GERD, compared to 76% in the KC position. 21 of 23 (91%) patients with erosive esophagitis were shown to have GER with scintigraphy. GER scintigraphy revealed severe reflux (grade 3 or 4) (83%, 10/12) in the patients who had severe mucosal breaks (the Los Angels classification grade C or D). GER scintigraphy detected grade 1 or 2 reflux in 7 of the 14 patients who were endoscopically negative. There was a correlation between the endoscopically determined severity of mucosa and the reflux grade which was determined with GER scintigraphy. GER scintigraphy can detect gastroesophageal reflux with a high sensitivity in the KC position and might be a useful method in the screening and assessment of the severity of this disease. This method would be useful for the diagnosis of GERD in endoscopically negative patients. (author)
International Nuclear Information System (INIS)
Thomas, E.J.; Bharathi Dasan, J.; Chandrasekhar, N.; Tripathi, M.; Kumar, R.; Kumar, A.; Malhotra, A.; Gupta, D.K.; Mitra, D.K.
2002-01-01
Introduction: Anatomical and functional esophageal abnormalities in survivors with CDH are well known. Gastro-esophageal Reflux (GER) is a common cause of long-term morbidity in survivors of congenital diaphragmatic hernia. The incidence of GER in these patients varies from 20-70% using various modalities. Aims: The present retrospective analysis was undertaken to find out the incidence of GER detected by radionuclide scintigraphy in survivors of congenital diaphragmatic hernia. Materials and Methods: Radionuclide scintigraphy for GER detection were performed in 26 survivors of congenital diaphragmatic hernia (17 male and 9 female) with a mean age of 19 months; age range 10 days to 56 months. Seven of the children had symptoms suggestive of GER. Of these 7, 3 had recurrent respiratory tract infection, 2 had regurgitation, 1 had vomiting and 1 had epigastric pain. The remaining 19 children were referred as part of routine follow up. All the children underwent radionuclide scintigraphy with 100-200 micro curie (3.7 -7.4MBq) of Tc99m-Sulphur Colloid. Results: The radionuclide scintigraphy detected GER in 11 out of 26(42.3%) children. Among the 7 symptomatic children, 4 (57%) had positive scintigraphic studies for reflux. Of these 4, 3(75%) had proximal reflux and 1 had distal reflux. Of the 19 asymptomatic patients, 7 (37%) were positive for GER on scintigraphy. Of these 7, 4 (57%) had proximal reflux and 3 (43%) had distal reflux. Conclusions: There is high incidence of GER in survivors of congenital diaphragmatic hernia irrespective of the presence or absence of symptoms suggestive of GER. Scintiscanning being a simple, noninvasive test can be used for initial evaluation of survivors of CDH for GER
Directory of Open Access Journals (Sweden)
Stevan Radojčić
2008-10-01
Full Text Available U radu je prikazan postupak i predložene su formule za transformacije iz Gaus-Krigerove projekcije, koja se koristi u Srbiji, u Svetsku poprečnu Merkatorovu projekciju i obratno. Osim preračunavanja između koordinata u ravni i na elipsoidu, date su i formule za Helmertovu sedmoparametarsku transformaciju između srpskog datuma i WGS84 (World Geodetic System 1984. / This paper gives a procedure and a complete set of formulas for transformations from the Gauss-Krüger projection, used in Serbia, to the Universal Transverse Mercator and vice versa. Besides the conversions between plane and ellipsoid coordinates, the paper gives the formulas for the Helmert's seven-parameter datum transformation between a Serbian datum and a WGS 84 (World Geodetic System 1984 one.
Proposed Grand Challenges in Geoscience Education Research: Articulating a Community Research Agenda
Semken, S. C.; St John, K. K.; Teasdale, R.; Ryker, K.; Riggs, E. M.; Pyle, E. J.; Petcovic, H. L.; McNeal, K.; McDaris, J. R.; Macdonald, H.; Kastens, K.; Cervato, C.
2017-12-01
Fourteen ago the Wingspread Project helped establish geoscience education research (GER) as an important research field and highlighted major research questions for GER at the time. More recently, the growth and interest in GER is evident from the increase in geoscience education research articles, the establishment of the NAGT GER Division, the creation of the GER Toolbox, an increase in GER graduate programs, and the growth of tenure-eligible GER faculty positions. As an emerging STEM education research field, the GER community is examining the current state of their research and considering the best course forward so that it can have the greatest collective impact on advancing teaching and learning in the geosciences. As part of an NSF-funded effort to meet this need, 45 researchers drafted priority research questions, or "Grand Challenges", that span 10 geoscience education research themes. These include research on: students' conceptual understanding of the solid and the fluid Earth, K-12 teacher preparation, teaching about Earth in the context of societal problems, access and success of underrepresented groups in the geosciences, spatial and temporal reasoning, quantitative reasoning and use of models, instructional strategies to improve geoscience learning, students' self-regulated learning, and faculty professional development and institutional change. For each theme, several Grand Challenges have been proposed; these have undergone one round of peer-review and are now ready for the AGU community to critically examine the proposed Grand Challenges and make suggestions on strategies for addressing them: http://nagt.org/nagt/geoedresearch/grand_challenges/feedback.html. We seek perspectives from geoscience education researchers, scholars, and reflective educators. It is our vision that the final outcomes of this community-grounded process will be a published guiding framework to (1) focus future GER on questions of high interest to the geoscience education
Gastroesophageal reflux and respiratory diseases in children
International Nuclear Information System (INIS)
Fatima, S.; Saeed, M.A.; Jafri, S.R.A.; Raza, M.; Kundi, Z.U.; Hyder, S.W.
2002-01-01
The association of gastroesophageal reflux disease and its pulmonary manifestation is well known however the exact underlying mechanism is unclear. The medical literature is deluged with studies on relationship between Gear and its pulmonary manifestations. The aim of this study was to 1) determine prevalence of GER in children with rLRTI, wheezing and asthma. 2) determine prevalence of asymptomatic respiratory anomalies in children with clinical reflux 3) determine effectiveness of anti-reflux therapy in clinical control of asthma, wheezing and rLRTI. Children were included in the study if they presented either with rLRTI, wheezing, Bronchial asthma or Clinical suspicion of GER without any respiratory symptoms. The GER study comprised esophageal transit, gastroesophageal reflux and lung aspiration studies. Acquisition and processing were according to predetermined protocol. Segmental and global esophageal transit times, GER according to duration of episode and volume of refluxed liquid, Reflux severity, Gastric retention at 30 minutes, Gastric emptying time, Presence of lung aspiration were calculated for each study. All children underwent Barium studies on a separate day. Clinical follow-up was done every 3 months and GER study was repeated every 6 months up to one year. The patient's therapy was determined by local protocols at discretion of clinicians. GER scintigraphy was performed in 43 patients (age range 5 months -12 years). Gastroesophageal reflux of varying degrees was observed in 10 children (23.25%) in all groups. The severity of clinical symptoms was directly related to severity of GER. The direct correlation was found between GER and reflux index. The results of GER scintigraphy were compared with Barium studies and results were found to be superior in terms of sensitivity, specificity and accuracy in detecting disease. It was possible to objectively evaluate and monitor response to therapy after medical treatment in few cases with help of follow
Directory of Open Access Journals (Sweden)
Jonathan D.
2006-11-01
Full Text Available Le procédé de thermovaporisation est utilisé pour l'extraction et l'analyse des hydrocarbures à point d'ébullition situé à l'intérieur de l'intervalle correspondant aux alcanes C6 à C15; il s'applique également aux roches et aux huiles. La mise en ceuvre est simple et rapide, ce qui rend cette technique utilisable dans certains laboratoires de chantiers d'exploration. Les chromatogrammes de vapeurs montrent une succession de pics, chaque pic correspondant théoriquement à un composant défini, alcane, cyclane ou aromatique; la portion située entre les alcanes n-C, et n-C8 est très typée, mais le reste du chromatogramme apporte également des informations importantes ; l'ensemble donne une définition chimique très fine des hydrocarbures légers présents dans l'échantillon. L'exploitation de ces informations en interprétation géochimique est multiple (pouvoir pétroligène de sédiments, état de maturation, etc.. La faible masse de la prise d'essai nécessaire constitue un intérêt essentiel de la méthode. The method called thermovaporization is used to extract and analyse low boiling point hydrocarbons in the range corresponding to C6-C15; alcanes. Sediments and oils ore examined in the same way. This method is simple and fast to utilize, and for this reason it can be applied in some field exploration laboratories. Chromatograms show a sertes of peaks, each of them theoretically corresponding to a particular composant : alkane, cyclone, arcmatics. The part of the chromatogram between n-C7 n-C8 is very characteristic, but other parts also provide a great deal of information. The total chromatogram gives a very fine chemical definition of the light hydrocarbons in the sample. This information can be used for many geochemical interpretations (hydrocarbon yield potential, state of maturation, etc.. Moreover, the tiny amount of sample thot is necessary is of major interest.
Bashashati, Mohammad; Hejazi, Reza A; Andrews, Christopher N; Storr, Martin A
2014-01-01
Gastroesophageal reflux (GER) is a common gastrointestinal process that can generate symptoms of heartburn and chest pain. Proton pump inhibitors (PPIs) are the gold standard for the treatment of GER; however, a substantial group of GER patients fail to respond to PPIs. In the past, it was believed that acid reflux into the esophagus causes all, or at least the majority, of symptoms attributed to GER, with both erosive esophagitis and nonerosive outcomes. However, with modern testing techniques it has been shown that, in addition to acid reflux, the reflux of nonacid gastric and duodenal contents into the esophagus may also induce GER symptoms. It remains unknown how weakly acidic or alkaline refluxate with a pH similar to a normal diet induces GER symptoms. Esophageal hypersensitivity or functional dyspepsia with superimposed heartburn may be other mechanisms of symptom generation, often completely unrelated to GER. Detailed studies investigating the pathophysiology of esophageal hypersensitivity are not conclusive, and definitions of the various disease states may overlap and are often confusing. The authors aim to clarify the pathophysiology, definition, diagnostic techniques and medical treatment of patients with heartburn symptoms who fail PPI therapy. PMID:24719900
International Nuclear Information System (INIS)
Thomas, E.J.; Bharathi Dasan, J.; Patel, C.D.; Bal, C.S.; Malhotra, A.; Kumar, R.; Mitra, D.K.; Agarwala, S.; Padhy, A.K.
2003-01-01
Gastro-esophageal Reflux is a common cause of long-term morbidity in survivors of congenital diaphragmatic hernia. The present retrospective analysis was undertaken to find out the incidence of GER in survivors of congenital diaphragmatic hernia (CDH). A total of 26 survivors of congenital diaphragmatic hernia with a mean age of 19 months were studied. Of these, only 7 had clinical symptoms suggestive of GER such as recurrent respiratory tract infection, vomiting, regurgitation, and epigastric pain. The remaining 19 were asymptomatic and had radionuclide scintigraphy for detection of GER as a part of routine follow-up. All the 26 underwent radionuclide scintigraphy with 100-200 μCi (3.7 -7.4MBq) of Tc99m-Sulphur Colloid. GER was detected in 11 out of 26 patients (4 out of 7 symptomatic patients and 7 out of 19 asymptomatic patients). We concluded that there is high incidence of GER in survivors of congenital diaphragmatic hernia and these patients should be followed up for GER regularly. Scintiscanning being a simple, noninvasive test, may be used for initial evaluation and follow-up of survivors of CDH for GER. (author)
International Nuclear Information System (INIS)
Puranik, Ameya D.; Nair, Gopinathan; Bandyopadhyay, Abhijit; Shinto, Ajit; Zade, Anand; Aggarwal, Rajiv
2013-01-01
The study aimed at developing a scoring system for scintigraphic grading of gastro-esophageal reflux (GER), on gastro-esophageal reflux scintigraphy (GERS) and comparison of clinical and scintigraphic scores, pre- and post-treatment. A total of 39 cases with clinically symptomatic GER underwent 99m Tc sulfur colloid GERS; scores were assigned based on the clinical and scintigraphic parameters. Post domperidone GERS was performed after completion of treatment. Follow up GERS was performed and clinical and scintigraphic parameters were compared with baseline parameters. Paired t-test on pre and post domperidone treatment clinical scores showed that the decline in post-treatment scores was highly significant, with P value < 0.001. The scintigraphic scoring system had a sensitivity of 93.9% in assessing treatment response to domperidone, specificity of 83.3% i.e., 83.3% of children with no decline in scintigraphic scores show no clinical response to Domperidone. The scintigraphic scoring system had a positive predictive value of 96.9% and a negative predictive value of 71.4%. GERS with its quantitative parameters is a good investigation for assessing the severity of reflux and also for following children post-treatment. (author)
Directory of Open Access Journals (Sweden)
Mounanga P.
2012-09-01
Full Text Available Cet article s’intègre dans une étude menée sur la valorisation de déchets de mousse de polyuréthane rigide (PUR pour l’élaboration de matériaux cimentaires légers. Dans ce but, des mortiers ont été fabriqués en remplaçant partiellement le sable par des particules fines de mousse PUR. Les taux de remplacement volumique considérés sont de 25 et 50%. Afin de comparer les bénéfices apportés par l’utilisation de mousse PUR par rapport à des granulats légers commerciaux, des mortiers légers à base de billes de polystyrène expansé (PSE de diamètre compris entre 1,5 et 2,5 mm, ont également été fabriqués. L’ouvrabilité, la cinétique d’hydratation au jeune âge et les propriétés mécaniques (résistance à la compression et module d’Young dynamique, thermiques (conductivité thermique et capacité calorifique, le retrait de séchage et la perméabilité au gaz ont été mesurés sur les différents mortiers mis en oeuvre. Une analyse comparative de ces propriétés est alors proposée. This article is part of a study on the valorization of rigid polyurethane foam (PUR waste for the development of lightweight cementitious materials. Mortars were made with volume replacement rates of sand with plastic lightweight aggregates equal to 25 and 50%. To compare the benefits of the use of PUR foam in comparison with commercial lightweight aggregates, two types of aggregates were considered: PUR foam particles and expanded polystyrene beads. The workability, early-age hydration rate, mechanical properties (compressive strength and dynamic Young’s modulus, thermophysical properties (thermal conductivity and specific heat, drying shrinkage and gas permeability were measured on the different mortars investigated. A comparative analysis of these properties was then proposed, which showed that it was possible to produce lightweight aggregate mortars for structural use using PUR foam waste and that PUR foam particles had a
Loots, C. M.; Benninga, M. A.; Omari, T. I.
2012-01-01
GER is the passage of gastric contents into the esophagus and is referred to as GER disease (GERD) when GER causes troublesome symptoms and/or complications. GERD in infants and children is sometimes difficult to diagnose and even more difficult to treat. The diagnosis of GERD is hampered by the
DEFF Research Database (Denmark)
Hallan, Andreas; Bomme, M.; Hveem, K.
2015-01-01
% CI 0.66-0.98) and higher education (OR 0.69, 95% CI 0.56-0.86) were negatively associated with new-onset GERS. Gain in body mass index (BMI) was dose-dependently associated with new-onset GERS (OR 1.30 per unit increase in BMI, 95% CI 1.25-1.35), irrespective of baseline BMI. Previous and current......-onset GERS were associated with increasing age, female sex, lower education, gain in BMI, and ever tobacco smoking. Tobacco smoking cessation was associated with new-onset GERS among those who gained weight upon quitting....
Danish general practitioners' self-reported competences in end-of-life care
DEFF Research Database (Denmark)
Winthereik, Anna; Neergaard, Mette; Vedsted, Peter
2016-01-01
Praktiserende læger har en central rolle i palliativ behandling, og deres deltagelse er værdsat af patienter og pårørende. I dette spørgeskemastudie undersøger forfatterne, hvordan praktiserende læger i region Midtjylland vurderede deres fortrolighed og egne evner inden for palliation. Derudover ...
International Nuclear Information System (INIS)
Orellana, P.; Bernal, P.; Birkenfeld, B.; Boonyaprapa, S.; Chen, S.; Ciofetta, G.; Ellman, A.; Fatima, S.; Kavasakal, L.; Rondain, J.E.; Padhy, A.K.
2002-01-01
Gastroesophageal reflux may cause or contribute to different respiratory problems such as bronchial asthma (BA), recurrent lower respiratory tract infection (rLRTI), among others. There is no clear cut explanation of mechanisms responsible for the respiratory symptoms in children with recurrent GER, and how beneficial GER treatment could be in the management of this children. The aim of this prospective coordinate research project was to evaluated the presence of GER, esophageal transit (ET) abnormalities and lung aspiration (LA) in children with recurrent respiratory symptoms. So far we had evaluated 309 children; 173 boys and 136 girls, between 15 days and 15 years old of age. Under standard and protocolized procedures all children underwent gastroesophageal scintigraphic study. Esophageal transit scintigraphy (ETS) was performed in 127 and LA scintigraphy in 205. The scintigraphic study was positive for GER in 160/309 (51.8%) of the total group. We found an abnormal ETS in 13.4% and a LA scintigraphy positive for aspiration of gastric content in 3.9% of the studied patients. According to clinical features, 75% of asthmatic children with persistent symptoms had GER and 30.7% of children with rLRTI. Follow-up studies were performed in 85 children after treatment of GER and there was a normalization of the scintigraphic study, associated with clinical improvement in 69.4% of them. These results show that GER prevalence in children with BA and rLRTI is higher than the reported normal prevalence in infancy, specially in the group of asthmatic patients. In our group, we do not find a significant presence of ET abnormalities neither LA of gastric content. The diagnosis and treatment of GER is mandatory in children with rLRTI or persistent BA. In asthmatic patients the recognition of gastric abnormalities is highly relevant for therapeutic problems when GER is in a sub-clinical stage
DEFF Research Database (Denmark)
Jensen, Line F; Mukai, Thomas; Andersen, Berit
2012-01-01
Artiklen undersøger om der er sammenhæng mellem den praktiserede læges holdning til brystkræftscreening og kvinders deltagelse i screening. Data omkring de praktiserende lægers holdning til screening blev indsamlet via en spørgeskemaundersøgelse blandt praktiserende læger i Region Midtjylland. Da...
Denmark. Alcohol, Drugs and Tobacco Programme
DEFF Research Database (Denmark)
Barfod, S.; Saunders, J.; Wutzke, S.
1998-01-01
Artiklen omtaler de danske resultater af en spørgeskemaundersøgelse blandt praktiserende læger i 16 lande. Af de 304 besvarelser angiver 91%, at de højst behandler 2 patienter om måneden for alkoholproblemer. Læger med erfaring i alkoholbehandling, og læger, der arbejder mest, spørger oftere dere...
Nasal continuous positive airway pressure inhibits gastroesophageal reflux in newborn lambs.
Directory of Open Access Journals (Sweden)
Djamal Djeddi
Full Text Available BACKGROUND: Using esophageal pHmetry, nasal CPAP (nCPAP has been shown to decrease acid gastroesophageal reflux (GER in adult humans. Although both GER (mainly non-acid and nCPAP use are very frequent in newborns, the effect of nCPAP on GER in early life is unknown. Having recently shown that the newborn lamb is a unique model for studying neonatal GER, our main objective was to assess the effect of nCPAP on GER in newborn lambs. METHODS: Eight newborn lambs, aged 2-3 days, were studied. Continuous esophageal pH-Impedance monitoring and polysomnography were performed for six hours during both spontaneous breathing and nCPAP application at 6 cmH2O (nCPAP(6, in a randomized order. Results were compared in the two experimental conditions, as well as without CPAP during the following 6 hours. RESULTS: i nCPAP(6 virtually abolished GER [mean ± SD reflux number for 6 h = 9.1 ± 8.6 without nCPAP(6 vs. 0.6 ± 1 with nCPAP(6, P<0.05]; ii GER number was also reduced during the 6 h-period following nCPAP(6 application (18 ± 16 without nCPAP(6 vs. 7 ± 8.1 with nCPAP(6, P<0.05; iii nCPAP(6 decreased the depth and duration of lower esophageal sphincter relaxation. CONCLUSIONS: nCPAP inhibits GER in the newborn lamb. Further clinical studies using different levels of nasal CPAP are needed to confirm this result in human infants.
Gastroesophageal Reflux: Regurgitation in the Infant Population.
Ferguson, Teresa D
2018-03-01
Gastroesophageal reflux (GER) is common in infancy and mainly treated through nonpharmacological interventions. Knowing the early warning signs of GER is important for nursing assessment. Untreated GER can become acute when an infant fails to gain weight and has recurrent, forceful vomiting. Further investigation of gastroesophageal reflux disease (GERD) is indicated when failure to gain weight, irritability, swallowing difficulties, regurgitation, and respiratory complications occur and should trigger referral to pediatric specialists. This article will share information about uncomplicated GER, GERD, and symptoms of these diagnoses, common screening tests, and treatment options. Copyright © 2017 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Hansen, Jane Møller; Wildner-Christensen, Mette; Schaffalitzky de Muckadell, Ove B
2009-01-01
OBJECTIVES: The prevalence of gastroesophageal reflux symptoms (GERS) in the population is high; however, data on long-term follow-up and incidence of GERS in the population are sparse. This study describes the long-term natural history of GERS, the related health-care use, and quality of life...... Gastrointestinal Symptom Rating Scale (GSRS)), and quality of life (the Short-Form 36-Item Health Survey (SF-36)) at inclusion and after 5 years. GERS was defined as a mean score > or =2 in the reflux dimension in the GSRS. Information on use of health-care resources was drawn from the questionnaires and registers...
The influence of a solid and liquid bolus on food-stimulated gastroesophageal reflux
Energy Technology Data Exchange (ETDEWEB)
Naeser, A.; Behrens, J.K.; Vejen-Christiansen, L.; Funch-Jensen, P.; Thommesen, P. (Aarhus Kommunehospital (Denmark). GI Motility Lab. Aarhus Kommunehospital (Denmark). Dept. of Diagnostic Radiology R)
1992-02-01
Using a radiological method to demonstrate food-stimulated gastroesophageal reflux (GER), a comparative study was carried out employing a solid, already validated bolus versus a liquid one. One hundred and four consecutive patients received both a solid and a liquid bolus in randomized order. GER was observed in 37 (35.6%) patients receiving the solid bolus versus 28 (26.9%) with the liquid one. This means that the solid bolus provokes significantly more reflux (P<0.02). GER, grade II (reflux above the level of the carina), occurred equally often as a result of both types of bolus, however. The study suggests that significant, food-stimulated GER is independent of the consistency of the foodstuffs and may be detected employing a liquid bolus. This result might be used in the examination of infants for GER, using milk as a food stimulus. (orig.).
Understanding the inverse care law
DEFF Research Database (Denmark)
Pedersen, Anette Fischer; Vedsted, Peter
2014-01-01
Udbrændthed er et stigende problem blandt alment praktiserende læger i Danmark. Dette studie viser, at alment praktiserende læger med en stor andel af socialt udsatte patienter på deres liste har større risiko for at være udbrændte sammenlignet med alment praktiserende læger med en lille andel af...
Directory of Open Access Journals (Sweden)
Adelina Giacomelli Prochnow
2005-08-01
Full Text Available Trata-se de uma reflexão teórica sobre a gerência do cuidado de enfermagem hospitalar e a Teoria Interpretativa da Cultura de Geertz. Abordam-se alguns elementos significantes da cultura no exercício da gerência destacados a partir dos referenciais teóricos da enfermagem, da administração e da antropologia. Nesses, ressalta-se a importância da diversidade cultural como um recurso inovador para ampliar a visão da integridade humana, valorizando as divergências, o respeito, o compartilhamento, importantes para o enfermeiro na construção de sua prática social.Se presenta una reflexión teórica sobre la gerencia del cuidado de la enfermería hospitalaria y la Teoría Interpretativa de la Cultura de Geertz. Son discutidos algunos elementos significativos de la cultura en la gerencia, a partir de los referenciales teóricos de la enfermería, administración y antropología. En éstos, se destaca la importancia de la diversidad cultural como un recurso innovador para ampliar la visión de la integridad humana que valora las divergencias, el respecto, el compartir, que son importantes para la enfermera en la construcción de su práctica social.This paper presents a theoretical reflection on hospital nursing care management and Geertz' Interpretive Theory of Culture. We discuss some significant elements of culture in management, based on the theoretical reference frameworks of nursing, administration and anthropology. In these, the importance of cultural diversity is highlighted as an innovative resource to expand the vision of human integrity, valuing divergences, respect and sharing, which are important for nurses in the construction of their social practice.
Directory of Open Access Journals (Sweden)
Almér Lars-Olof
2007-09-01
Full Text Available Abstract Background Dietary fibre food intake is related to a reduced risk of developing diabetes mellitus. However, the mechanism of this effect is still not clear. The aim of this study was to evaluate the effect of commercial fibre cereals on the rate of gastric emptying, postprandial glucose response and satiety in healthy subjects. Methods Gastric emptying rate (GER was measured by standardized real time ultrasonography. Twelve healthy subjects were assessed using a randomized crossover blinded trial. The subjects were examined after an 8 hour fast and after assessment of normal fasting blood glucose level. Satiety scores were estimated and blood glucose measurements were taken before and at 0, 20, 30, 40, 60, 80, 100 and 120 min after the end of the meal. GER was calculated as the percentage change in the antral cross-sectional area 15 and 90 min after ingestion of sour milk with corn flakes (GER1, cereal bran flakes (GER2 or wholemeal oat flakes (GER3. Results The median value was, respectively, 42% for GER1, 33 % for GER2 and 51% for GER3. The difference between the GER after ingestion of bran flakes compared to wholemeal oat flakes was statistically significant (p = 0.023. The postprandial delta blood glucose level was statistically significantly lower at 40 min (p = 0.045 and 120 min (p = 0.023 after the cereal bran flakes meal. There was no statistical significance between the areas under the curve (AUCs of the cereals as far as blood glucose and satiety were concerned. Conclusion The result of this study demonstrates that the intake of either bran flakes or wholemeal oat flakes has no effect on the total postprandial blood glucose response or satiety when compared to corn flakes. However, the study does show that the intake of cereal bran flakes slows the GER when compared to oat flakes and corn flakes, probably due to a higher fibre content. Since these products do not differ in terms of glucose response and satiety on healthy
Smits, M J; Loots, C M; van Wijk, M P; Bredenoord, A J; Benninga, M A; Smout, A J P M
2015-05-01
Despite existing criteria for scoring gastro-esophageal reflux (GER) in esophageal multichannel pH-impedance measurement (pH-I) tracings, inter- and intra-rater variability is large and agreement with automated analysis is poor. To identify parameters of difficult to analyze pH-I patterns and combine these into a statistical model that can identify GER episodes with an international consensus as gold standard. Twenty-one experts from 10 countries were asked to mark GER presence for adult and pediatric pH-I patterns in an online pre-assessment. During a consensus meeting, experts voted on patterns not reaching majority consensus (>70% agreement). Agreement was calculated between raters, between consensus and individual raters, and between consensus and software generated automated analysis. With eight selected parameters, multiple logistic regression analysis was performed to describe an algorithm sensitive and specific for detection of GER. Majority consensus was reached for 35/79 episodes in the online pre-assessment (interrater κ = 0.332). Mean agreement between pre-assessment scores and final consensus was moderate (κ = 0.466). Combining eight pH-I parameters did not result in a statistically significant model able to identify presence of GER. Recognizing a pattern as retrograde is the best indicator of GER, with 100% sensitivity and 81% specificity with expert consensus as gold standard. Agreement between experts scoring difficult impedance patterns for presence or absence of GER is poor. Combining several characteristics into a statistical model did not improve diagnostic accuracy. Only the parameter 'retrograde propagation pattern' is an indicator of GER in difficult pH-I patterns. © 2015 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Rainer Diaz-Bone
2006-05-01
Full Text Available Abstract: The German discourse researcher Siegfried JÄGER from Duisburg is the first to have published a German-language book about the methodology of discourse analysis after FOUCAULT. JÄGER integrates in his work the discourse analytic work of Jürgen LINK as well as the interdisciplinary discussion carried on in the discourse analytic journal "kultuRRevolution" (Journal for Applied Discourse Analysis. JÄGER and his co-workers were associated with the Duisburger Institute for Language Research and Social Research (DISS, see http://www.diss-duisburg.de/ for 20 years, developing discourse theory and the methodology of discourse analysis. The interview was done via e-mail. It depicts the discourse analytic approach of JÄGER and his co-workers following the works of FOUCAULT and LINK. The interview reconstructs JÄGERs vita and his academic career. Further topics of the interview are the agenda of JÄGERs discourse studies, methodological considerations, the (problematic relationship between FOUCAULDian discourse analysis and (discourses, linguistics, styles and organization of research and questions concerning applied discourse analytic research as a form of critical intervention. URN: urn:nbn:de:0114-fqs0603219
Nasal Continuous Positive Airway Pressure Inhibits Gastroesophageal Reflux in Newborn Lambs
Djeddi, Djamal; Cantin, Danny; Samson, Nathalie; Praud, Jean-Paul
2014-01-01
Background Using esophageal pHmetry, nasal CPAP (nCPAP) has been shown to decrease acid gastroesophageal reflux (GER) in adult humans. Although both GER (mainly non-acid) and nCPAP use are very frequent in newborns, the effect of nCPAP on GER in early life is unknown. Having recently shown that the newborn lamb is a unique model for studying neonatal GER, our main objective was to assess the effect of nCPAP on GER in newborn lambs. Methods Eight newborn lambs, aged 2–3 days, were studied. Continuous esophageal pH-Impedance monitoring and polysomnography were performed for six hours during both spontaneous breathing and nCPAP application at 6 cmH2O (nCPAP6), in a randomized order. Results were compared in the two experimental conditions, as well as without CPAP during the following 6 hours. Results i) nCPAP6 virtually abolished GER [mean ±SD reflux number for 6 h = 9.1±8.6 without nCPAP6 vs. 0.6±1 with nCPAP6, PCPAP are needed to confirm this result in human infants. PMID:25226514
International Nuclear Information System (INIS)
Zhao Ruifang; Zeng Jihua; Shi Yumin
1999-01-01
Objective: To evaluate the gastroesophageal reflux (GER) in children with chronic respiratory diseases (CRD) by radionuclide gastroesophageal imaging and to investigate the therapeutic effect of Cisapride. Methods: 45 patients were studied with 99 Tc m -DTPA gastroesophageal imaging, and compared the results with those obtained from 8 normal children. The repeated imagings were performed on some of the cases at the end of a three months' Cisapride therapy. Results: 25 (55%) among 45 patients were diagnosed as GER by imaging, while none of 8 normal children. 10 cases with GER received Cisapride therapy for 3 months. At the end of the treatment, the second imaging revealed that GER completely disappeared in 7 of them, and clinical follow-up showed marked improvement of CRD symptoms. Conclusions: The incidence of GER among with CRD children is rather great. Cisapride therapy not only remarkably relieve reflux, but also improve the symptoms of CRD
[Role of gastroesophageal reflux in acute recurrent laryngeal dyspnea in children].
Andrieu-Guitrancourt, J; Dehesdin, D; Le Luyer, B; Fouin, M; Peron, J M
1984-01-01
Recurrent laryngeal croup (RLC) in children is rarely discussed unless permanent laryngeal obstruction is involved or there is an allergic basis. An atypical case is described where gastro-esophageal reflux (GER) was not only associated with but was also directly related to the provocation of each period. A series of 15 patients with RLC were investigated for the presence of GER, and this was confirmed in 7 cases. These findings suggest that GER may be responsible for the onset of RLC, as is now admitted for numerous respiratory manifestations in children. Moreover, GER may be implicated in the course of various laryngeal obstructive lesions, particularly subglottic angioma.
Guo, Hui-Ping; Li, Hui; Guo, Jing; Li, Yan-Wen
2002-04-01
To evaluate the clinical effect of preventing gastroesophageal reflux (GER) and aspiration in neonates delivered by elective cesarean section with hand immediately after birth. On the basis of the principles for drowning resuscitation and evaluation of the principal factors causing GER and aspiration, the author adopted immediate manual management to promote emptying of gastroesophageal and airway contents in 496 newborns delivered by elective cesarean section. No GER and aspiration occurred in the babies receiving the management, and no complication was recorded. As an early preventive measure, manual management is effective in clearing gastroesophageal and airway contents against GER and aspiration, and Apgar scoring can be readily conducted.
Gastroesophageal reflux and idiopathic pulmonary fibrosis: A long term relationship
Directory of Open Access Journals (Sweden)
Karthik Gnanapandithan
2016-01-01
Full Text Available Idiopathic pulmonary fibrosis (IPF is a dreaded disease of uncertain etiology and no available cure. It is still unclear if a causal relationship exists between gastro-esophageal reflux (GER and IPF, but studies have shown an increased prevalence of acid reflux in patients with IPF. We describe a patient with achalasia and GER who went on to develop IPF. She underwent a rapidly worsening course punctuated by acute exacerbations of IPF, despite best efforts to manage the acid GER. We also reviewed the literature on the role of GER in the etiology and progression of IPF and the impact of antireflux measures on its course.
[Differentiation therapy for non-acidic gastroesophageal reflux disease].
Lishchuk, N B; Simanenkov, V I; Tikhonov, S V
2017-01-01
To investigate the clinical and pathogenetic features of the non-acidic types of gastroesophageal reflux disease (GERD) and to evaluate the impact of combined therapy versus monotherapy on the course of this disease. The investigation enrolled 62 patients with non-acidic GERD. The follow-up period was 6 weeks. The patients were divided into 2 groups: 1) weakly acidic gastroesophageal refluxes (GER); 2) weakly alkaline GER. Then each group was distributed, thus making up 4 groups: 1) 19 patients with weakly acidic GER who received monotherapy with rabeprazole 20 mg/day; 2) 21 patients with weakly acidic GER had combined therapy with rabeprazole 20 mg and itopride; 3) 8 patients with weakly alkaline GER who received ursodeoxycholic acid (UDCA) monotherapy; and 4) 14 patients with weakly alkaline GER who had combined therapy with UDCA and itopride, The clinical symptoms of the disease, the endoscopic pattern of the upper gastrointestinal tract (GIT) mucosa, histological changes in the esophageal and gastric mucosa, and the results of 24-hour impedance pH monitoring were assessed over time. During differentiation therapy, the majority of patients reported positive clinical changes and an improved or unchanged endoscopic pattern. Assessment of impedance pH monitoring results revealed decreases in the overall number of GERs, the presence of a bolus in the esophagus, and the number of proximal refluxes. These changes were noted not only in patients taking proton pump inhibitors (PPIs), but also in those treated with UDCA monotherapy or combined PPI and prokinetic therapy. A differentiated approach to non-acidic GER treatment contributes to its efficiency. Adding the prokinetic itomed (itopride hydrochloride) to PPI therapy in a patient with weakly acidic GER enhances the efficiency of treatment, by positively affecting upper GIT motility. The mainstay of therapy for GERD with a predominance of weakly alkaline refluxes is UDCA, the combination of the latter and the
Association between esophageal dysmotility and gastroesophaeal reflux on barium studies
Energy Technology Data Exchange (ETDEWEB)
Campbell, Craig [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Levine, Marc S. [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States)]. E-mail: marc.levine@uphs.upenn.edu; Rubesin, Stephen E. [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Laufer, Igor [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Redfern, Gina [Department of Radiology, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States); Katzka, David A. [Department of Medicine, Hospital of the University of Pennsylvania, Philadelphia, PA 19104 (United States)
2006-07-15
Objective: To determine whether there is an association between abnormal primary peristalsis in the esophagus and gastroesophageal reflux (GER) on barium studies. Methods: A computerized search of radiologic reports revealed 151 patients with esophageal dysmotility (characterized by intermittently decreased or absent peristalsis in the esophagus on upper gastrointestinal tract examinations) who fulfilled our study's entry criteria. These 151 patients were stratified into two groups depending on whether this dysmotility was associated with nonperistaltic contractions (NPCs): 92 patients had no NPCs (Dysmotility and No NPCs Group) and 59 had NPCs (Dysmotility and NPCs Group). An age-matched control group of 92 patients with normal motility was also generated from the radiologic reports. The reports were also reviewed for the presence and degree of GER and other complications of GER. The frequency and degree of GER were tabulated for each group, and the data were analyzed using a Pearson chi square test to determine if significant differences were present in the frequency and degree of GER or other findings among the groups. Results: The frequency of GER was significantly higher in patients with abnormal peristalsis and no NPCs than in controls (p = 0.02). When GER was stratified based on the degree of reflux, the frequency of moderate-to-marked GER was significantly higher in patients with abnormal peristalsis and no NPCs than in patients with abnormal peristalsis and NPCs (p = 0.01) or in controls (p = 0.0031). The frequency of reflux esophagitis also was significantly higher in patients with abnormal peristalsis and no NPCs than in controls (p = 0.04). Conclusion: Our findings suggest that patients with esophageal dysmotility characterized by intermittently decreased or absent peristalsis without NPCs have a significantly higher frequency and degree of GER than patients with normal motility. The presence of this specific form of esophageal dysmotility on
Directory of Open Access Journals (Sweden)
MH Amirian
2014-04-01
Full Text Available Introduction: Gastroesophageal reflux (GER is the most common of esophageal disorder in all ages. GER defined as passage of gastric contents into the esophagus, and GER disease (GERD, (symptoms or complications of GER, are common pediatric problems. Clinical manifestations of GERD in infants include regurgitation, irritability, choking, gagging vomiting, poor weight gain and respiratory disorder. The purpose of this study is evaluation prevalence of Gastroesophageal reflux and its symptoms in infants during first year of life. Materials and Method: This study was performed on 75 infants younger than one year old, who were admitted in pediatric department of Imam Reza Hospital in Mashhad during 3 months. Results: In this study in a three- month period, GER was assessed in 75 infants younger than one year who were admitted in pediatric department of Imam Reza Hospital. Their parents reported GER in 66% of these infants. The most common symptom of reflux was regurgitation. Regurgitation was reported at least once a day to seven times a day. The other reported symptoms were respectively: irritability (16%, choking (10%, and failure to thrive (0.3%. Peak reported regurgitation was 60% at 3.5 months. Conclusion: Gastroesophageal reflux is a common problem in infancy. Complaints of regurgitation are common during the first year of life. So understanding the symptoms of GER and recognition of GERD should be considred. Keyword: Infant,Gastroesophageal Reflux, Prevalence.
Qin, Chao; Malykhina, Anna P; Thompson, Ann M; Farber, Jay P; Foreman, Robert D
2010-06-01
Gastroesophageal reflux (GER) frequently triggers or worsens cardiac pain or symptoms in patients with coronary heart disease. This study aimed to determine whether GER enhances the activity of upper thoracic spinal neurons receiving noxious cardiac input. Gastric fundus and pyloric ligations as well as a longitudinal myelotomy at the gastroesophageal junction induced acute GER in pentobarbital-anesthetized, paralyzed, and ventilated male Sprague-Dawley rats. Manual manipulations of the stomach and lower esophagus were used as surgical controls in another group. At 4-9 h after GER surgery, extracellular potentials of single neurons were recorded from the T3 spinal segment. Intrapericardial bradykinin (IB) (10 microg/ml, 0.2 ml, 1 min) injections were used to activate cardiac nociceptors, and esophageal distensions were used to activate esophageal afferent fibers. Significantly more spinal neurons in the GER group responded to IB compared with the control group (69.1 vs. 38%, P neurons in the superficial laminae of GER animals was significantly different from those in deeper layers (1/8 vs. 46/60, P 0.05). Excitatory responses of spinal neurons to IB in the GER group were greater than in the control group [32.4 +/- 3.5 impulses (imp)/s vs. 13.3 +/- 2.3 imp/s, P neurons responded to cardiac input and ED, which was higher than the control group (61.5%, P neurons in deeper laminae of the dorsal horn to noxious cardiac stimulus.
Ford, A C; Forman, D; Bailey, A G; Axon, A T R; Moayyedi, P
2013-02-01
Gastro-oesophageal reflux symptoms (GERS) are common in the community. However, few studies have examined their long-term natural history, or impact on survival. To examine these issues in individuals recruited into a community-based screening programme for Helicobacter pylori in 1994. Data on mortality and cause of death at 10 years were obtained from the Office for National Statistics. Baseline demographic data, lifestyle factors, gastrointestinal symptoms and quality of life were recorded at study entry. The effect of all these factors on persistent and new-onset GERS, and 10-year mortality, were examined using univariate and multivariate analysis, with results expressed as odds ratios (ORs) or hazard ratios (HR) with 99% confidence intervals (CI). Of 3967 individuals providing complete GERS data at baseline and 10 years, 549 (13.8%) had GERS at baseline. Of these, 183 (33.3%) had persistent symptoms. Among 3418 individuals asymptomatic at baseline, approximately 0.8% per year developed new-onset GERS. No predictors of persistent GERS were identified. New-onset symptoms were associated with lower quality of life or presence of irritable bowel syndrome (IBS) at baseline, and higher body mass index (BMI) at 10 years. There were 8331 (99.1%) of 8407 subjects providing complete GERS data at baseline, 1289 (15.5%) of whom were symptomatic. Presence of GERS at baseline did not affect survival (HR: 0.84; 99% CI: 0.44-1.59). Gastro-oesophageal reflux symptoms persisted in one-third of individuals, whilst new-onset gastro-oesophageal reflux symptoms were associated with poor quality of life, irritable bowel syndrome and higher body mass index. Gastro-oesophageal reflux symptoms did not impact adversely on survival. © 2012 Blackwell Publishing Ltd.
Jaimchariyatam, Nattapong; Tantipornsinchai, Warangkana; Desudchit, Tayard; Gonlachanvit, Sutep
2016-06-01
Literature has addressed the increased prevalence of gastroesophageal reflux disease (GERD) in obstructive sleep apnea (OSA). Significant improvement of GERD has been found after OSA treatment. However, precise mechanisms underlying this correlation remain unclear. We examined the association between nocturnal gastroesophageal reflux (GER) and sleep events in patients with coexisting OSA and GERD. A case-crossover study among 12 patients with coexisting moderate-severe OSA and GERD was conducted. Participants underwent simultaneous polysomnography and esophageal impedance and pH monitoring. GER subtypes (ie, acid reflux, non-acid reflux) were defined as outcomes. Respective control time points were selected in all eligible control periods. Each sleep event was assessed individually. Estimated odds ratios (ORs) and 95% confidence intervals (CIs) were analyzed. A p-value of reflux and 28 non-acid reflux. Arousals and awakenings were significantly associated with subsequent GER events. The OR for GER following an arousal was 2.31 (95% CI 1.39-3.68; p 0.05). Both awakening and arousal appear to precipitate any subtype of GER events in patients with coexisting GERD and moderate to severe OSA. However, GER events were significantly less likely to occur after other respiratory events and did not appear to cause sleep-related events. Copyright © 2016 Elsevier B.V. All rights reserved.
Functional studies of the oesophagus with sulfur-colloid of sup(99m)Tc and gamma-camera
International Nuclear Information System (INIS)
Veiga-Fernandes, F.; Costa, P.M.; Pinheiro, M.F.; Guerreiro, D.
1982-01-01
A scintiscanning technique which allows sequential detection and quantification of gastro-oesophageal reflux (GER), and study of the oesophageal emptying of a liquid and semi-solid food is presented. At first patients swallowed 5 ml of water containing 1 mCi sup(99m)Tc sulfur-colloid and oesophageal activity is recorded from an anterior view by a gamma-camera. Then, patients ingest 300 ml of water that clear the oesophagus and fill up the stomach. GER index is calculated according to the formula GER = (Ae - Ab)/Ag) x 100, where Ae is the activity in the oesophagus; Ab, is the background activity; and Ag is the gastric activity. GER index presented corresponds to a median of three determinations in upright, supine and supine position with abdominal pressure of 4 kilos. The oesophageal transit time of a semi-solid food in upright and supine position is registered 5 minutes after GER studies through two areas of interest which are positioned: one in the superior third and the other in the inferior third of the oesophagus. Normal GER reflux index was, 0.84 +- 0.37 in the upright position; 0.87 +- 0.43 in the supine position; and 0.90 +- 0.56 in the supine position plus abdominal pressure
GERD related micro-aspiration in chronic mustard-induced pulmonary disorder
Directory of Open Access Journals (Sweden)
Rasoul Aliannejad
2012-01-01
Full Text Available Background and Aim: Bronchiolitis obliterans (BO is the main pulmonary involvement resulting from sulfur mustard (SM gas exposure that was used against Iranian civilians and military forces during the Iran-Iraq war. The present study aimed to investigate the prevalence of gastro-esophageal reflux (GER and gastric micro-aspiration in SM gas injured patients with chronic pulmonary diseases and recurrent episodes of exacerbations. Materials and Methods: This cross-sectional study was done at Baqiyatallah University of Medical Sciences, Tehran, Iran. Gastric micro-aspiration and GER were assessed in the enrolled patients by assessing bile acids, pepsin and trypsin in their bronchoalveolar lavage fluid. Results: Our result showed that bile acids were found to be high in 21.4% patients, and low in 53.6% of patients. Only in 16% patients, no bile was detected in the BALF. Trypsin and pepsin were detected in BAL fluid of all patients. Conclusion: Most of BO patients after exposure to SM suffer GER, while none the etiologic factors of GER in post lung transplant BO are present. It would be hypothesized that GER per se could be considered as an aggregative factor for exacerbations in patients. Further studies will provide more advances to better understanding of pathophysiological mechanism regarding GER and BO and treatment.
DEFF Research Database (Denmark)
Knakkergaard, Martin
2015-01-01
med dette talpar omtyder vi alt, hvad der lader sig omtyde, til tabeller i en ustoppelig bevægelse, som efterlader det omtydede til glemsel og nostalgi. Afhængig af hvordan vi anskuer disse tabeller, i det rene Aristoteliske perspektiv eller i Heideggers mere spekulative optik, er det enten causa...... finalis eller causa efficiens, som tabellerne fremstiller for os, men hvad blev der af causa materialis og causa formalis undervejs? Og at producere betyder netop at stille frem, at fremstille - dette vægter ifølge sagens natur det 'stillads' - den teknik eller teknologi - gennem hvilket noget stilles...
International Dinner / Gerli Punison
Punison, Gerli
2008-01-01
Tallinna ülikooli ajaloo instituudis toimunud üritusest, mille käigus said Eestisse õppima tulnud välistudengid tutvuda kohalike traditsioonidega, proovida siinseid toite ning omakorda tutvustada enda maa tavasid ja rahvusroogi
DEFF Research Database (Denmark)
Bergenholtz, Henning
1997-01-01
Principielt kan der ikke være tvivl om, at ethvert sprogsamfund har store behov for leksikografiske opslagsværk. Disse sprog kan dog lettere dækkes for sprog, hvor antallet af sprogbrugere er stort, som fx for engelsk, tysk og fransk. For små sprog som færøsk, grønlandsk og samisk er det ikke bare...
Single isotopic probe for gastro-esophageal reflux diagnosis in children
Energy Technology Data Exchange (ETDEWEB)
Maurel, G.; Le Moing, G.; Mensch, B.
1987-03-01
Gastro-esophageal reflux (GER) in children has been implicated in various recurring respiratory diseases. Several techniques including oesophageal pH testing and scintigraphy have been devised to detect and quantify GER Limitations have been found for each test: short duration with gamma-camera and restricted acceptability of the pH probe by children. A single isotopic probe was designed for a non-invasive screening test of GER in infants. This device was checked by comparison with oesophageal scintigraphy using a gamma camera. Only 1 discrepancy was detected in 19 reflux episodes. This method, using a relatively inexpensive detector and data acquisition module, seems to be well accepted by children, and may be associated with a pH probe for GER diagnosis.
TUNÇTANER, Prof. Dr. Korhan; ÖZEL, Arş. Gör. Halil Barış; UZUNER, Orm.Yük. Müh. Tuğba
2006-01-01
Bu çalışmada, Kdz. Ereğli-Kocaman Orman İşletme Şefliğinin bazı bölmelerinde, değişik yıllarda gerçekleştirilen Kayın yapay gençleştirme çalışmalarının başarı durumu değerlendirilmiştir. Yapılan ölçüm ve tespitler sonucunda, farklı yaşlarda bulunan Kayın bireylerinin gelişimlerinin genel olarak tatmin edici düzeyde olduğu, ancak sayılarının çok yetersiz olduğu belirlenmiştir. Diğer taraftan, Kayın bireylerinin mevcut gövde düzgünlüklerinin ve tepe formlarının iyi durumda olduğu söylenebilir. ...
Clinical features of Japanese patients with chronic cough induced by gastroesophageal reflux
Directory of Open Access Journals (Sweden)
Katsuya Fujimori
1997-01-01
Full Text Available Gastroesophageal reflux (GER has been reported as a cause of chronic cough (CC in the United States. It has been reported that 5–21% of CC cases are induced by GER. In Japan, however, detailed clinical features of CC induced by GER have not been described. The present study reports on six Japanese patients with GER-induced CC. The subjects were all females, with a mean age of 72 years. The average body mass index was 37 kg/m2, indicating obesity. No abnormalities were found with regard to concentrations of C-reactive protein, peripheral eosinophil counts, serum IgE concentrations, serum titers of cold agglutinins or antibodies to Mycoplasma pneumoniae, chest radiograph findings, respiratory function tests or blood gas analyses. Bronchial biopsy was performed in three patients and showed chronic inflammation characterized by lymphocytic infiltration, squamous metaplasia and mucosal basement membrane thickening. In the study population (Japanese patients, GER-induced CC tended to occur in elderly obese women and may be attributable to airway inflammation.
DEFF Research Database (Denmark)
Zeller, Jörg
2012-01-01
Artiklen undersøger forskellige betydningsvarianter af begrebet intuition og deres rolle i Descartes' og Kants erkendelsesteori.......Artiklen undersøger forskellige betydningsvarianter af begrebet intuition og deres rolle i Descartes' og Kants erkendelsesteori....
Single isotopic probe for gastro-esophageal reflux diagnosis in children
International Nuclear Information System (INIS)
Maurel, G.; Le Moing, G.; Mensch, B.
1987-01-01
Gastro-esophageal reflux (G.E.R.) in children has been implicated in various recurring respiratory diseases. Several techniques including oesophageal pH testing and scintigraphy have been devised to detect and quantify G.E.R. Limitations have been found for each test: short duration with gamma-camera and restricted acceptability of the pH probe by children. A single isotopic probe was designed for a non-invasive screening test of G.E.R. in infants. This device was checked by comparison with oesophageal scintigraphy using a gamma camera. Only 1 discrepancy was detected in 19 reflux episodes. This method, using a relatively inexpensive detector and data acquisition module, seems to be well accepted by children, and may be associated with a pH probe for GER diagnosis. (orig.)
Directory of Open Access Journals (Sweden)
Adelina Giacomelli Prochnow
2007-12-01
Full Text Available O exercício da gerência do enfermeiro é permeado de conflitos que podem ser interpretados pelos referenciais de cultura. O presente estudo tem como objetivo denotar especificidades culturais, analisadas segundo a Teoria Interpretativa da Cultura de Geertz, que se expressam como conflitos no âmbito da gerência do enfermeiro num Hospital Universitário. Os resultados denotam a incorporação de elementos ideológicos e de mecanismos de controle e de poder, que manifestam sua origem na forma de organização do trabalho. Percebe-se a efetivação de políticas alicerçadas em valores da própria profissão. As práticas exercidas destacam uma construção cultural que elucida algumas compreensões dos processos cognitivos, sociais e comportamentais, pois estes organizam as interpretações e as respostas para os eventos da prática gerencial do enfermeiro. Os resultados deste estudo apontam para a importância da cultura organizacional no exercício da gerência na enfermagem diante das incertezas laborais, na complexidade do ambiente hospitalarEl ejercicio de la gerencia del enfermero es perneado de conflictos que pueden ser interpretados por los referenciales de cultura. El presente estudio tiene como objetivo denotar especificidades culturales, analizadas según la Teoría Interpretativa de la Cultura de Geertz, que se expresan como conflictos en el ámbito de la gerencia de enfermero en un Hospital Universitario. Los resultados denotan la incorporación de elementos ideológicos y de mecanismos de control y de poder, que manifiestan su origen en la forma de organización del trabajo. Se percibe la efectividad de políticas basadas en valores de la propia profesión. Las prácticas ejercidas destacan una construcción cultural que elucida algunas comprensiones de los procesos cognitivos, sociales y de comportamientos, pues estos organizan las interpretaciones y las respuestas para los eventos de la práctica gerencial del enfermero. Los
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
Gastrointestinal (GI) Bleeding
... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Children & Teens Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Acid Reflux (GER & GERD) in Infants Definition & ...
DEFF Research Database (Denmark)
Ebbesen, Toke Riis
2015-01-01
En blog om design, materialitet og bøger i krydsfeltet mellem digitale udfordringer og en kulturel optik.......En blog om design, materialitet og bøger i krydsfeltet mellem digitale udfordringer og en kulturel optik....
Predictive values of GPs' suspicion of serious disease
DEFF Research Database (Denmark)
Hjertholm, Peter; Moth, Grete; Ingeman, Mads Lind
2014-01-01
Denne artikel undersøger hyppigheden af praktiserende lægers mistanke om kræft eller anden alvorlig sygdom hos patienter i konsultationen. Dertil om mistanken fører til en alvorlig diagnose og patientens brug af det øvrige sundhedsvæsen. Lægen havde mistanke i 5,7 % af alle konsultationer, og en ...... data fra KOS 2008-undersøgelsen (Kontakt- og sygdomsmønsteret i almen praksis), hvor 404 praktiserende læger registrerede 4518 konsultationer med personer over 18 år....
Amalachandran, Jaykanth; Simon, Shelley; Elangoven, Indirani; Jain, Avani; Sivathapandi, Thangalakshmi
2018-01-01
Purpose of Study: The purpose is to evaluate the findings and utility of esophageal transit scintigraphy (ETS) and gastroesophageal reflux scintigraphy (GES) in patients presenting with upper respiratory tract (URT) symptoms suspected to be due to gastroesophageal reflux (GER) disease. Materials and Methods: Thirty patients aged between 19 and 60 years underwent nasopharyngolaryngoscopy (NPL), ETS, and GES. Correlation between GER, esophageal motility, and NPL was evaluated. Inclusion criteria include patients with recurrent URT symptoms such as chronic dry cough/hoarseness of voice and itching/foreign body sensation in throat. Those with typical gastrointestinal (GI) symptoms of GER, URT symptoms relieved by antibiotics, surgical intervention in abdomen, cardiac/hepatobiliary diseases, etc. were excluded from the study. Results: Significant correlation was found between GER and NPL in 28/30 patients. More the grade of reflux, more severe was the NPL findings. Two patients with Grade II reflux had normal NPL suggesting structural inflammatory changes due to acidic pH of refluxate which have not yet manifested or symptoms could be due to nonacid refluxate. Incidence of esophageal motility disorder was statistically significant in patients with GER disease (GERD). Patients who had symptoms, but no demonstrable GER showed delayed ET in supine position suggesting the presence of esophageal motility disorder even before GERD. Conclusion: GES demonstrated GER in patients presenting with URT symptoms without typical GI symptoms. ETS showed coexistence of esophageal motility disorder in most patients presenting with URT symptoms even without an associated reflux disease. We hypothesize that primary abnormal esophageal motility leads to delayed esophageal clearance and consequently to URT symptoms. Addition of ETS to GES is easily feasible with no significant additional cost, time, or radiation burden. PMID:29430111
International Nuclear Information System (INIS)
Padhy, A.K.; Gopinath, P.G.; Tiwari, D.C.; Gupta, K.; Sharma, S.K.; Prasad, A.K.; Arora, N.K.; Chetty, A.
1990-01-01
Radionuclide gastroesophageal scintigraphy was performed on twentyfive control and one hundred and eightythree children suffering from recurrent lower respiratory tract infection. Gastroesophageal reflux (GER) of varying grades was observed in 135 patients. The severity of clinical symptoms in these patients was found to be directly related to the severity of reflux observed in the radionuclide study. In some patients an attempt was also made to quantitate GER by calculating the Gastrosophageal Reflux Index. The results of the scintigraphic study were correlated with the results of the other commonly used and more convetional barium swallow and fluoroscopy study. Gastrosophageal scintigraphy was found to be much superior in terms of sensitivity, specificity and accuracy in detecting GER. It was also possible to objectively evaluate and monitor response to treatment following conservative or corrective surgical therapy using the radionuclide technique. The results of the present study demonstrated a remarkably high incidence of GER in the patient population studied. Whether GER is the cause of recurrent lower respiratory tract infection or not is difficult to establish firmly. But within the perview of this study the association seems to be very strong and cannot be easily ignored. (author). 26 refs., 5 tabs
International Nuclear Information System (INIS)
Padhy, A.K.; Gopinath, P.G.; Sharma, S.K.; Prasad, A.K.; Arora, N.K.; Tiwari, D.C.; Gupta, K.; Chetty, A.
1990-01-01
Radionuclide gastro-esophageal scintigraphy was performed on 25 control and 183 children suffering from recurrent lower respiratory tract inspection. Gastro-esophageal reflux (GER) of varying grades was observed in 135 patients. The severity of clinical symptoms in the patients was found to be directly related to the severity of reflux observed in the radionuclide study. In some patients an attempt was also made to quantitate GER by calculating the gastro-esophageal reflex index. The results of the scintigraphic study were correlated with the results of the other commonly used and more conventional barium swallow and fluoroscopy study. Gastro-esophageal scintigraphy was found to be much superior in terms of sensitivity, specificity and accuracy in detecting GER. It was also possible to objectively evaluate and monitor response to treatment following conservative or corrective surgical therapy using the radionuclide technique. The results of the study demonstrated a remarkably high incidence of GER in the patients. Whether GER is the cause of recurrent lower respiratory tract infection or not is difficult to establish firmly. But within the perview of the study the association seems to be very strong and cannot be easily ignored. (author). 26 refs., 5 tabs., 4 figs
International Nuclear Information System (INIS)
Rosen, P.R.; Treves, S.
1984-01-01
One hundred twenty-six pediatric patients (0-16 yr of age) with clinically suspected gastroesophageal reflux (GER) were evaluated using radionuclide scintigraphy. Although 46 of the patients (38.3%) had abnormal studies exhibiting evidence of GER, there were no signifcant differences in gastric emptying between patients with and without GER. At 60 min after ingestion, the 76 patients less than 2 yr old had a mean residual of 54%, whereas those over 2 yr of age had a value of 29%. Gastric emptying values may be age-related
Treatment of Post-Stent Gastroesophageal Reflux by Anti-Reflux Z-Stent
International Nuclear Information System (INIS)
Davies, Roger Philip; Kew, Jacqueline; Byrne, Peter D.
2000-01-01
Severe symptoms of heartburn and retrosternal pain consistent with gastro-esophageal reflux (GER) developed in a patient following placement of a conventional self-expanding 16-24-mm-diameter x 12-cm-long esophageal stent across the gastroesophageal junction to treat an obstructing esophageal carcinoma. A second 18-mm-diameter x 10-cm-long esophageal stent with anti-reflux valve was deployed coaxially and reduced symptomatic GER immediately. Improvement was sustained at 4-month follow-up. An anti-reflux stent can be successfully used to treat significant symptomatic GER after conventional stenting
Directory of Open Access Journals (Sweden)
Vinicius Bernardo Silva
2016-06-01
Full Text Available Observa-se o uso crescente de métodos de gerenciamento ágil de projetos nas organizações. Tais métodos têm características próprias, difíceis de serem totalmente compreendidas pelos alunos somente com base em explicações teóricas. Assim, o ensino de métodos ágeis deve ser feito não só por exposição teórica, mas também com demonstração prática. O desafio de ensinar tais métodos aumenta em um ambiente de ensino virtual. O objetivo deste trabalho é propor e avaliar uma atividade em grupos a distância para ensino do método ágil Scrum com foco na elaboração e gerência de histórias de usuário, com o apoio da ferramenta Pivotal Tracker. Como contribuição, destaca-se a disponibilização de um tutorial da ferramenta e outros materiais de apoio, que, segundo alunos, contribuiu positivamente para a realização da atividade. O trabalho também promoveu a identificação de questões comuns dos alunos, que podem orientar professores no planejamento de suas aulas e atividades virtuais.
NCBI nr-aa BLAST: CBRC-MDOM-01-0108 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-01-0108 ref|ZP_04293469.1| Spore germination protein, gerB [Bacillus cere...us AH621] gb|EEK74759.1| Spore germination protein, gerB [Bacillus cereus AH621] ZP_04293469.1 0.85 27% ...
NCBI nr-aa BLAST: CBRC-PMAR-01-0052 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0052 ref|ZP_01186502.1| GerA spore germination protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR74131.1| GerA spore germination protein [Bacillus weihenstephanensis KBAB4] ZP_01186502.1 0.26 25% ...
Between international and local:
DEFF Research Database (Denmark)
Skyggebjerg, Anna Karlskov
2008-01-01
Artiklen beskriver Lene Kaaberbøls fantasy-bøger i skæringsfeltet mellem det internationale og det lokale......Artiklen beskriver Lene Kaaberbøls fantasy-bøger i skæringsfeltet mellem det internationale og det lokale...
Singendonk, Maartje M. J.; Brink, Anna J.; Steutel, Nina F.; van Etten-Jamaludin, Faridi S.; van Wijk, Michiel P.; Benninga, Marc A.; Tabbers, Merit M.
2017-01-01
CONTEXT: Gastroesophageal reflux (GER) is defined as GER disease (GERD) when it leads to troublesome symptoms and/or complications. We hypothesized that definitions and outcome measures in randomized controlled trials (RCTs) on pediatric GERD would be heterogeneous. OBJECTIVES: Systematically assess
DEFF Research Database (Denmark)
Refslund, Bjarke
Det danske arbejdsmarked bliver i stigende grad påvirket af den internationale økonomiske integration. Globaliseringen øger arbejdsgivernes fleksibilitet og øger samtidig konkurrencepresset, hvilket påvirker magtbalancen, som historisk er meget central for det danske arbejdsmarkeds organisering. ...
Directory of Open Access Journals (Sweden)
Emel Çilingir
2016-12-01
Full Text Available The aim of study was to investigate the effects of Realistic Mathematics Education (RME based instruction in the elementary mathematics curriculum on the mathematics achievement, Visual Mathematics Literacy Self Efficiency Perceptions (VMLSP and Mathematics Problem Solving Attitude (MPSA. The study was determined as a quasi-experimental study which conducted as a pre-posttest design with a control group. The research was conducted with 147 students at fourth grade of a public elementary school in Adana. In the study, the experimental group and one of the control group were instructed by one of the researchers, while in other control group was instructed by their teacher. „Geometric Shapes‟ unit was instructed with RME at the experimental group while the current instructional method was conducted to the control groups. The data were obtained with mathematics achievement tests and VMLSP and MPSA Scale which provided goodness according to the confirmatory factor analysis model. The quantitative data was evaluated by using mixed ANOVA and tTest methods. As a result, it was found that the students at the experimental group have more successful in mathematic achievement tests and more progress on VMLSP and MPSA than control group. [Araştırmanın amacı, ilkokulda Gerçekçi Matematik Eğitimi yaklaşımıyla gerçekleştirilen öğretimin, öğrencilerin matematik başarılarına, görsel matematik okuryazarlık özyeterlik algılarına ve matematik problemlerini çözmeye yönelik tutumlarına etkisini incelemektir. Bu amaçla öntest-sontest kontrol gruplu yarı deneysel bir çalışma yapılmıştır. Araştırma, Adana’daki bir devlet ilkokulunun 4. sınıfına giden 147 öğrenci üzerinde gerçekleştirilmiştir. Araştırmada deney grubunda ve iki kontrol grubundan birinde dersler araştırmacı tarafından diğer kontrol grubunda ise sınıfın öğretmeni tarafından yürütülmüştür. Deney grubunda ‘Geometrik Şekiller’
Chen, Yi-Ting; Huang, Yu-Kai; Luvsan, Munkh-Erdene; Gombojav, Enkhjargal; Ochir, Chimedsuren; Bulgan, Jargal; Chan, Chang-Chuan
2015-02-01
Heating indoor living environments elevates air pollution in Ulaanbaatar, Mongolia. This study was conducted to investigate the influence of season and living environment on children's urinary 1-hydroxypyrene (1-OHP) levels in Ulaanbaatar, Mongolia. Our study subjects were 320 children aged 11-15 years living in gers, brick houses and apartments, in ger and non-ger areas of Ulaanbaatar. Spot urine samples and questionnaires were collected three times from each subject in three seasons, September (warm) and December (cold) in 2011 and March (moderate) in 2012. Urinary 1-OHP was analyzed by high-performance liquid chromatography with fluorescent detection (HPLC/FLD). Generalized estimating equation (GEE) models were applied to estimate the seasonal and residential effects on 1-OHP levels, adjusting for demographic and environmental factors. Children's urinary 1-OHP levels showed significant seasonal differences with 0.30 ± 0.57 μmol/mol creatinine in cold season, 0.14 ± 0.12 μmol/mol creatinine in moderate season, and 0.14 ± 0.21 μmol/mol creatinine in warm season. After controlling confounding factors, the GEE model showed that season, living area, and housing type had significant influence on children's urinary 1-OHP levels. Urinary 1-OHP levels in the cold and moderate seasons were, respectively 2.13 and 1.37 times higher than the warm season. Urinary 1-OHP levels for children living in ger areas were 1.27 times higher than those living in non-ger areas. Children who lived in gers or brick houses had 1.58 and 1.34 times higher 1-OHP levels, respectively, compared with those living in apartments. Children's urinary 1-OHP levels were associated with either estimated NO2 or SO2 concentrations at their home addresses in Ulaanbaatar. Mongolian children's urinary 1-OHP levels were significantly elevated during the cold season, and for those living in ger areas, gers, or brick houses in Ulaanbaatar. Children's urinary 1-OHP levels were associated PAH co
Gastroesophageal Reflux Symptoms in Patients with Chronic Obstructive Pulmonary Disease
Directory of Open Access Journals (Sweden)
Zlatica Goseva
2014-09-01
CONCLUSION: GER symptoms are more prevalent in patients with severe airways obstruction when compared to less airways obstructed group and controls. We could suggest an association between the degree of airways obstruction in patients with COPD and the increased rate of GER symptoms.
An updated review on gastro-esophageal reflux in pediatrics.
Vandenplas, Yvan; Hauser, Bruno
2015-01-01
Comprehensive guidelines for the diagnosis and management of gastro-esophageal reflux (GER) and GER disease (GERD) were developed by the European and North American Societies for Pediatric Gastroenterology, Hepatology and Nutrition. GERD is reflux associated with troublesome symptoms or complications. The recognition of GER and GERD is relevant to implement best management practices. A conservative management is indicated in infants with uncomplicated physiologic reflux. Children with GERD may benefit from further evaluation and treatment. Since the publications of the European and North American Societies for Pediatric Gastroenterology, Hepatology and Nutrition guidelines in 2009, no important novelties in drug treatment have been reported. Innovations are mainly restricted to the management of regurgitation in infants. During the last 5 years, pros and cons of multichannel intraluminal impedance have been highlighted. However, overall 'not much has changed' in the diagnosis and management of GER and GERD in infants and children.
A Clostridium difficile-Specific, Gel-Forming Protein Required for Optimal Spore Germination
Directory of Open Access Journals (Sweden)
M. Lauren Donnelly
2017-01-01
Full Text Available Clostridium difficile is a Gram-positive spore-forming obligate anaerobe that is a leading cause of antibiotic-associated diarrhea worldwide. In order for C. difficile to initiate infection, its aerotolerant spore form must germinate in the gut of mammalian hosts. While almost all spore-forming organisms use transmembrane germinant receptors to trigger germination, C. difficile uses the pseudoprotease CspC to sense bile salt germinants. CspC activates the related subtilisin-like protease CspB, which then proteolytically activates the cortex hydrolase SleC. Activated SleC degrades the protective spore cortex layer, a step that is essential for germination to proceed. Since CspC incorporation into spores also depends on CspA, a related pseudoprotease domain, Csp family proteins play a critical role in germination. However, how Csps are incorporated into spores remains unknown. In this study, we demonstrate that incorporation of the CspC, CspB, and CspA germination regulators into spores depends on CD0311 (renamed GerG, a previously uncharacterized hypothetical protein. The reduced levels of Csps in gerG spores correlate with reduced responsiveness to bile salt germinants and increased germination heterogeneity in single-spore germination assays. Interestingly, asparagine-rich repeat sequences in GerG’s central region facilitate spontaneous gel formation in vitro even though they are dispensable for GerG-mediated control of germination. Since GerG is found exclusively in C. difficile, our results suggest that exploiting GerG function could represent a promising avenue for developing C. difficile-specific anti-infective therapies.
What are reflux (GER) and GERD? The esophagus is the tube that carries food from your mouth to your stomach. If your child has reflux, his or ... into the esophagus. Another name for reflux is gastroesophageal reflux (GER). GERD stands for gastroesophageal reflux disease. It ...
What are reflux (GER) and GERD? The esophagus is the tube that carries food from your mouth to your stomach. If your baby has reflux, his or ... into the esophagus. Another name for reflux is gastroesophageal reflux (GER). GERD stands for gastroesophageal reflux disease. It ...
Omari, Taher I.; Benninga, Marc A.; Sansom, Lloyd; Butler, Ross N.; Dent, John; Davidson, Geoffrey P.
2006-01-01
OBJECTIVE: To evaluate the effect of baclofen, a gamma-amino-butyric-acid B receptor agonist that inhibits transient lower esophageal sphincter relaxation (TLESR), on the rates of TLESR, gastroesophageal reflux (GER), and gastric emptying (GE) in children with GER disease. STUDY DESIGN: The efficacy
Resistance to and killing by the sporicidal microbicide peracetic acid.
Leggett, Mark J; Schwarz, J Spencer; Burke, Peter A; Mcdonnell, Gerald; Denyer, Stephen P; Maillard, Jean-Yves
2015-03-01
To elucidate the mechanisms of spore resistance to and killing by the oxidizing microbicide peracetic acid (PAA). Mutants of Bacillus subtilis lacking specific spore structures were used to identify resistance properties in spores and to understand the mechanism of action of PAA. We also assessed the effect of PAA treatment on a number of spore properties including heat tolerance, membrane integrity and germination. The spore coat is essential for spore PAA resistance as spores with defective coats were greatly sensitized to PAA treatment. Small acid-soluble spore proteins apparently provide no protection against PAA. Defects in spore germination, specifically in germination via the GerB and GerK but not the GerA germination receptors, as well as leakage of internal components suggest that PAA is active at the spore inner membrane. It is therefore likely that the inner membrane is the major site of PAA's sporicidal activity. PAA treatment targets the spore membrane, with some of its activity directed specifically against the GerB and GerK germination receptors. © The Author 2014. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Dzhulay, G S; Sekareva, E V
2016-01-01
To estimate esophageal and gastric pH values on an empty stomach and after stimulation of gastric secretion and gastric and duodenal motor-evacuatory activity in patients with gastroesophageal reflux disease (GERD) associated with pathological refluxes, such as gastroesophageal reflux (GER) and duodenogastroesophageal reflux (DGER). The observational cross-sectional study was conducted to investigate and compare the parameters of intraesophageal and intragastric pH metry and peripheral electrogastroenterography in 103 GERD patients with endoscopically positive distal reflux esophagitis in GER and DGER. The patients with GERD developed pathological esophageal refluxes (both GER and DGER) in various degrees of impaired gastric production, from anacidity to hyperacidity. The patients with predominant DGER were found to have gastric hyperacidity and normal acidity slightly less frequently than those with predominant GER. The patients with GERD developing in the presence of predominant GER had moderate gastric stasis with discoordinated antroduodenal propulsion resulting from hypomotor dyskinesia of the stomach and duodenum. When DGER was predominant in the patients with GERD, the signs of gastric stasis and duodenal hyperkinesia were concurrent with discoordinated antroduodenal and duodenojejunal propulsion. The specific features of the esophagogastroduodenal secretory and motor evacuatory disorders found create conditions for the pathological refluxes into the esophagus, which differ in the composition of refluxate.
DEFF Research Database (Denmark)
Jensen, Niels Rosendal
2015-01-01
De to bøger (Malcolm Carey resp. Bruve A. Thyer) præsenteres i oversigtsform, og begge kan anvendes som håndbøger i kvalitativ forskning, hvor især Thyers tilgang til quasi-eksperimentelle forskningsdesign synes at udfylde et hul i dansk faglitteratur...
DEFF Research Database (Denmark)
Duedahl, Poul
I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J.C...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....
Gastroesophageal reflux and lung disease.
Meyer, Keith C
2015-08-01
Gastroesophageal reflux (GER) can cause respiratory symptoms and may trigger, drive and/or worsen airway disorders, interstitial lung diseases and lung allograft dysfunction. Whether lifestyle changes and acid suppression alone can counter and prevent the adverse effects of GER on the respiratory tract remains unclear. Recent data suggest that antireflux surgery may be more effective in preventing lung disease progression in patients with idiopathic pulmonary fibrosis or lung transplant recipients who have evidence of allograft dysfunction associated with the presence of excessive GER. Additional research and clinical trials are needed to determine the role of GER in various lung disorders and identify which interventions are most efficacious in preventing the respiratory consequences of gastroesophageal reflux disease. In addition, measuring biomarkers that indicate that gastric refluxate has been aspirated into the lower respiratory tract (e.g., pepsin and bile acid concentrations in bronchoalveolar lavage fluid) may prove helpful in both diagnosis and therapeutic decision making.
A case of congenital myopathy masquerading as paroxysmal dyskinesia
Directory of Open Access Journals (Sweden)
Harsh Patel
2014-01-01
Full Text Available Gastroesophageal reflux (GER disease is a significant comorbidity of neuromuscular disorders. It may present as paroxysmal dyskinesia, an entity known as Sandifer syndrome. A 6-week-old neonate presented with very frequent paroxysms of generalized stiffening and opisthotonic posture since day 22 of life. These were initially diagnosed as seizures and he was started on multiple antiepileptics which did not show any response. After a normal video electroencephalogram (VEEG was documented, possibility of dyskinesia was kept. However, when he did not respond to symptomatic therapy, Sandifer syndrome was thought of and GER scan was done, which revealed severe GER. After his symptoms got reduced to some extent, a detailed clinical examination revealed abnormal facies with flaccid quadriparesis. Muscle biopsy confirmed the diagnosis of a specific congenital myopathy. On antireflux measures, those episodic paroxysms reduced to some extent. Partial response to therapy in GER should prompt search for an underlying secondary etiology.
Correlation of gastroesophageal reflex with aspiration pneumonia after surgery
International Nuclear Information System (INIS)
Hirashima, Tokuji; Hashimoto, Hajime; Noro, Toshio; Takahashi, Tadao; Hino, Yasunori; Kuroiwa, Kouzirou
1996-01-01
In order to elucidate the correlation of gastroesophageal reflex (GER) with aspiration pneumonia after surgery, 48 patients (mean, 75.6 years) with gastric cancer treated at the hospital from March, 1994 to December, 1994 were subjected to this prospective study. The pharyngeal stimulation test, nutritional assessment, radionuclide esophageal scintigraphy (34 cases) were performed before surgery and relationship between those results and aspiration pneumonia were studied. Aspiration pneumonia occurred in 3 cases, and all of them were in, significantly, poor nutritional status, compared with other. A significant increase in the frequency of GER was observed when a naso-gastric tube (NGT) was placed, but surprisingly, all the patients with aspiration pneumonia were 3 out of 4 patients who had continuous GER without NGT. It is noteworthy, continuous GER without NGT was significantly (p<0.001) affected postoperative aspiration pneumonia and impaired phalyngeal reflex was frequently correlated with development of aspiration pneumonia, when malnutritional status existed. (author)
Hiatial hernia in gastroesophageal reflux disease
Energy Technology Data Exchange (ETDEWEB)
Kaul, B.; Petersen, H.; Myrvold, H.E.; Grette, K.; Roeysland, P.; Halvorsen, T.
1986-01-01
Upper gastrointestinal endoscopy and radiologic examination were performed in 101 patients with symptoms strongly suggestive of gastroesophageal reflux (GER) disease. Hiatus hernia (HH) was found in 50 patients diagnosed by radiography or endoscopy, or both, in 22, 19, and 9 patients respectively. Severe endoscopic esophagitis (grades III and IV) was found more often in the patients with HH than in those without. The same was true for the early positive timed acid perfusion tests. Furthermore, the patients with HH more often had reflux by the standard acid reflux test (42 og 50 versus 28 of 51, gastroesophageal scintigraphy (47 of 50 versus 40 of 51; and radiography (20 of 50 versus 2 of 51; than the patients without HH. The results show that severe GER disease can occur without an associated HH and indicate that patients with symptoms of GER disease and associated HH are likely to have a more severe GER disease than those without HH.
DEFF Research Database (Denmark)
Nielsen, Sandro
2003-01-01
Many reviews of dictionaries are exercises in linguistics instead of exercises in lexicography. This paper aims to establish a framework for the review of dictionaries with the focus on the dictionary as a subject of investigation. There are three approaches to reviewing a dictionary, namely...... the lexicographic, the factual and the linguistic. These approaches should be combined with the three significant features of the dictionary: its lexicographic potential, its lexicographic data and its lexicographic structures. For this purpose the reviewer's matrix is introduced, and the use of reviewer teams...... is suggested. It is a fundamental requirement that a dictionary review gives a true and fair view of the dictionary. This is only possible if the aspects addressed in the review are relevant and material, if the criticism is reliable, and if the reviewer treats the dictionary, its lexicographers and publishers...
DEFF Research Database (Denmark)
Hougaard, Jens Leth; Kolind, Jacob Michelsen; Østerdal, Lars Peter
by lottery, the National Board of Health takes into account only the candidates preferences over the various internships, for reasons discussed in the paper. However, a problem, relating to the lottery which the NBH uses, is that the lottery itself is not efficient in an economic sense. By way of simulations......A medical internship is mandatory for all medical students graduating from a Danish university. The internships are distributed fairly even amongst most Danish hospitals, m.a. in order to secure a steady inflow of new doctors to all regions of Denmark. When allocating the graduates to an internship...
Directory of Open Access Journals (Sweden)
Jacques Lévy
2003-01-01
Full Text Available Les chercheurs de l'équipe Mit (Mobilités Itinéraires Territoires, dirigée par Rémy Knafou, nous ont récemment livré le premier tome d'un travail à double détente sur le tourisme. C'est un livre collectif mais très cohérent, roboratif, souvent drôle, toujours écrit avec force, la titraille représentant un résumé justement accrocheur et incitant à la réflexion : le sous-titre, déjà, « Lieux communs », exprime la tension entre tourisme de masse et ...
African Journals Online (AJOL)
developments of geriatric medicine in the medical schools and hospitals of Europe .... including physical, mental, social, economic, functional and environmental .... occupational therapy and speech therapy has grown over the years, further ...
DEFF Research Database (Denmark)
Møller, Bernt Carsten
1999-01-01
The present article focuses on "the dictionary selector" as opposed to the dictionary user. It briefly discusses the notion of quality in relation to the assumed needs of the selector. Inspired by the principle and practice of Informative Labelling, the insertion on the back of the dictionary of ...... of a "User´s Guide" is recommended. The required items of information of the User´s Guide as well as their presentation are discussed....
Alcohol and drug use among Danish physicians. A nationwide cross-sectional study in 2014
DEFF Research Database (Denmark)
Sørensen, Johanne Korsdal; Pedersen, Anette Fischer; Bruun, Niels Henrik
2015-01-01
Dette studie undersøger danske lægers forbrug af alkohol og stoffer/medicin [substansforbrug], herunder deres selv-rapporterede bedømmelse af eget forbrug og håndtering af lægefaglige kollegers substansforbrug. Resultaterne viser, at 19 procent af deltagerne har et ”risikobetonet” (potentielt ska...
Supply Chain Management som interaktionel praksis
DEFF Research Database (Denmark)
Smith, Leo Feddersen; Lund, Anders
2016-01-01
I dette bidrag undersøger vi Supply Chain Management som en interaktionel praksis forankret i kommunikation. Med udgangspunkt i e-mail korrespondancer undersøger vi, hvordan køber-leverandør forholdet kommunikativt konstitueres mellem to danske SMVer og deres kinesiske leverandører. Det...
Aktionslæring og Aktionsforskning
DEFF Research Database (Denmark)
Rask, Morten
2004-01-01
Denne artikel undersøger underviserens og de studerendes erfaringer med en kursusform, som forsøger at koble aktionsforskning og undervisning. Hensigten er at vise, hvorledes de studerendes, underviserens og virksomhedens reflektionsrum øges, når denne kursusform er i anvendelse. Formålet er at s...
DEFF Research Database (Denmark)
Andersen, Christian Ulrik
2006-01-01
Spacewar fra 1962 undersøger afhandlingen computerspillets dannelsesper-spektiv og belyser, hvordan computerspillet som underholdningsfænomen kan tillade brugeren ikke blot at vænne sig til, men også kritisk reflektere en kulturel forandring forårsaget af computeren. Afhandlingens anden del undersøger...
DEFF Research Database (Denmark)
Kaarsted, Thomas
2009-01-01
Digital Natives, Google Generationen, Dot Net-generationen. Mens forskerne søger efter den rigtige term søger bibliotekerne at lægge strategier for fremtiden. Et bredt anlagt forskningsprojekt giver et bud på udviklingen og har en udløber til forskningsbibliotekerne. Kritikerne mener projektet...
Grammatik in bilingualen Wörterbüchern
DEFF Research Database (Denmark)
Bergenholtz, Henning
1995-01-01
Almensproglige ordbøger indeholder - i modsætning til fagordbøger - traditionelt mange grammatiske oplysninger. De er dog ikke altid indarbejdet optimalt. Der kan dels foreslås mere hensigtsmæssige leksikografiske koncepter, dels er de foreliggende grammatiske informationer ikke sjældent unøjagtige...
DEFF Research Database (Denmark)
Loots, Clara M; van Wijk, Michiel P; Blondeau, Kathleen
2011-01-01
of gastroesophageal reflux (GER) episodes was compared between observers and AA. Intraobserver agreement was assessed in 3 observers after 3 to 5 months. RESULTS: Overall, 1242 liquid and mixed GER events were detected, 490 (42%) were scored by the majority of observers, yielding moderate agreement (Cohen's kappa [κ...
Münster, M; Kook, P; Araujo, R; Hörauf, A; Vieth, M
2015-01-01
It was hypothesized that typical characteristics of hyperregeneratory esophagopathy (HRE) in humans such as basal cell hyperplasia and elongation of stromal papillae are also histologically detectable in canine esophageal epithelium, and that these changes are associated with clinical signs and endoscopic findings suggesting gastroesophageal reflux (GER). Sixty-five adult dogs with clinical signs attributable to esophageal disease underwent esophagoscopy and biopsy. Clinical signs suggesting GER (regurgitation, ptyalism, painful discomfort) were prospectively evaluated through a questionnaire. Endoscopic mucosal alterations suggesting GER such as minimal endoscopic changes and obvious mucosal defects were assessed via video endoscopy. Biopsy specimens obtained from the esophageal squamous epithelium were evaluated histologically. The squamous epithelium's substructures of esophageal biopsies were quantitatively assessed through microscopic morphometry. Esophageal squamous epithelium was considered normal in 48 dogs, and HRE was detected histologically in 17 dogs; both pathognomonic changes (basal cell hyperplasia, elongation of stromal papillae) were consistently present. Morphometrically assessed stromal papillary length and basal cell layer thickness was significantly (each, p HRE than in the 48 dogs without HRE, respectively. Overall, clinical signs suggesting GER were significantly (p = 0.02) more frequently encountered and regurgitation was significantly (p = 0.009) more common in the 17 dogs with HRE than in the 48 dogs without HRE. Similarly, endoscopic changes were significantly (p = 0.002) more frequently observed and minimal endoscopic changes suggesting GER were significantly (p = 0.004) more common in 17 dogs with HRE than in the 48 dogs without HRE. Typical characteristics of hyperregeneratory esophagopathy in humans are also histologically detectable in canine esophageal epithelium. Histological changes are associated with clinical signs and
Does CPAP treatment lead to gastroesophageal reflux in patients with moderate and severe OSA?
Ozcelik, Hatice; Kayar, Yusuf; Danalioglu, Ahmet; Arabaci, Elif; Uysal, Omer; Yakar, Fatih; Kart, Levent
2017-03-01
Obstructive sleep apnea (OSA) leads to upper respiratory tract obstruction, causing increased abdominal-gastric pressure and decreased lower esophageal sphincter (LES) pressure and thus gastroesophageal reflux (GER). Continuous positive airway pressure (CPAP) is known to be an effective method for OSA treatment, but its effect on GER is still controversial. There are a very few studies investigating CPAP and GER relationship and performed based on pre- and post-treatment objective parameters of GER in patients with OSA. The study investigated the effect of CPAP treatment in patients with moderate and severe OSA without GER complaints on pre- and post-treatment objective GER parameters. The study included 25 patients with respiratory disturbance indices >15 without reflux symptoms who had undergone polysomnography at sleep laboratory. Age, sex, body mass index (BMI), waist, and neck circumference of the patients were documented. DeMeester score, LES pressure, and polysomnography parameters were evaluated pre- and post-CPAP. The results were statistically evaluated, and p value CPAP phase, mean sphincter pressure was 22.2 ± 1.2 (range 8-73), and mean DeMeester score was 18 ± 15.5 (range 0.2-57). At the post-CPAP, mean sphincter pressure was 22.9 ± 1.6 (range 9-95), and mean DeMeester score was 16.3 ± 14.8 (range 0.2-55). No significant difference (p > 0.05) was found comparing pre-CPAP and post-CPAP measurements. Objective criteria show that CPAP treatment does not cause reflux in patients with OSA. Unlike studies reported in the literature, this conclusion has been reached by pre- and post-CPAP assessments.
Izawa, Shinya; Funaki, Yasushi; Iida, Akihito; Tokudome, Kentaro; Tamura, Yasuhiro; Ogasawara, Naotaka; Sasaki, Makoto; Kasugai, Kunio
2014-01-01
The symptom improvement rate is low with proton pump inhibitors (PPIs) in nonerosive reflux disease (NERD). The underlying pathogenic mechanism is complex. Esophageal motility disorders (EMDs) are thought to be a factor, but their prevalence, type, symptoms and the role played by gastroesophageal reflux (GER) in symptom onset have not been fully investigated. To investigate the role of GER in symptom onset in PPI-refractory NERD patients with EMDs. This study comprised 76 patients with PPI-refractory NERD. Manometry was performed during PPI treatment and patients were divided into an EMD group and normal motility (non-EMD) group. Then, multichannel intraluminal impedance-pH monitoring was performed and medical interviews were conducted. Nineteen patients (25%) had an EMD. Data were compared between 17 patients, excluding 2 with achalasia and 57 non-EMD patients. No significant differences were observed between groups in 24-hour intraesophageal pH <4 holding time (HT), mean number of GER episodes or mean number of proximal reflux episodes. The reflux-related symptom index (≥50%) showed a relationship between reflux and symptoms in 70.5% of EMD patients and 75% of non-EMD patients. In the EMD group, the score for FSSG (Frequency Scale for the Symptoms of GERD) question (Q)10 was significantly correlated with the number of GER episodes (r = 0.58, p = 0.02) and the number of proximal reflux episodes (r = 0.63, p = 0.02). In addition, the score for Q9 tended to be correlated with the number of GER episodes (r = 0.44, p = 0.06). Our results suggest that some PPI-refractory NERD patients have EMDs, and that GER plays a role in symptom onset.
Jung, Woo Jin; Yang, Hyeon Jong; Min, Taek Ki; Jeon, You Hoon; Lee, Hae Won; Lee, Jun Sung; Pyun, Bok Yang
2012-01-01
Gastro-esophageal reflux (GER), particularly non-acid reflux, is common in infants and is a known cause of chronic respiratory symptoms in infancy. Recent guidelines recommended empirical acid suppression therapy and the head-up position in patients with suspected GER. However, the efficacy of the upright position in relieving GER and reflux-related respiratory symptoms in infants is unclear. We conducted this study to investigate the efficacy of the upright position on GER and reflux-related respiratory symptoms in infants with chronic respiratory symptoms. Thirty-two infants (21 male; median age, 5 months; range, 0 to 19 months) with unexplained chronic respiratory symptoms underwent multi-channel intraluminal esophageal impedance and pH monitoring. We retrospectively compared the frequencies of GER and reflux-related symptoms according to body position. A mean of 3.30 episodes of reflux per hour was detected. Overall, refluxes were more frequent during the postprandial period than the emptying period (3.77 vs. 2.79 episodes/hour, respectively; P=0.01). Although there was no significant difference in the total refluxes per hour between the upright and recumbent positions (6.12 vs. 3.77 episodes, P=0.10), reflux-related respiratory symptoms per reflux were significantly fewer in infants kept in an upright position than in a recumbent position during the postprandial period (3.07% vs. 14.75%, P=0.016). Non-acid reflux was the predominant type of reflux in infants, regardless of body position or meal time. The upright position may reduce reflux-related respiratory symptoms, rather than reflux frequency. Thus, it may be a useful non-pharmacological treatment for infantile GER disease resistant to acid suppressants.
Gastroesophageal reflux and gastric emptying
International Nuclear Information System (INIS)
Rosen, P.; Treves, S.T.
1985-01-01
Gastroesophageal reflux (GER) may be defined as a dysfunction of the distal esophagus causing return of gastric contents into the esophagus. GER is a rather common problem during infancy, with an incidence estimated as 1 in 500 infants. Several methods are available to diagnose and quantitate GER. These include fluoroscopy after barium feedings, in conjunction with an upper gastrointestinal series; esophageal manometry; endoscopy; pH probe monitoring, in conjunction with a Tuttle Test; and extended pH probe evaluation for a 24-h period. Gastroesophageal scintigraphy has been advocated as an alternative noninvasive study requiring no sedation. Scintigraphy offers the advantages of prolonged observation, high sensitivity, and low radiation exposure
Analysis of the static yield stress for giant electrorheological fluids
Seo, Youngwook P.; Choi, Hyoung Jin; Seo, Yongsok
2017-08-01
Cheng et al. (2010)'s experimental results for the static yield stress of giant electrorheological (GER) fluids over the full range of electric field strengths were reanalyzed by applying Seo's scaling function which could include both the polarization and the conductivity models. The Seo's scaling function could correctly fit the yield stress behavior of GER suspensions behavior after if a proper normalization of the yield stress data was taken which collapse them onto a single curve. The model predictions were also contrasted with recently proposed Choi et al.'s scaling function to rouse the attention for a proper consideration of the GER fluid mechanisms.
Directory of Open Access Journals (Sweden)
Érica Torres
2011-12-01
Full Text Available Trata-se de estudo de natureza qualitativa, do tipo estudo de caso único, em que se adotou uma triangulação de técnicas para obtenção dos dados (questionário estruturado, observação sistemática e análise documental e análise de conteúdo segundo Bardin para análise. Objetivou-se verificar se os enfermeiros do Serviço de Infectologia de um hospital universitário consideram a Sistematização da Assistência de Enfermagem (SAE uma ferramenta da gerência do cuidado e analisar se a SAE, enquanto ferramenta gerencial, serve de base para suas ações de cuidar. Identificou-se que os sujeitos compreendem o que é SAE e a gerência do cuidado e enxergam uma relação entre as duas. Ficou demonstrada uma lacuna entre o que é dito e o que é praticado. Não se pode considerar que a SAE, enquanto ferramenta gerencial, serve de base para o cuidado. Recomendam-se estratégias que possibilitariam um feedback às gerências dos serviços de enfermagem sobre estes aspectos.Se trata de un estudio de naturaleza cualitativa, de caso único, en el cual se adoptó una triangulación de técnicas para la recolección de datos (cuestionario estructurado, observación sistemática y análisis de documentos y análisis de contenido según Bardin. El objetivo fue determinar si el personal de enfermería del sector de enfermedades infecciosas de un hospital universitario considera la Sistematización de la Asistencia de Enfermería (SAE como herramienta para la gerencia del cuidado y examinar si la SAE, como instrumento de gestión, proporciona la base para sus acciones de cuidado. Se ha identificado que los sujetos comprenden qué es SAE y qué es gerencia del cuidado y que entienden una relación entre ambos. Se demostró una diferencia entre lo que se dice y lo que se practica. No se puede considerar que la SAE como instrumento de gestión proporcione la base para su cuidado. Se recomiendan estrategias que permitan a las gerencias obtener un feedback
DEFF Research Database (Denmark)
Elling, Rasmus Christian
2009-01-01
Review Article. I artiklen anmeldes fem nye bøger om Irans præsident Ahmadinejad og om den Islamiske Republiks atomprogram. Udgivelsesdato: 1/10......Review Article. I artiklen anmeldes fem nye bøger om Irans præsident Ahmadinejad og om den Islamiske Republiks atomprogram. Udgivelsesdato: 1/10...
IT-baseret fagleksikografi: Nye perspektiver
DEFF Research Database (Denmark)
Laursen, Anne Lise; Duvå, Grete
2003-01-01
IT-baseret fagleksikografi: nye perspektiver For leksikografer vil der altid være områder, der ikke kan behandles tilfredsstillende inden for den traditionelle ordbogs snævre rammer. Elektroniske versioner af forskellige håndbøger, herunder ordbøger, åbner imidlertid for helt nye muligheder, idet...
Kulturel liminalitet i Don Quixote
DEFF Research Database (Denmark)
Fastrup, Anne
2007-01-01
Med udgangspunkt i og i kontrast til nogle af hovedlinierne i den nyere litteratur om Don Quixote søger artiklen tilbage til de mere specifikke og lokale historiske forhold, som er romanens baggrund, bl.a. til Cervantes' »algierske erfaring« med tyrkisk fangenskab. Artiklen forsøger at kombinere ...
Study Design and Data Gathering Guide for Serious Games’ Evaluation
Baalsrud Hauge, Jannicke; Boyle, Elizabeth; Mayer, Igor; Nadolski, Rob; Riedel, Johann C. K. H.; Moreno-Ger, Pablo; Bellotti, Francesco; Lim, Theodore; Ritchie, James
2013-01-01
Baalsrud Hauge, J., Boyle, E., Mayer, I., Nadolski, R. J., Riedel, J. C. K. H., Moreno-Ger, P., Bellotti, F., Lim, T., & Ritchie, J. (2013). Study Design and Data Gathering Guide for Serious Games’ Evaluation. In T. M. Connolly, T. Hainey, E. Boyle, G. Baxter, & P. Moreno-Ger (Eds.), Psychology,
Barrierer for tidlig opsporing af alkoholproblemer i børnefamilier
DEFF Research Database (Denmark)
Niss, Nete Krogsgaard; Kierkgaard, Anemone; Højen-Sørensen, Anna-Katharina
Rapporten undersøger, hvilke barrierer der er medvirkende til, at børn i familier med alkoholproblemer ikke opspores tidligere og hyppigere af fx pædagoger, skolelærere, sundhedsplejersker, jordemødre og praktiserende læger. Alkoholproblemer er en kompleks problemstilling med mange gråzoner, som ...
DEFF Research Database (Denmark)
Grumsen, Stine Slot
Afhandlingen udfordrer den måde hvorpå amerikansk tandlægehistorie bliver studeret, skrevet og anvendt ved at revidere en række problematiske narrativer, der er blevet ukritisk genfortalt indenfor dette felt. Afhandlingen undersøger, hvordan amerikanske tandlæger i begyndelsen af det tyvende århu...
DEFF Research Database (Denmark)
Toftegaard, Berit; Bro, Flemming; Vedsted, Peter
2014-01-01
Alment praktiserende læger spiller en nøglerolle for tidlig diagnostik af kræft. Denne artikel beskriver en intervention i form af efteruddannelse af alment praktiserende læger i tidlig diagnostik af kræft. Artiklen beskriver identifikation af barrierer i almen praksis for tidlig diagnostik af...
Læringsfremmende evaluering i den lægelige videreuddannelse
DEFF Research Database (Denmark)
Madsen, Bjørn; Klitmøller, Anders
2011-01-01
Denne statusartikel omhandler evaluering af læger, og hvorledes evaluering kan anvendes som en læringsfremmende foranstaltning. Fokus i artiklen er på den formelle evaluering, som den kommer til udtryk i de kliniske vejledersamtaler. Da de fleste læger i deres karriere fungerer som vejleder, er d...
DEFF Research Database (Denmark)
Böss, Michael
2009-01-01
Om religion og modernitet med henvisning til bøger af Karen Armstrong, Hans Jørgen Schanz og Marcel Proust. Udgivelsesdato: 26. december 2009......Om religion og modernitet med henvisning til bøger af Karen Armstrong, Hans Jørgen Schanz og Marcel Proust. Udgivelsesdato: 26. december 2009...
Mathai, Ss; Datta, Karuna; Adhikari, Km
2012-01-01
Nasal modes of respiratory support cause variable amounts of gastric dilatation which may increase gastro-oesophageal reflux (GER) in preterms. To compare the incidence of GER in nasally ventilated, preterm babies with controls (babies not on ventilation). A prospective, observational comparative study. Twenty-three preterm babies of gestational age 28-36 weeks and weight ranging between 1,000 g and Reflux index (RI) was calculated as the percentage of study time the lower oesophageal pH was reflux with symptoms if any. Numerical data were shown as mean with standard deviation and statistical comparisons were done using the χ(2)-test, Fischer test, and t-test wherever applicable. The RI was higher in ventilated babies as compared to the control group, particularly in the subgroup A, where test babies formed their own controls. Grade IV reflux (7 cases) was seen only in the ventilated babies. There was no difference in the incidence of GER in babies on nCPAP as compared with nIPPV. Grade IV reflux could not be reliably predicted by RI alone. No definite temporal relation between episodes of reflux and symptoms could be determined in this study. There is an increase in GER in preterms on nasal modes of ventilation. A combination of upper (pharyngeal) and lower oesophageal sensors are preferred to a single lower oesophageal sensor when assessing GER by oesophageal pHmetry in neonates.
Private Computer in der Schule: Zwischen schulischer Infrastruktur und Schulentwicklung
Directory of Open Access Journals (Sweden)
Mandy Schiefner-Rohs
2013-04-01
Full Text Available Der vorliegende Artikel diskutiert die Implikationen eines schulischen IT-Konzepts, das darauf basiert, dass die Schülerinnen und Schüler explizit von der Schule aufgefordert werden, ihre privaten Geräte mit in den Unterricht zu bringen (Bring your own devices, BYOD. In einer Fallstudie wurden schulische Akteure einer Gymnasialklasse in Deutschland gefragt, wie sich die Nutzung privater Geräte von Schülerinnen und Schüler im Unterricht, zu der sich die Klasse gemeinsam entschieden hat, auswirkt. Untersucht werden sollte, ob sich dabei Unterschiede zu bisherigen Ansätzen einer 1:1-Ausstattung an Schulen zeigen, bei denen jede Schülerin und jeder Schüler ein Gerät (i. d. Regel Laptop nutzt, das von der Schule organisiert und administriert wird. Als ein Ergebnis dieser Fallstudie kann festgehalten werden, dass von den Befragten keine inhaltlichen oder didaktischen Unterschiede zwischen der Nutzung privater Geräte und einer 1:1-Ausstattung mit schulisch organisierten Laptops wahrgenommen werden. Es zeigt sich vielmehr, dass organisatorische Prozesse bei der Integration digitaler Medien in Schulen erleichtert werden: Der Gerätesupport ist nicht mehr in dem bisherigen Umfang erforderlich, Ressourcen werden frei, um Fokus auf den didaktischen Einsatz digitaler Medien im Unterricht zu legen. Implikationen dieser Weiterentwicklung schulischer Infrastruktur werden vorgestellt und in Diskussionen um mediengestützte Schulentwicklung eingebettet.
Directory of Open Access Journals (Sweden)
Djamal-Dine Djeddi
Full Text Available BACKGROUND: It has been suggested that disturbed activity of the autonomic nervous system is one of the factors involved in gastroesophageal reflux (GER in adults. We sought to establish whether transient ANS dysfunction (as assessed by heart rate variability is associated with the occurrence of GER events in neonates during sleep and wakefulness. METHODS: Nineteen neonates with suspected GER underwent simultaneous, synchronized 12-hour polysomnography and esophageal multichannel impedance-pH monitoring. We compared changes in HRV parameters during three types of periods (control and prior to and during reflux with respect to the vigilance state. RESULTS: The vigilance state influenced the distribution of GER events (P<0.001, with 53.4% observed during wakefulness, 37.6% observed during active sleep and only 9% observed during quiet sleep. A significant increase in the sympathovagal ratio (+32%, P=0.013 was observed in the period immediately prior to reflux (due to a 15% reduction in parasympathetic activity (P=0.017, relative to the control period. This phenomenon was observed during both wakefulness and active sleep. CONCLUSION: Our results showed that GER events were preceded by a vigilance-state-independent decrease in parasympathetic tone. This suggests that a pre-reflux change in ANS activity is one of the factors contributing to the mechanism of reflux in neonates.
Altered gastric emptying in patients with irritable bowel syndrome
International Nuclear Information System (INIS)
Caballero-Plasencia, A.M.; Valenzuela-Barranco, M.; Herrerias-Gutierrez, J.M.; Esteban-Carretero, J.M.
1999-01-01
Irritable bowel syndrome is the most frequent functional disorder of the digestive system. Patients with irritable bowel syndrome have motor disorders not only in the colon, but also in other parts of the digestive tract such as the oesophagus and small intestine; however, it is not known whether the stomach is also involved. We used a radiolabelled mixed solid-liquid meal (technetium-99m for the solid component, indium-111 for the liquid component) to study gastric emptying of solids (GES), liquids (GEL) and indigestible solids (GER) in 50 patients diagnosed as having irritable bowel syndrome (30 with predominant constipation and 20 with predominant diarrhoea). GER was measured by counting the number of indigestible solids remaining in the stomach 4 h after they were swallowed. In patients with irritable bowel syndrome, GES and GEL were slower than in control subjects (P<0.05). GER was normal in all patients except for two women. Thirty-two patients (64%) showed delayed GES, 29 (58%) delayed GEL, and 2 (4%) delayed GER. Among patients with irritable bowel syndrome, GES was slower in those with predominant constipation than in those with predominant diarrhoea (P<0.05); GEL and GER were similar in both groups. Gastroparesis was found in a large proportion of patients with irritable bowel syndrome, suggesting the presence of a more generalised motor disorder of the gut. (orig.)
Savvas, Ioannis; Raptopoulos, Dimitrios; Rallis, Timoleon
Emerging evidence from veterinary and medical clinical research shows that reducing preoperative fasting time may reduce the incidence of gastro-esophageal reflux (GER) intraoperatively. In order to evaluate the effect of two different preoperative fasting times on the incidence of GER during general anesthesia, 120 dogs were randomly assigned to two groups: administration of canned food 3 h before premedication (group C3, n = 60) and administration of canned food 10 h before premedication (group C10, n = 60). The animals were premedicated with propionyl-promazine. Anesthesia was induced with thiopental sodium and maintained with halothane. A pH electrode was introduced into the esophagus, and the esophageal pH was constantly monitored. Esophageal pH of less than 4 or greater than 7.5 was taken as an indication of GER. Three of the 60 dogs of group C3 and 12 of the 60 dogs of group C10 experienced a GER episode, the difference being statistically significant (P = .025). Feeding the dog 3 h before anesthesia at a half daily rate reduces significantly the incidence of GER during anesthesia, compared to the administration of the same amount and type of food 10 h before anesthesia. The administration of a half daily dose of an ordinary canine diet may be useful in clinical practice.
Exercise Training in Stable Heart Transplant recipients
DEFF Research Database (Denmark)
Dall, Christian Have
Afhandlingen består af to forsøg, et randomiseret crossover forsøg der undersøger effekten af træning på hjertetransplanterede, samt et klinisk forsøg der undersøger akut blodtryksstigning ved styrketræning hos hjertetransplanterede, hjertesvigtspatienter, og patienter med iskæmisk hjertesygdom. ...
Scintigraphic Methods to Evaluate Alterations of Gastric and Esophageal Functions in Female Obesity
Directory of Open Access Journals (Sweden)
Özgür Ömür
2014-02-01
Full Text Available Objective: Altered gastrointestinal function has frequently been observed in obese patients. The aim of this study was to investigate the frequency of gastro-esophageal reflux (GER and to determine the alterations of gastric emptying and esophageal transit by scintigraphic methods in obese patients. Methods: Scintigraphic studies of 50 obese female non-diabetic patients who had not received any treatment for weight control were retrospectively reviewed. Mean Body Mass Index (BMI was 34.96±3.04 kg/m² (range:32-39 kg/m². All subjects were submitted to scintigraphic evaluation of esophageal transit, gastro-esophageal reflux, gastric emptying and presence of Helicobacter pylori infection. The data of obese patients were compared with those of sex-age matched 30 non-obese cases who were selected from our clinical archive. Results: In obese group, seventeen (34% patients were found to be GER positive scintigraphically; mean gastric emptying time (t½ was 59.18±30.8 min and the mean esophageal transit time was 8.9±7.2 s. Frequency of positive GER scintigraphy and the mean value of esophageal transit time were significantly higher in obese patients than non-obese control subjects. Gastric emptying time and esophageal transit time values were significantly longer in GER positive obese patients than GER negative ones. There was no statistically significant difference in the frequency of positive C14 urea breath test between obese and non-obese subjects and there were also no statistically significant correlations between BMI, GER, esophageal transit time and gastric emptying time. Conclusion: In our study, 42 of the 50 obese patients had esophago-gastric motility alterations. The significance of these alterations in obesity is not fully understood, but it is believed that these changes could be because of potential contributing factors in the development or maintenance of obesity or changes in eating habits
Model Transformers for Dynamical Systems of Dynamic Epistemic Logic
DEFF Research Database (Denmark)
Rendsvig, Rasmus Kræmmer
2015-01-01
I artiklen tages et dynamisk system-perspektiv på dynamisk epistemisk logik, og undersøger opdateringskraften af forskellige måder at definere evolutionsafbildninger på.......I artiklen tages et dynamisk system-perspektiv på dynamisk epistemisk logik, og undersøger opdateringskraften af forskellige måder at definere evolutionsafbildninger på....
DEFF Research Database (Denmark)
Conrad, Torsten
2014-01-01
supervision i praksis (Joyce & Showers, 2002). Artiklen sigter mod at bidrage med en øget forståelse af implementeringen af politiske beslutninger ved at belyse de forhold, der præger implementeringen med særligt fokus på skoleledelsen, medarbejderne og deres relation. Artiklen søger også at belyse, hvordan...
PHARMACEUTICAL MARKETING TARGETED AT PRIMARY CARE: MAGNITUDE AND COMPOSITION
DEFF Research Database (Denmark)
Schramm, Jesper
Denne undersøgelse forsøger at registrere omfanget og metoder, som medicinalfirmaerne benytter til at fremme deres produkter i den primære sundhedssektor. I en periode på 6 måneder 47 praktiserende læger registrerede alle besøg af farmaceutiske repræsentanter, dato, firma, forfremmet narkotika, n...
Teknologi 1700-1789: Den industrielle revolution
DEFF Research Database (Denmark)
Buhl, Hans
2006-01-01
Tankens Magt beskriver i tre bind Vestens idehistorie fra Antikken frem til det 21. århundrede. Værket består af ni 'hovedbøger', der hver modsvarer en historisk periode. Hver af disse ni hovedbøger er igen inddelt i syv underkapitler, der beskriver periodens væsentligste udviklinger indenfor fel...
Hiatus hernia in gastroesophageal reflux disease
International Nuclear Information System (INIS)
Kaul, B.; Petersen, H.; Myrvold, H.E.; Grette, K.; Roeysland, P.; Halvorsen, T.
1986-01-01
Upper gastrointestinal endoscopy and radiologic examination were performed in 101 patients with symptoms strongly suggestive of gastroesophageal reflux (GER) disease. Hiatus hernia (HH) was found in 50 patients diagnosed by radiography or endoscopy, or both, in 22, 19, and 9 patients respectively. Severe endoscopic esophagitis (grades III and IV) was found more often (p<0.05) in the patients with HH than in those without. The same was true for the early positive timed acid perfusion tests (p<0.02). Furthermore, the patients with HH more often had reflux by the standard acid reflux test (42 og 50 versus 28 of 51; p<0.01), gastroesophageal scintigraphy (47 of 50 versus 40 of 51; p<0.05), and radiography (20 of 50 versus 2 of 51; p<0.001) than the patients without HH. The results show that severe GER disease can occur without an associated HH and indicate that patients with symptoms of GER disease and associated HH are likely to have a more severe GER disease than those without HH
The acid perfusion test in gastroesophageal reflux disease
International Nuclear Information System (INIS)
Kaul, B.; Petersen, H.; Grette, K.; Myrvold, H.E.
1986-01-01
An acid perfusion test, isotope scanning, endoscopy, and esophageal biopsy were performed in 101 patients with symptoms strongly suggestive of gastroesophageal reflux (GER) disease. A positive acid perfusion test within 30 min (APT) and within 5 min (TAPT) was found in 70.2% and 37.6% of the patients, respectively. A positive APT was found significantly more often in patients with than without endoscopic esophagitis, whereas a positive TAPT was found significantly more often in patients with severe symptoms than in patients with moderate symptoms, and in a significantly higher proportion of patients with than without GER by scintigraphy. Neither the APT nor the TAPT showed any dependency on the presence of histologic esophagitis. Most (97%) patients with a negative acid perfusion test, in addition to typical symptoms, also presented with scintigraphic, endoscopic, or histologic evidence of GER disease. Although it shows that the acid perfusion test, particularly when early positive, may serve as a weak predictor of the severity of GER disease, the present study gives little support to the test's clinical usefulness
/sup 99m/Tc-HIDA dynamic scintigraphy for the diagnosis of gastroesophageal reflux of bile
Energy Technology Data Exchange (ETDEWEB)
Bortolotti, M.; Bersani, G.; Labo, G.; Abbati, A.; Turba, E.; Pozzoto, R.
1985-06-01
In 5 patients with partial gastric resection and esophagitis, in whom esophageal pH metry was unable to demonstrate significant gastroesophageal reflux (GER), we administered i.v. 5 mCi (185 MBq) of /sup 99m/Tc-HIDA, the patient lying under a computer-assisted LFOV gamma camera. When gallbladder image was evident, caerulein was administered i.v. at a physiologic dose in order to induce gallbladder contraction, and in the subsequent 45 min the patient was asked to perform a standard series of manoeuvres that increase the intraabdominal pressure (Valsalva, etc.) and favour GER. Scintigraphic images and time/activity curves obtained from areas of interest corresponding to gastric remnant and distal esophagus showed that at least one of these manoeuvres in each case was followed by the appearance of the radiocompound in the distal esophagus, indicating a /sup 99m/Tc-HIDA-tagged bile GER. Consequently, we believe that HIDA-GER dynamic scintigraphy may be more useful than esophageal pH metry in demonstrating the bilairy origin of an esophagitis.
Acid perfusion test in gastroesophageal reflux disease
Energy Technology Data Exchange (ETDEWEB)
Kaul, B.; Petersen, H.; Grette, K.; Myrvold, H.E.
1986-01-01
An acid perfusion test, isotope scanning, endoscopy, and esophageal biopsy were performed in 101 patients with symptoms strongly suggestive of gastroesophageal reflux (GER) disease. A positive acid perfusion test within 30 min (APT) and within 5 min (TAPT) was found in 70.2% and 37.6% of the patients, respectively. A positive APT was found significantly more often in patients with than without endoscopic esophagitis, whereas a positive TAPT was found significantly more often in patients with severe symptoms than in patients with moderate symptoms, and in a significantly higher proportion of patients with than without GER by scintigraphy. Neither the APT nor the TAPT showed any dependency on the presence of histologic esophagitis. Most (97%) patients with a negative acid perfusion test, in addition to typical symptoms, also presented with scintigraphic, endoscopic, or histologic evidence of GER disease. Although it shows that the acid perfusion test, particularly when early positive, may serve as a weak predictor of the severity of GER disease, the present study gives little support to the test's clinical usefulness.
Douzinas, Emmanuel E; Tsapalos, Andreas; Dimitrakopoulos, Antonios; Diamanti-Kandarakis, Evanthia; Rapidis, Alexandros D; Roussos, Charis
2006-01-07
To investigate the effect of percutaneous endoscopic gastrostomy (PEG) on gastroesophageal reflux (GER) in mechanically-ventilated patients. In a prospective, randomized, controlled study 36 patients with recurrent or persistent ventilator-associated pneumonia (VAP) and GER > 6% were divided into PEG group (n = 16) or non-PEG group (n = 20). Another 11 ventilated patients without reflux (GER Patients were strictly followed up for semi-recumbent position and control of gastric nutrient residue. A significant decrease of median (range) reflux was observed in PEG group from 7.8 (6.2 - 15.6) at baseline to 2.7 (0 - 10.4) on d 7 post-gastrostomy (P position and absence of nutrient gastric residue reduces the gastroesophageal reflux in ventilated patients.
Measuring efficiency of the Writereader-app
DEFF Research Database (Denmark)
Heiden, Thomas Roed
2016-01-01
Dette studie forsøger at påvise, at anvendelsen af læringsværktøjet Skriv og Læs som en del af danskundervisningen i 1. klasse øger elevernes tilegnelse af fonologiske strategier gennem egen skrivning. Der var primært fokus på elevernes anvendelse af fonologiske strategier, samt den kvantitative ...
DEFF Research Database (Denmark)
Roos, Nanna
2014-01-01
Et forskningsprojekt med dansk deltagelse undersøger, hvordan masseproduktion af insekter kan etableres i Kenya og bidrage med fødevarer til mennesker og protein til husdyrfoder.......Et forskningsprojekt med dansk deltagelse undersøger, hvordan masseproduktion af insekter kan etableres i Kenya og bidrage med fødevarer til mennesker og protein til husdyrfoder....
DEFF Research Database (Denmark)
Krenzen, Anette Elisabeth
Rapporten er en del af kandidatspeciale, der empirisk undersøger børns narrative kompetencer i skolestarten på Egumsvejens skole i Fredericia samt tilknyttede børneinstitutioner.......Rapporten er en del af kandidatspeciale, der empirisk undersøger børns narrative kompetencer i skolestarten på Egumsvejens skole i Fredericia samt tilknyttede børneinstitutioner....
Skal alkoholmisbrug overhovedet behandles i almen praksis
DEFF Research Database (Denmark)
Barfod, Sverre Malm
1995-01-01
Som en del af en international undersøgelse gennemførtes telefon-interviews ud fra et semi-struktureret spørgeskema af 12 tilfældigt udvalgte praktiserende læger samt personlige interviews af seks nøglepersoner i sundhedsvæsenet. Alle de udspurgte praktiserende læger var interesserede i at udføre...
DEFF Research Database (Denmark)
Guttorm Andersen, Pia; Hansen, Ole
Teknologier giver adgang til viden - og med viden forøges handlemulighederne. Teknologier nedbryder traditionelle barrierer som tid og sted. Teknologier øger kompetencerne hos den enkelte borger......Teknologier giver adgang til viden - og med viden forøges handlemulighederne. Teknologier nedbryder traditionelle barrierer som tid og sted. Teknologier øger kompetencerne hos den enkelte borger...
THE GREAT DETECTIVE IN DENMARK – THE EARLY YEARS
DEFF Research Database (Denmark)
Lauridsen, Palle Schantz
2014-01-01
Forskingsbaseret, engelsksproget artikel om den tværmediale introduktion af Sherlock Holmes i Danmark, 1891-1911 i aviser, bøger, seriehæfter, film og på teateret.......Forskingsbaseret, engelsksproget artikel om den tværmediale introduktion af Sherlock Holmes i Danmark, 1891-1911 i aviser, bøger, seriehæfter, film og på teateret....
The Changing Scope of Professional Autonomy
DEFF Research Database (Denmark)
Jespersen, Peter Kragh; Wrede, Sirpa
2009-01-01
Kapitlet undersøger hvordan lægeprofessionens autonomi ændres i relation til ledelse i sygehuse i Danmark, Norge, Sverige og Finland i tiden fra 1970 og fremefter.......Kapitlet undersøger hvordan lægeprofessionens autonomi ændres i relation til ledelse i sygehuse i Danmark, Norge, Sverige og Finland i tiden fra 1970 og fremefter....
Videnskabshistorie som god formidling
DEFF Research Database (Denmark)
Nielsen, Kristian Hvidtfelt; Nielsen, Henry
2008-01-01
Videnskabshistorie har måske aldrig været mere populært end nu, hvilket bevidnes af de mange bøger, der fulgte i kølvandet på Dava Sobels bog Longitude (1995). I disse år bliver de mest populære videnskabshistoriebøger dog forfattet af professionelle journalister og forfattere, ikke universitetsa...
Hvilke Dødehavstekster er "sekteriske"?
DEFF Research Database (Denmark)
Holst, Søren
2003-01-01
Skønt Dødehavsrullerne antageligt tilhørte en gruppering, der boede i Qumran, tyder alt på, at mange af teksterne er forfattet andre steder. Artiklen undersøger den særlige sprogbrug, som antageligt er typisk for Qumran-samfundet, og som præger forbavsende få af tekserne. En meget stor del af...
Directory of Open Access Journals (Sweden)
Umberto Alecci
2016-01-01
Full Text Available Gastroesophageal reflux (GER is a common, chronic, relapsing symptom. Often people self-diagnose and self-treat it even though health-related quality of life is significantly impaired. In the lack of a valid alternative approach, current treatments focus on suppression of gastric acid secretion by the use of proton pump inhibitors (PPIs, but people with GER have a significantly lower response rate to therapy. We designed a randomized double-blinded controlled clinical study to evaluate the efficacy and the safety of a formulation based on sodium alginate/bicarbonate in combination with extracts obtained from Opuntia ficus-indica and Olea europaea associated with polyphenols (Mucosave®; verum, on GER-related symptoms. Male/female 118 (intention to treat subjects with moderate GER and having at least 2 to 6 days of GER episodes/week were treated with verum (6 g/day or placebo for two months. The questionnaires Gastroesophageal Reflux Disease-Health-Related Quality of Life (GERD-HRQoL and Gastroesophageal Reflux Disease Symptom Assessment Scale (GSAS were self-administered by participants before the treatment and at the end of the treatment. Verum produced statistically significant reduction of GERD-HRQoL and GSAS scores, −56.5% and −59.1%, respectively, in comparison to placebo. Heartburn and acid regurgitation episodes for week were significantly reduced by verum (p<0.01. Results indicate that Mucosave formulation provides an effective and well-tolerated treatment for reducing the frequency and intensity of symptoms associated with gastroesophageal reflux.
Gastroesophageal Reflux Disease in Children with Interstitial Lung Disease.
Dziekiewicz, M A; Karolewska-Bochenek, K; Dembiński, Ł; Gawronska, A; Krenke, K; Lange, J; Banasiuk, M; Kuchar, E; Kulus, M; Albrecht, P; Banaszkiewicz, A
2016-01-01
Gastroesophageal reflux disease is common in adult patients with interstitial lung disease. However, no data currently exist regarding the prevalence and characteristics of the disease in pediatric patients with interstitial lung disease. The aim of the present study was to prospectively assess the incidence of gastroesophageal reflux disease and characterize its features in children with interstitial lung disease. Gastroesophageal reflux disease was established based on 24 h pH-impedance monitoring (MII-pH). Gastroesophageal reflux episodes (GERs) were classified according to widely recognized criteria as acid, weakly acid, weakly alkaline, or proximal. Eighteen consecutive patients (15 boys, aged 0.2-11.6 years) were enrolled in the study. Gastroesophageal reflux disease was diagnosed in a half (9/18) of children. A thousand GERs were detected by MII-pH (median 53.5; IQR 39.0-75.5). Of these, 585 (58.5 %) episodes were acidic, 407 (40.7 %) were weakly acidic, and eight (0.8 %) were weakly alkaline. There were 637 (63.7 %) proximal GERs. The patients in whom gastroesophageal reflux disease was diagnosed had a significantly higher number of proximal and total GERs. We conclude that the prevalence of gastroesophageal reflux disease in children with interstitial lung disease is high; thus, the disease should be considered regardless of presenting clinical symptoms. A high frequency of non-acid and proximal GERs makes the MII-pH method a preferable choice for the detection of reflux episodes in this patient population.
Altered gastric emptying in patients with irritable bowel syndrome
Energy Technology Data Exchange (ETDEWEB)
Caballero-Plasencia, A.M.; Valenzuela-Barranco, M. [Department of Medicine, School of Medicine, University of Granada (Spain); Herrerias-Gutierrez, J.M. [Division of Gastroenterology, University Hospital ``Virgen de la Macarena``, Sevilla (Spain); Esteban-Carretero, J.M. [Central Service of Investigation in Health Sciences, University of Cadiz, Cadiz (Spain)
1999-04-29
Irritable bowel syndrome is the most frequent functional disorder of the digestive system. Patients with irritable bowel syndrome have motor disorders not only in the colon, but also in other parts of the digestive tract such as the oesophagus and small intestine; however, it is not known whether the stomach is also involved. We used a radiolabelled mixed solid-liquid meal (technetium-99m for the solid component, indium-111 for the liquid component) to study gastric emptying of solids (GES), liquids (GEL) and indigestible solids (GER) in 50 patients diagnosed as having irritable bowel syndrome (30 with predominant constipation and 20 with predominant diarrhoea). GER was measured by counting the number of indigestible solids remaining in the stomach 4 h after they were swallowed. In patients with irritable bowel syndrome, GES and GEL were slower than in control subjects (P<0.05). GER was normal in all patients except for two women. Thirty-two patients (64%) showed delayed GES, 29 (58%) delayed GEL, and 2 (4%) delayed GER. Among patients with irritable bowel syndrome, GES was slower in those with predominant constipation than in those with predominant diarrhoea (P<0.05); GEL and GER were similar in both groups. Gastroparesis was found in a large proportion of patients with irritable bowel syndrome, suggesting the presence of a more generalised motor disorder of the gut. (orig.) With 1 fig., 3 tabs., 48 refs.
Infant Gastroesophageal Reflux Information on the World Wide Web.
Balgowan, Regina; Greer, Leah C; D'Auria, Jennifer P
2016-01-01
The purpose of this study was to describe the type and quality of health information about infant gastroesophageal reflux (GER) that a parent may find on the World Wide Web. The data collection tool included evaluation of Web site quality and infant GER-specific content on the 30 sites that met the inclusion criteria. The most commonly found content categories in order of frequency were management strategies, when to call a primary care provider, definition, and clinical features. The most frequently mentioned strategies included feeding changes, infant positioning, and medications. Thirteen of the 30 Web sites included information on both GER and gastroesophageal reflux disease. Mention of the use of medication to lessen infant symptoms was found on 15 of the 30 sites. Only 10 of the 30 sites included information about parent support and coping strategies. Pediatric nurse practitioners (PNPs) should utilize well-child visits to address the normalcy of physiologic infant GER and clarify any misperceptions parents may have about diagnosis and the role of medication from information they may have found on the Internet. It is critical for PNPs to assist in the development of Web sites with accurate content, advise parents on how to identify safe and reliable information, and provide examples of high-quality Web sites about child health topics such as infant GER. Copyright © 2016 National Association of Pediatric Nurse Practitioners. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Joana Hernández Ortiz
2010-09-01
Full Text Available El presente trabajo fue desarrollado mediante la indagación de términos en revistas virtuales en medios electrónicos. El objetivo fue obtener información de las definiciones de gerencia y administración; Al mismo tiempo, realizar la interpretación de datos y efectuar una crítica de cada una de las definiciones seleccionadas, contrastando con los conocimientos de enfermería, ya que estos están forjados dentro del área empresarial. Se utilizó una metodología basada en constructos; aplicados para reeducar deficiencias terminológicas. Al analizar cada una de estas definiciones, se identificó que la gerencia y la administración coinciden en algunos aspectos y al aplicarlos logran confundir, aún teniendo similitudes en la práxis, no realizan las mismas acciones, ya que la gerencia es la estrategia y la administración es la ejecución. De esta manera, los resultados obtenidos fueron dos conceptos aplicables a la disciplina de Enfermería. Concluyendo así, que una disciplina necesita el apoyo de otras áreas del conocimiento.O presente trabalho foi desenvolvido diante da indagação dos términos em periódicos virtuais em médios eletrônicos. O objetivo foi obter informação das definições de gerência e administração e, ao mesmo tempo, realizar a interpretação de dados e efetuar uma crítica de cada uma das definições selecionadas, contrastando com os conhecimentos de enfermagem, já que estes geralmente ficam forjados dentro da área empresarial. Utilizou-se a metodologia baseada nos constructos, aplicada para reeducar deficiências terminológicas. Ao analisar cada um destas definições, identificou-se que a gerência e a administração coincidem em alguns aspectos e têm similitudes, mas, na prática, não realizam as mesmas ações já que a gerência é a estratégia e a administração é a execução. Desta maneira, os resultados obtidos foram dois conceitos aplicáveis à disciplina de Enfermagem, concluindo que
African Journals Online (AJOL)
Elamin
Krüger B, Fischereder M, Jauch KW, Graeb C,. Hoffmann U, Böger CA, Banas B, Obed A. Schlitt HJ,. Krämer BK. Five-year follow-up after late conversion from calcineurin inhibitors to sirolimus in patients with chronic renal allograff dysfunction. Transplant Proc. 2007 Mar,39(2):518-21. 54. Schena FP, Pascoe MD, Albertu J, ...
DEFF Research Database (Denmark)
Nielsen, Lisbeth Overgaard
2007-01-01
Afhandlingen undersøger Lars von Triers filmæstetik, som den kommer til udtryk i spillefilmene fra perioden 1984-2007. Afhandlingen analyserer de enkelte films stil, virkningsstrategi og betydningsdannelse.......Afhandlingen undersøger Lars von Triers filmæstetik, som den kommer til udtryk i spillefilmene fra perioden 1984-2007. Afhandlingen analyserer de enkelte films stil, virkningsstrategi og betydningsdannelse....
DEFF Research Database (Denmark)
Gitz-Johansen, Thomas
2012-01-01
I danske børnehaver foretager man vurderinger af børnenes udvikling. Denne artikel undersøger en række materialer til sådanne vurderinger, og den undersøger hvilke personlighedstræk, der her opfattes som uønskede og ikke-acceptable, som ”smuds”. En sådan læsning af vurderingsmaterialer siger noge...
DEFF Research Database (Denmark)
Andersen, Tem Frank
2013-01-01
Kulturhistoriske kan vi finde flere eksempler på renselsesritualer, hvor man søger at vaske ”det urene” væk, eller fjerne den mistænkelige stank af ondskab. Den unge kvinde i reklamen er præcist i gang med et af vore moderne renselsesritualer: Fitness! Gennem kropslig bevægelse søger vi at fjerne...
Effects of omeprazole and cisapride treatment in Japanese asthmatics with reflux esophagitis
Directory of Open Access Journals (Sweden)
Katsuya Fujimori
1997-01-01
Full Text Available In the United States and Europe, gastroesophageal reflux (GER is receiving attention as a potential cause of bronchial asthma. Few Japanese case reports have described this relationship. Therefore, we investigated the effect of omeprazole and cisapride on pulmonary function tests, blood gases and home peak expiratory flow rates (PEFR in six Japanese outpatients with asthma and proven GER. After 8 weeks of treatment, reflux esophagitis had improved in all patients. However, the parameters of pulmonary function showed no change other than a significant post- treatment increase in home PEFR (4.4-27.7% in three patients. These results suggest that anti-reflux (omeprazole and cisapride treatment will produce small improvements in the PEFR in some Japanese asthmatics with GER.
Evaluation of B10Plus+* proportional detectors for neutron coincidence counting
Energy Technology Data Exchange (ETDEWEB)
Beddingfield, David H.; Yoon, Seokryung [International Atomic Energy Agency, Vienna International Centre, PO Box 100, 1400 Vienna, (Austria)
2015-07-01
GE-Reuter-Stokes (GERS) has developed a new line of neutron proportional counters, the B10Plus+* proportional counter. The detector design is intended to serve as a cost-effective alternative to traditional {sup 3}He proportional counters in a variety of applications. The detector is a hybrid design 10B-lined tube optimized with the addition of a small quantity of 3He gas to improve the detector performance and efficiency. As a demonstration of the B10Plus+* detector, GERS has constructed a Uranium Neutron Collar (UNCL) system consisting of B-10Plus+* proportional counters. GERS has designed and built a demonstration UNCL system intended to match the performance of a Type-I UNCL design in Pressurized Water Reactor (PWR) geometry operating in thermal mode. GERS offered their system on loan to the International Atomic Energy Agency (IAEA) Safeguards Division of Technical and Scientific Services for an assessment of the detector technology and the demonstration system. We have characterized the demonstration UNCL system and compared its performance with a traditional Type-I UNCL design in regular use by the IAEA. This paper summarizes our findings and observations during the characterization and testing activity. (authors)
Diagnosis and treatment of patients with nonacid gastroesophageal reflux-induced chronic cough
Directory of Open Access Journals (Sweden)
Xianghuai Xu
2015-01-01
Full Text Available Gastroesophageal reflux (GER is one of the most common causes of chronic cough, and chronic cough due to GER represents a subtype of GER-related diseases. Gastroesophageal reflux-induced chronic cough (GERC can be divided into two subgroups based on the pH of the GER. Nonacid GERC is less common than acid GERC, and its diagnosis and treatment strategy have not been standardized. However, nonacid GERC usually presents with its unique set of characteristics and features upon diagnosis and treatment in the clinic. Although the underlying molecular mechanism of nonacid GERC is not fully understood, it is considered to be associated with reflux theory, reflex theory and airway hypersensitivity. Multi-channel intraluminal impedance combined with pH monitoring is a promising new technique that can detect both acid and nonacid reflux, and our findings as well as those of others have shown its usefulness in diagnosing nonacid GERC. Development of new diagnostic techniques has led to an increased rate of nonacid GERC diagnosis. We summarize our experience in the diagnosis and treatment of nonacid GERC and provide a guide for future therapeutic approaches.
JAVA PROGRAMLAMA DİLİNDE IŞIN İZLEME GERÇEKLEŞTİRİMİ
Directory of Open Access Journals (Sweden)
Aybars UĞUR
2002-01-01
Full Text Available Bu makalede ilk olarak bilgisayar grafiklerinde gerçekçilik ve gerçekçiliği sağlayan bileşenler üzerinde durulmuştur. Bu kapsamda aydınlatma modellerine, yüzey kaplama yöntemlerine ve ışık kaynaklarına değinilmiştir. Ardından, üç boyutlu sanal bir ortamın iki boyutlu gerçekçi resmini oluşturma işlemi yani Işın İzleme (Ray Tracing anlatılmıştır. Basit bir ışın izleme algoritması verilmiştir. Bu çalışma kapsamında, Java programlama dilinde gerçekleştirimi yapılan ve internet üzerinde işletilebilen "SahneIzle" yazılımı tanıtılmıştır. Son olarak, ışın izleme yazılımlarının İnternet üzerinde kullanımının önemi belirtilmiştir.
Insulin Pump and CGM Usage in the United States and Germany
Walsh, John; Roberts, Ruth; Weber, Dietmar; Faber-Heinemann, Gabriele; Heinemann, Lutz
2015-01-01
Background: This survey collected and evaluated user responses about routine tasks and preferences regarding insulin pumps and infusion sets (IIS) with comparison of intercountry differences between the United States (US) and Germany (GER), chosen for their large insulin pump populations. Methods: A total of 985 subjects (534 US, 451 GER; 60% female) with type 1 diabetes on pump therapy anonymously answered 20 pump-related questions. US subjects also answered 11 questions about continuous glucose monitoring (CGM) usage. Results: Length of use of insulin cartridges is shorter in US than in GER, mean (SD) 4.3 (5.0) versus 5.3 (3.2) days (P 3 days vs 7.7% for <3 days; P < .01), and with use of an auto-insertion device (vs manual IIS insertion) in the US (7.2% vs 6.9%), but not in GER (7.7% vs 7.9%). Only 47% of pump wearers stated that they were “very satisfied” with their pump (49% US vs 45% GER, ns). However, 98% would recommend the pump to others (95% vs 93%, ns). Analysis of CGM questions showed that 297 (60%) of 496 US responders currently wore one. Of these, 84% said they would recommend CGM to others. CGM wearers who stated they were “very satisfied” with their CGM had lower HbA1c than those who said they were “partly satisfied” (6.9% vs 7.2%). Conclusions: This survey shows interesting differences in real-world use of insulin pumps in 2 large markets, and suggests areas where insulin pumps and CGMs might be improved. PMID:26071425
International Nuclear Information System (INIS)
Thomas, E.J.; Bharathi Dasan, J.; Kumar, R.; Chanderashekher, N.; Tripathi, M.; Kabra, S.K.; Malhotra, A.; Kumar, A.; Menon, S.
2002-01-01
Introduction: Paediatric respiratory tract infections are one of the most common reasons for physician visits and hospitalisation, and are associated with significant morbidity and mortality. The socioeconomic impact of these recurrent infections is staggering. Gastroesophageal reflux (GER) has long been associated with pulmonary symptoms and diseases. Aims: The present retrospective analysis was undertaken to find out the incidence of GER in children suffering from recurrent lower respiratory tract infections without any typical gastrointestinal (GI) symptoms of GER. Materials and Methods: A total of 297 children with a mean age of 2.7 years and range 9-months to 8 years were evaluated. All studies were performed using a dose of 100-200 micro Curie (3.7-7.4MBq) of Tc99m-sulphur colloid, which was administered via a nasogastric tube into the stomach in younger children. Adequate intragastric volume was ensured by instilling water of 50-ml volume for children less than 6 months and 100-ml volume for children between 6-12 months of age. The nasogastric tube was removed with the patient held in erect position and a small volume of water was pushed to avoid any contamination. In older children the isotope was administered in a capsule and was swallowed with 150-300 ml of water. Results: Of the total 297 children, 111(37%) children had GER on scintigraphy. Conclusion: There is a high incidence of silent GER in children suffering from recurrent lower respiratory tract infections. Scintiscanning can be used as a screening modality in these children
Transformation of History textbooks
DEFF Research Database (Denmark)
Haue, Harry
2013-01-01
Artiklen omhandler danske og tyske lærebøger i historie over de seneste to århundreder med hensyn til deres vægtning af det nationale og det globale stof.......Artiklen omhandler danske og tyske lærebøger i historie over de seneste to århundreder med hensyn til deres vægtning af det nationale og det globale stof....
Current Trends in Danish Children's Literature
DEFF Research Database (Denmark)
Skyggebjerg, Anna Karlskov
2008-01-01
En beskrivelse af tendenser i aktuel dansk børnelitteratur med fokus på tekstbøger for større børn inden for fantasy, hverdagsrealisme og kriminallitteratur Udgivelsesdato: Autume......En beskrivelse af tendenser i aktuel dansk børnelitteratur med fokus på tekstbøger for større børn inden for fantasy, hverdagsrealisme og kriminallitteratur Udgivelsesdato: Autume...
DEFF Research Database (Denmark)
Krarup Andersen, Cecil
2013-01-01
Denne afhandling undersøger dubleringshistorien for samlingen af danske guldaldermalerier på lærred på Statens Museum for Kunst (SMK) og søger at forstå fugtfølsomheden i malerierne før og navnlig efter dublering. Dette gøres ved hjælp af kemiske analyser såvel som trækstyrketests af prøver fra o...
Day-of-the-week effect on doctors' response to a postal questionnaire
DEFF Research Database (Denmark)
Olivarius, Niels de Fine; Andreasen, A.H.
1995-01-01
Formålet med dette lille metodearbejde var at undersøge, om svarprocenten på spørgeskemaundersøgelser til alment praktiserende læger og speciallæger kan øges ved at sørge for, at skemaet modtages lige før en week-end. I det randomiserede forsøg var der imidlertid ingen forskel på, om spørgeskemae...
DEFF Research Database (Denmark)
Rasmussen, F.D.
1994-01-01
Artiklen, der er udformet som en kronik, søger at henlede opmærksomheden på det afsluttede projekt om psykologbistand i almen praksis. Artiklen lægger særlig vægt på de forhold, der må forventes at interessere de praktiserende læger, såsom lægernes uddannelse på området samt relevansen af en ordn...
DEFF Research Database (Denmark)
Lauridsen, Palle Schantz
2016-01-01
På baggrund af et internetbaseret spørgeskema undersøger artiklen forskelle og ligheder mellem medlemmer af Sherlock Holmes Klubben i Danmark og følgere af facebook-siden Sherlocked.dk......På baggrund af et internetbaseret spørgeskema undersøger artiklen forskelle og ligheder mellem medlemmer af Sherlock Holmes Klubben i Danmark og følgere af facebook-siden Sherlocked.dk...
Trump er godt nyt for verdensfreden
DEFF Research Database (Denmark)
Jakobsen, Peter Viggo
2017-01-01
Trumps uberegnelighed øger ikke risikoen for krig. Den mindsker den ved at få de allierede til at gøre mere og modstanderne til at forhandle. Det er godt for verdensfreden......Trumps uberegnelighed øger ikke risikoen for krig. Den mindsker den ved at få de allierede til at gøre mere og modstanderne til at forhandle. Det er godt for verdensfreden...
DEFF Research Database (Denmark)
Redvall, Eva Novrup
2015-01-01
Norske Joachim Triers unikke stemme præger hans første amerikanske film, den livskloge ’Louder Than Bombs’, der viser livet under overfladen og ikke kun taler til følelserne......Norske Joachim Triers unikke stemme præger hans første amerikanske film, den livskloge ’Louder Than Bombs’, der viser livet under overfladen og ikke kun taler til følelserne...
Energy Technology Data Exchange (ETDEWEB)
Morigeri, C.; Mukhopadhyay, K.; Narang, A. [Postgraduate Institute of Medical Education and Research (PGIMER), Division of Neonatology, Department of Paediatrics, Chandigarh (India); Bhattacharya, A.; Mittal, B.R. [Postgraduate Institute of Medical Education and Research (PGIMER), Department of Nuclear Medicine, Chandigarh (India)
2008-09-15
Gastroesophageal reflux (GER) is very common in pre-term infants. The diagnosis based on symptoms is always questionable. The incidence of GER in symptomatic babies varies from 22% to 85%, but literature regarding the incidence of reflux in asymptomatic pre-term infants is lacking. We used radionuclide scintigraphy to evaluate the incidence of GER in symptomatic as well as asymptomatic pre-term neonates and to assess whether symptoms have any relation with positive scintigraphy. We studied 106 pre-term infants (52 symptomatic, 54 asymptomatic) of less than 34 weeks of gestation, who fulfilled the eligibility criteria. Babies were considered symptomatic in the presence of vomiting, regurgitation, apnea, de-saturations, unexplained bradycardia and recurrent lung collapses. Radionuclide scintigraphy was conducted at post-conceptional age of 32-34 weeks when they were clinically stable for 72 h. Feeding was avoided for 2 h preceding the study. {sup 99m}Tc sulphur colloid was administered in a dose of 1.85 MBq (0.05 mCi) in 1 ml, followed by milk (full feed) through an orogastric tube, prior to imaging under a gamma camera. Reflux was graded as low or high, and reflux episodes during the study were counted. The incidence of GER in the symptomatic group was 71.2% and in asymptomatic babies 61.1% (p=0.275). High-grade reflux was more common (71.4%) than low-grade (28.6%) in both groups (p=0.449). Mean number of reflux episodes in 20 min was 4.4{+-}2.4 in symptomatic babies and 4.9 {+-}2.2 in asymptomatic babies (p=0.321). Babies with positive scintigraphy were similar in birth weight, gestation, time to achieve full feeds, weight and age at discharge to those with negative scintigraphy. GER is common in pre-term infants of less than 34 weeks gestation. The incidence of positive scintigraphy and grade of reflux is not significantly different in symptomatic vs. asymptomatic babies. Though radionuclide scintigraphy is a simple, quick and non-invasive investigation in
Plaßmann, Wilfried
Die schreibenden Messgeräte werden hauptsächlich eingesetzt, um Vorgänge aufzuzeichnen und zu dokumentieren, die sich im Minuten- und Stunden-Bereich abspielen. Sie sind weitgehend durch Oszilloskope oder elektronische Geräte ähnlich einem Oszilloskop ersetzt worden, die entsprechend für Langzeitaufnahmen ausgelegt sind. Der Vorteil dieser Geräte gegenüber den schreibenden Messgeräten ist der, dass die Daten dauerhaft gespeichert sind, einschließlich der notwendigen Kenngrößen wie Zeitmaßstab, Amplitude, Datum, Aufzeichnungsgerät usw., und sich in dieser Form beliebig oft ausdrucken und vor allem direkt weiterverarbeiten lassen. Weiterhin entfallen die Probleme mit der Mechanik, dem Papier und den Schreibstiften. Deshalb folgt hier eine nur kurze Darstellung der Geräte.
Use of radioisotope in the diagnosis of gastroesophageal reflux
Energy Technology Data Exchange (ETDEWEB)
Kohno, Sumio; Ichikawa, Masato; Sanada, Hiroshi; Chin, Moriyoshi; Kimura, Koichiro; Yano, Masayuki (Shizuoka Children' s Hospital (Japan))
1983-01-01
For the purpose of establishing the qualitative diagnosis of GER, symptomatic pediatric patients were evaluated by GER scintigraphy over 30 minutes. sup(99m)Tc-SHA-MDP used in this study is quite stable in acidic condition and has provided better imaging and time activity curve of the esophagus compared with previously available agents. According to the results of the time activity curve, the patients have been able to be divided into 4 grades which correctly represent the clinical conditions of the patients. Follow-up evaluations of surgically managed patients have been performed as well with satisfactory results. The study is easily repeated because of its short duration and also obviates overnight hospital stay. Despite the limited number of the cases, it appears to have several advantages over another diagnostic methods of GER.
Diabetes øger risikoen for frakturer
DEFF Research Database (Denmark)
Starup-Linde, Jakob; Karahasanovic, Azra; Vestergaard, Peter
2016-01-01
Diabetes is associated with an increased risk of fracture, however, neither bone mineral density, falls, diabetes complications nor other risk factors can explain why. Among patients with diabetes, hyperglycaemia may have detrimental effects on bone, but also use of anti-diabetic treatment may have...... an impact on fracture risk. In this article we assess the relationship between diabetes, bone and fracture and the effects of hyperglycaemia and anti-diabetic treatment on bone. Furthermore, fracture preventive measures in patients with diabetes are evaluated....
Diabetes øger risikoen for frakturer
DEFF Research Database (Denmark)
Starup-Linde, Jakob; Karahasanovic, Azra; Vestergaard, Peter
2015-01-01
Diabetes is associated with an increased risk of fracture, however, neither bone mineral density, falls, diabetes complications nor other risk factors can explain why. Among patients with diabetes, hyperglycaemia may have detrimental effects on bone, but also use of anti-diabetic treatment may have...... an impact on fracture risk. In this article we assess the relationship between diabetes, bone and fracture and the effects of hyperglycaemia and anti-diabetic treatment on bone. Furthermore, fracture preventive measures in patients with diabetes are evaluated....
Parametrische Optimierung eines Querträgers
Orantes Riera, Manel
2010-01-01
Desarrollo de una metodología que permita obtener de manera sistemática y, a partir de unas condiciones de contorno fijadas, una primera gometría del conjunto (travesía+deformables). La optimización paramétrica debe tener la suficiente flexibilidad para adaptarse a diferentes ensayos de choque (tanto de baja velocidad como de alta velocidad). Puntos destacables del proyecto: 1)Definición de los requisitos que debe cumplir el conjunto (traviesa+deformables) 2)Contraposición de diversos procedi...
Ontikal algas teatrisuvi / Gerli Romanovitš
Romanovitš, Gerli, 1977-
2009-01-01
Ontika mõisa õuel esietendus vene kirjandusklassiku Nikolai Leskovi jutustuse ainetel valminud suvelavastus "Mtsenski maakonna leedi Macbeth". Dramatiseeringu autor Urmas Lennuk, lavastaja Eili Neuhaus. Kaasa teevad Jõhvi teater Tuuleveski ja slaaviühingu "Läte" naiskoor Kundast
Køn i standardiserede undersøgelser - og komplekse effekter
DEFF Research Database (Denmark)
Vittrup, Bonnie
2013-01-01
Artiklen undersøger hvordan køn konstrueres i to rapporter fra to store internationale undersøgelser, hhv. PISA og TIMSS og peger på (køns)pædagogiske konsekvenser.......Artiklen undersøger hvordan køn konstrueres i to rapporter fra to store internationale undersøgelser, hhv. PISA og TIMSS og peger på (køns)pædagogiske konsekvenser....
DEFF Research Database (Denmark)
Led, Jens Christian Lauenstein
2005-01-01
Artiklen undersøger dogmereglerne som en æstetisk strageti, sætter strategien i forhold til teaterforestillingen Der Idiot (regi: Frank Castorf) og sammenligner denne med Lars von Triers film Idioterne......Artiklen undersøger dogmereglerne som en æstetisk strageti, sætter strategien i forhold til teaterforestillingen Der Idiot (regi: Frank Castorf) og sammenligner denne med Lars von Triers film Idioterne...
Rebecchi, Fabrizio; Giaccone, Claudio; Farinella, Eleonora; Campaci, Roberto; Morino, Mario
2008-12-01
To compare in a prospective, randomized trial the long-term results of laparoscopic Heller myotomy plus Dor fundoplication versus laparoscopic Heller myotomy plus floppy-Nissen for achalasia. Anterior fundoplication is usually performed after Heller myotomy to control GER; however, the incidence of postoperative GER ranges between 10% and 30%. Total fundoplication may aid in reducing GER rates. From December 1993 to September 2002, 153 patients with achalasia underwent Heller laparoscopic myotomy plus antireflux fundoplication. Of these, 9 were excluded from the study. The remaining 144 patients were randomly assigned to 2 treatment groups: Heller laparoscopic myotomy plus anterior fundoplication (Dor procedure) or Heller laparoscopic myotomy plus total fundoplication (floppy-Nissen procedure). The primary end point was incidence of clinical and instrumental GER after a minimum of 60 months follow-up. The secondary end point was recurrence of dysphagia. Follow-up clinical assessments were performed at 1, 3, 12, and 60 months using a modified DeMeester Symptom Scoring System (MDSS). Esophageal manometry and 24-hour pH monitoring were performed at 3, 12, and 60 months postoperative. Of the 144 patients originally included in the study, 138 were available for long-term analysis: 71 (51%) underwent antireflux fundoplication plus a Dor procedure (H + D group) and 67 (49%) antireflux fundoplication plus a Nissen procedure (H + N group). No mortality was observed. The mean follow-up period was 125 months. No statistically significant differences in clinical (5.6% vs. 0%) or instrumental GER (2.8% vs. 0%) were found between the 2 groups; however, a statistically significant difference in dysphagia rates was noted (2.8% vs. 15%; P Heller myotomy.
Screening for Helicobacter pylori in Idiopathic Pulmonary Fibrosis Lung Biopsies.
Kreuter, Michael; Kirsten, Detlef; Bahmer, Thomas; Penzel, Roland; Claussen, Martin; Ehlers-Tenenbaum, Svenja; Muley, Thomas; Palmowski, Karin; Eichinger, Monika; Leider, Marta; Herth, Felix J F; Rabe, Klaus F; Bittmann, Iris; Warth, Arne
2016-01-01
Increasing evidence suggests a role of gastro-oesophageal reflux (GER) in idiopathic pulmonary fibrosis (IPF) pathogenesis. Recently, an association between serum Helicobacter pylori (HP) antibody positivity and more severe disease was described, but HP has not been directly analysed in lung tissue so far. To investigate the presence of HP in the lung tissue of IPF patients. Two tertiary interstitial lung disease care centre databases were screened for available lung biopsy material from IPF patients. Clinical and radiological data, including presence of GER and antiacid medication, were evaluated. HP-specific PCR was carried out on the IPF lung biopsy specimens. A total of 39 IPF patients were included, of whom 85% were male. The patients' median age was 66 years, their vital capacity was 79% predicted, and their diffusing capacity for carbon monoxide was 53% predicted. In all, 82% of the lung biopsies were surgical and 18% transbronchial. Comorbidities were GER disease in 23% (n = 9), sleep apnoea in 13% (n = 5) and hiatal hernia in 38% of the cases (n = 15). Proton pump inhibitors were prescribed at the time of biopsy in 21% of the cases (n = 9). After a median follow-up of 25 months (range 6-69), there were 1 death, 1 lung transplantation and 8 acute exacerbations without relevant differences between the GER and non-GER subgroups. HP DNA was not detected in any of the lung tissue samples. The fact that no HP DNA was detected in the lung tissues calls into question the proposed relevance of HP to the direct pathogenesis of IPF. © 2015 S. Karger AG, Basel.
Randomized Clinical Trial of Lansoprazole for Poorly Controlled Asthma in Children
Holbrook, Janet T.; Wise, Robert A.; Gold, Benjamin D.; Blake, Kathryn; Brown, Ellen D.; Castro, Mario; Dozor, Allen J.; Lima, John; Mastronarde, John G.; Sockrider, Marianna; Teague, W. Gerald
2013-01-01
Context Asymptomatic gastroesophageal reflux (GER) is prevalent in children with asthma. It is not known whether treatment of GER with a proton-pump inhibitor (PPI) improves asthma control. Objective To determine whether lansoprazole is effective in reducing asthma symptoms in children without overt GER. Design, Setting, and Patients A multicenter, randomized, masked, placebo controlled, parallel clinical trial comparing lansoprazole to placebo in children with poor asthma control on inhaled corticosteroid treatment conducted at 18 academic clinical centers. Participants were followed for 24 weeks. A subgroup had an esophageal pH study before randomization. Intervention Children received either lansoprazole (15 mg daily lansoprazole and placebo groups, respectively (P=0.12). There were no detectable treatment differences in secondary outcomes (mean (95% CI) for FEV1(0.00 (−0.08, 0.08)), asthma quality of life (−0.1 (−0.4, 0.1) or episodes of poor asthma control, hazard ratio of 1.18 (95% CI 0.91, 1.53). Among the 115 children with esophageal pH studies, the prevalence of GER was 43%. In the subgroup with a positive pH study, no treatment effect for lansoprazole versus placebo was observed for any asthma outcome. Children treated with lansoprazole reported more upper respiratory infections (63% vs 49%, P=0.02), sore throats (52% vs 39%, P=0.02), and bronchitis (7% vs 2%, P=0.05). Conclusion Among children with poorly controlled asthma without symptoms of GER who were using inhaled corticosteroids, the addition of lansoprazole, as compared to placebo, did not improve symptoms nor lung function but was associated with increased adverse events. PMID:22274684
PP-16 WEAK ACID REFLUX A TRIGGER FOR RECURRENT RESPIRATORY DISEASES IN CHILDREN.
Kostovski, Aco; Zdraveska, Nikolina
2015-10-01
The main advantage of multichannel intraluminar impedance (MII) compared with pH monitoring is its ability to detect both acid and non-acid gastroesophageal reflux (GER) and to determine the characteristics of reflux (liquid or gas). To compare the value of pH monitoring and MII for diagnosis of GER in children who present with refractory respiratory symptoms. A prospective study that included 37 patients, aged 4.25 ± 3.15 years, using combined MII-pH monitoring was performed. Patients were referred for investigation because of suspected GER as the etiology of recurrent respiratory diseases, including recurrent obstructive bronchitis, recurrent pneumonia, laryngitis, and chronic cough. We analyzed the percentage of time during which the pH was less than 4, the numeric and percentile values of acid, weak acid, and non-acid reflux episodes, and the values of liquid and mixed reflux. Diagnostic values were determined separately for pH monitoring and MII using Fisher's exact test. Reflux was detected in 31 patients. pH monitoring was positive in 20 patients (% time during which pH acid and weak acid reflux episodes, 3 had only acid reflux, 8 had weak acid reflux, and 3 had non-acid reflux. Sixteen patients had mixed (liquid and gas) reflux, and 14 had both liquid and mixed reflux. This study suggests that significant numbers of GER include weak acid reflux that cannot be detected by pH probes alone. The weak acid reflux could be a trigger for recurrent respiratory symptoms. Combining pH with MII monitoring is a valuable diagnostic method for diagnosing GER in children.
Directory of Open Access Journals (Sweden)
V.R.S.G. Monteiro
2005-02-01
Full Text Available Gastroesophageal reflux (GER disorder was studied in children and adolescents with chronic and/or recurrent rhinosinusitis not associated with bronchial asthma. Ten children with a clinical and radiological diagnosis of chronic and/or recurrent rhinosinusitis, consecutively attended at the Pediatric Otolaryngology Outpatient Clinic, Federal University of São Paulo, were evaluated. Prolonged esophageal pH monitoring was used to investigate GER disorder. The mean age of the ten patients evaluated (eight males was 7.4 ± 2.4 years. Two patients presented vomiting as a clinical manifestation and one patient presented retrosternal pain with a burning sensation. Twenty-four-hour esophageal pH monitoring was performed using the Sandhill apparatus. An antimony probe electrode was placed in the lower third of the esophagus, confirmed by fluoroscopy and later by a chest X-ray. The parameters analyzed by esophageal pH monitoring included: total percent time of the presence of acid esophageal pH, i.e., pH below 4 (<4.2%; total number of acid episodes (<50 episodes; number of reflux episodes longer than 5 min (3 or less, and duration of the longest reflux episode (<9.2 min. One patient (1/10, 10% presented a 24-h esophageal pH profile compatible with GER disorder. This data suggest that an association between chronic rhinosinusitis not associated with bronchial asthma and GER disorder may exist in children and adolescents, especially in those with compatible GER disorder symptoms. In these cases, 24-h esophageal pH monitoring should be performed before indicating surgery, since the present data suggest that 10% of chronic rhinosinusitis surgeries can be eliminated.
Directory of Open Access Journals (Sweden)
Irena Lorenc-Kubis
2011-01-01
Full Text Available Antitrypsin activity in germinating common seeds of flax (Linum usitatissimum was investigated. At the early stage of germination an increase in antitrypsin activity was observed, followed by its decrease during the development of the seedlings. From 6-day-old seedlings a trypsin inhibitor (gerLUTI was purified. The purification procedure involved fractionation of proteins from seedling homogenate with alcohol and successive chromatography on CM-Sephadex C-25 on immobilised methylchymotrypsin in the presence of 5 M NaCl, and finally on a C18 column in RP-HPLC. The gerLUTI migrated in SDS PAGE as a single band, but in mass spectroscopy analysis it exhibited the presence of at least three forms with molecular masses of 7654 ± 3 Da, 7668/7670 ± 3 Da, and 7687 ± 3 Da. The preparation of LUTI isolated from resting seeds contained only one form, with a molecular mass of 7655 ± 3 Da. LUTI and gerLUTI differed also in methionine contents. LUTI contained two methionine residues, whereas in gerLUTI only a trace of methionine was detected. The obtained results might suggest that during flax seeds germination the inhibitor molecules undergo selective modification, e.g. oxidation at methionine residues, before being degraded by proteolytic enzymes.
Directory of Open Access Journals (Sweden)
Ashraf Karbasi
2013-01-01
Full Text Available Background: The association of gastro-esophageal reflux (GER with a wide variety of pulmonary disorders was recognized. We aimed to evaluate the effect of GER-induced esophagitis on airway hyper-reactivity (AHR in patients and the response to treatment. Materials and Methods: In this cohort study, 30 patients attending the gastrointestinal clinic of a university hospital with acid reflux symptoms were included. All patients were evaluated endoscopically and divided into case group with esophagitis and control group without any evidence of esophagitis. Spirometry and methacholine test were done in all patients before and after treatment of GER with pantoprazole 40 mg daily for six months. Results: There was a significant difference in the rate of positive methacholine test between the cases (40% and the controls (6.7% prior to anti-acid therapy (P < 0.0001. After six months of treatment, the frequency of positive methacholine test diminished from 40 to 13.3% in the case group (P < 0.05 but did not change in the controls (P = 0.15. Conclusion: The presence of esophagitis due to GER would increase the AHR and treatment with pantoperazole would decrease AHR in patients with proved esophagitis and no previous history of asthma after six months.
Nursing care management to men with cancer
Directory of Open Access Journals (Sweden)
Maria Gefé da Rosa Mesquita
2015-07-01
Full Text Available Objetivo: Discutir as interações entre perspectiva de gênero e integralidade na gerência do cuidado de enfermagem a homens com câncer. Método: Estudo qualitativo, orientado pela Teoria Fundamentada nos Dados. O cenário foi um Hospital Federal do Município do Rio de Janeiro - Brasil e os sujeitos, todos os 6 enfermeiros do serviço de oncologia, que concederam entrevistas semi-estruturadas. Resultados: Cinco categorias emergiram gerando o fenômeno: Ressignificando a gerência do cuidado de enfermagem mediante a perspectiva de gênero a fim de assegurar a integralidade ao homem com câncer. Na interação com os homens com câncer em tratamento antineoplásico, enfermeiros ouvem a influência da masculinidade em suas vidas e detectam a necessidade de inclusão da perspectiva de gênero em sua prática profissional. Conclusão: Assegurar a integralidade do cuidado ao homem lança o desafio de se colocar no lugar do mesmo, reconhecer suas necessidades singulares e assim ressignificar a gerência do cuidado de enfermagem. Descritores: Saúde do Homem; Enfermagem; Assistência Integral à Saúde; Oncologia; Gerência.
Taze Barbunya Peroksidazının Rejenerasyonu (Phaseolus vulgaris (İngilizce
Directory of Open Access Journals (Sweden)
Ahmet Yemenicioğlu
2015-02-01
Full Text Available Kısmi olarak inaktive edilmiş taze barbunya peroksidazının (POX rejenerasyon kinetiği 30o ve 1 oC’lerde incelenmiştir. Rejenerasyon, her iki sıcaklıkta da yavaş bir şekilde gerçekleşmiş ve rejenerasyonun çoğunluğu ilk 1 saat içinde tamamlanmıştır. Beklenildiği gibi 30 oC’deki rejenerasyon, 1 oC’deki rejenarasyondan daha hızlı gerçekleşmiştir. Ayrıca 30 oC’de gerçekleşen yüzde rejenerasyon ile 65 oC’deki ısıtma süresi arasında ters gelişin bir ilişki olduğu belirlenmiştir.
DEFF Research Database (Denmark)
Hlebowicz, Joanna; Hlebowicz, Anna; Lindstedt, Sandra
2009-01-01
glucose, plasma concentrations of insulin and incretin hormones [glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide 1 (GLP-1)], the ghrelin response, and satiety in healthy subjects. DESIGN: GER was measured by using real-time ultrasonography after ingestion of rice pudding...... with and without 1 or 3 g cinnamon. Fifteen healthy subjects were assessed in a crossover trial. RESULTS: The addition of 1 or 3 g cinnamon had no significant effect on GER, satiety, glucose, GIP, or the ghrelin response. The insulin response at 60 min and the area under the curve (AUC) at 120 min were...... cinnamon (P = 0.0082 and P = 0.0138, respectively, after Bonferroni correction). CONCLUSIONS: Ingestion of 3 g cinnamon reduced postprandial serum insulin and increased GLP-1 concentrations without significantly affecting blood glucose, GIP, the ghrelin concentration, satiety, or GER in healthy subjects...
Tournier, Charl?ne; Hours, Martine; Charnay, Pierrette; Chossegros, Laetitia; Tardy, H?l?ne
2016-01-01
Cette étude a pour objectif de comparer l'état de santé et la qualité de vie cinq ans après l'accidents de la route chez des blessés légers atteints d'une part de "coup du lapin", d'autre part de toute autre lésion considérée comme mineure. l'évolution de cet état de santé entre la première année et la cinquième année est également étudiée. L'étude est basée sur les données de la cohorte ESPARR et inclut 167 blessés légers avec coup du lapin et 185 blessés légers sans coup du lapin. la qualit...
2003-04-01
SAR system”, Proc. EUSAR’98, 25-27 May 1998, Friedrichshafen , Ger- many [15] Farina, A., Timmoneri, L., ”Space-time processing for AEW radar”, Proc...98, Friedrichshafen , Germany, 25-27 May 1998. [PSF00] V. Pascazio, G. Schirinzi, A. Farina, “ Along track interferometry by one bit coded SAR signals...airborne multi-channel SAR systems AER II.The air- borne experimental multi-channel SAR system”, Proc. EUSAR’98, 25-27 May 1998, Friedrichshafen , Ger
DEFF Research Database (Denmark)
Pedersen, Anette Fischer; Andersen, Christina Maar; Olesen, Frede
2013-01-01
Denne artikel ser nærmere på alment praktiserende lægers risiko for udbrændthed. Resultaterne viser, at lægernes risiko for at udvikle udbrændthed i løbet af en 7-års periode (2004-2012) var 13,2 %. De læger, som i 2004 havde været usikre på, om de ville vælge almen medicin som speciale, hvis de ...
Fernandes, Giovana [UNESP; Castanharo, Sabrina Maria [UNESP; Franco, Ana Lúcia [UNESP; Gonçalves, Daniela Aparecida de Godoi [UNESP; Camparis, Cinara Maria [UNESP
2011-01-01
Introduction: Bruxism has been defined as an oral parafunctional activity that includes clenching and/or grinding the teeth while asleep or awake. In addition to sleep bruxism (SB), various other orofacial movements sporadically occur during sleep. Occasional regurgitation and heartburn due to gastroesophageal reflux (GER) are frequent in the general population. GER refers to the presence of symptoms that are secondary to the reflux of gastric content through the esophagus with or without sig...
Directory of Open Access Journals (Sweden)
Özge Eliçin
2011-07-01
Full Text Available Bu araştırmada, Türkiye’de yaygın gelişimsel bozukluklar alanında 1990-2011 yılları arasında lisansüstü düzeyde gerçekleştirilen tez çalışmalarının gözden geçirilmesi amaçlanmıştır. Bu araştırma için kaynaklara Yüksek Öğretim Kurulu’nun internet sitesinden ulaşılmıştır. Taramada anahtar kelime olarak “otizm”, “otistik bozukluk”, “otizm spektrum bozukluğu/yaygın gelişimsel bozukluk”, “Asperger” kelimeleri kullanılmıştır. Bunun yanında Zihinsel Yetersizlik ve Gelişimsel Bozukluk Alanlarında Lisansüstü Tez Bibliyografyası (Diken, Ünlü ve Karaaslan, 2008 kitabından “otizm”, “otistik bozukluk” ve “yaygın gelişimsel bozukluk”, “Asperger” kelimelerini içeren tezler araştırmaya dâhil edilmiştir. Araştırmaya dâhil edilen tezlerde a yaygın gelişimsel bozukluklar alanından bir tanı almış çocuklarla ya da bu tanı kriterlerine sahip çocukların aileleriyle yürütülmüş olması b incelenen durumların (görüş, olgu, karşılaştırma, etki yaygın gelişimsel bozukluklar alanından bir tanı almış çocuklar için yapılmış olması c çalışmaların yüksek lisans ve doktora tezi olması özellikleri aranmıştır. Araştırmada bu amaçla gerçekleştirilen toplam 79 teze ulaşılmıştır. Tezlerin analizi aşamasında, tezler konularına göre 6 kategoriye ayrılmıştır. Her bir kategoride yer alan tezler karşılaştırmalı olarak incelenmiştir. The purpose of this study is to review graduate studies (master thesis and doctoral dissertations regarding pervasive developmental disorders (PDD carried out between 1990-2011 in Turkey. Graduate studies were reached through website of Higher Education Council of Turkey by using keywords of “autism, autistic disorder, and pervasive developmental disorder/autism spectrum disorders”. In addition, graduate studies listed in the book (Diken, Ünlü and Karaaslan, 2008 entitled “Bibliography of
International Nuclear Information System (INIS)
Morigeri, C.; Mukhopadhyay, K.; Narang, A.; Bhattacharya, A.; Mittal, B.R.
2008-01-01
Gastroesophageal reflux (GER) is very common in pre-term infants. The diagnosis based on symptoms is always questionable. The incidence of GER in symptomatic babies varies from 22% to 85%, but literature regarding the incidence of reflux in asymptomatic pre-term infants is lacking. We used radionuclide scintigraphy to evaluate the incidence of GER in symptomatic as well as asymptomatic pre-term neonates and to assess whether symptoms have any relation with positive scintigraphy. We studied 106 pre-term infants (52 symptomatic, 54 asymptomatic) of less than 34 weeks of gestation, who fulfilled the eligibility criteria. Babies were considered symptomatic in the presence of vomiting, regurgitation, apnea, de-saturations, unexplained bradycardia and recurrent lung collapses. Radionuclide scintigraphy was conducted at post-conceptional age of 32-34 weeks when they were clinically stable for 72 h. Feeding was avoided for 2 h preceding the study. 99m Tc sulphur colloid was administered in a dose of 1.85 MBq (0.05 mCi) in 1 ml, followed by milk (full feed) through an orogastric tube, prior to imaging under a gamma camera. Reflux was graded as low or high, and reflux episodes during the study were counted. The incidence of GER in the symptomatic group was 71.2% and in asymptomatic babies 61.1% (p=0.275). High-grade reflux was more common (71.4%) than low-grade (28.6%) in both groups (p=0.449). Mean number of reflux episodes in 20 min was 4.4±2.4 in symptomatic babies and 4.9 ±2.2 in asymptomatic babies (p=0.321). Babies with positive scintigraphy were similar in birth weight, gestation, time to achieve full feeds, weight and age at discharge to those with negative scintigraphy. GER is common in pre-term infants of less than 34 weeks gestation. The incidence of positive scintigraphy and grade of reflux is not significantly different in symptomatic vs. asymptomatic babies. Though radionuclide scintigraphy is a simple, quick and non-invasive investigation in suspected cases
Warburton, David; Warburton, Nicole; Wigfall, Clarence; Chimedsuren, Ochir; Lodoisamba, Delgerzul; Lodoysamba, Sereeter; Jargalsaikhan, Badarch
2018-04-01
Environmental pollution of the air, water, and soil comprise an increasingly urgent challenge to global health, well-being, and productivity. The impact of environmental pollution arguably has its greatest impact across the lifespan on children, women of childbearing age, and pregnant women and their unborn children, not only because of their vulnerability during development, but also because of their subsequent longevity. Ulaanbaatar, Mongolia, is a highly instructive, perhaps extreme, example of what happens with recent, rapid urbanization. It is the coldest capital city on Earth, where average ambient temperatures routinely fall below -40°C/F between November and February. During the cold winter period, more than 200,000 "Gers" (traditional felt-lined dwellings) in the "Ger district" burn over 600,000 tons of coal for domestic heating (>3 tons each). Thus, outdoor ambient particulate levels frequently exceed 100 times the WHO-recommended safety level for sustained periods of time, and drive the majority of personal particulate matter exposure. Indoor levels of exposure are somewhat lower in this setting because Gers are equipped with chimneys. Major adverse health impacts that we have documented in the Ger districts include the following: respiratory diseases among those between 1 and 59 years of age and cardiac diseases in those over 60; alarming increases in lung cancer rates in females are also beginning to emerge; and fertility and subsequent successful completion of term pregnancy falls by up to half during the winter pollution season, while early fetal death rises by fourfold. However, the World Bank has intervened with a Ger stove replacement project that has progressively reduced winter pollution by about 30% over the past 5 years, and this has been accompanied by an increase in mean term birth weight of up to 100g. Each incremental decrement in air pollution clearly has beneficial effects on pregnancy, which are likely to have the greatest positive
DEFF Research Database (Denmark)
Juul, Kristine; Schmidt, Jeanett; Kastanje, Maj
2012-01-01
Dette kapitel søger at belyse hvordan vestafrikanske hjemløse, der er kommet til Danmark som arbejdsmriganter klarer sig i København. Pga. vansligheder med at komme ind på det københavnske arbejdsmarked fratages de initiativet som arbejdstagere og overlever istedet som en art moderne jæger-samler......-samler folk gennem flaskesamling og som klienter på diverse sociale tilbud. Denne deroute er forbundet med hvad Goffman har betegnet som stigma....
Shopping Association Of Government Education Development In East Java
Muhamamd Guzali Tafalas; Deddy T. Tikson; Baharuddin; Hj. Hasniati
2017-01-01
The purpose of this study is to explain and analyze in detail The positive association Government spending in education PP with a Gross Enrolment Ratio GER and net enrollment ratio NER in East Java Province. Government spending on education is less associated significantly to the gross enrollment ratio at primary education. gross enrollment GER especially at the level of elementary education. As for the middle and high school level of education government spending on education was significant...
The influence of a solid and liquid bolus on food-stimulated gastroesophageal reflux
International Nuclear Information System (INIS)
Naeser, A.; Behrens, J.K.; Vejen-Christiansen, L.; Funch-Jensen, P.; Thommesen, P.; Aarhus Kommunehospital
1992-01-01
Using a radiological method to demonstrate food-stimulated gastroesophageal reflux (GER), a comparative study was carried out employing a solid, already validated bolus versus a liquid one. One hundred and four consecutive patients received both a solid and a liquid bolus in randomized order. GER was observed in 37 (35.6%) patients receiving the solid bolus versus 28 (26.9%) with the liquid one. This means that the solid bolus provokes significantly more reflux (P [de
Lyden af musik - er lyden af idealisme
DEFF Research Database (Denmark)
Eigtved, Michael
2015-01-01
Programartiklen til Det Ny Teaters opsætning af Rodgers & Hammersteins The Sound of Music, undersøger musicalgenrens - og især de konkrete ophavsmænds- affinitet til fremstillingen af såvel idealistiske som ideologiske universer.......Programartiklen til Det Ny Teaters opsætning af Rodgers & Hammersteins The Sound of Music, undersøger musicalgenrens - og især de konkrete ophavsmænds- affinitet til fremstillingen af såvel idealistiske som ideologiske universer....
DEFF Research Database (Denmark)
Sodemann, Morten
2016-01-01
Læger er dømt til langsom, pinagtig udryddelse som en flok intetanende, lidt for tungnemme, selvglade dinosaurer, hvis vi ikke begynder at tage os selv og patienterne mere alvorligt som mennesker på godt og ondt.......Læger er dømt til langsom, pinagtig udryddelse som en flok intetanende, lidt for tungnemme, selvglade dinosaurer, hvis vi ikke begynder at tage os selv og patienterne mere alvorligt som mennesker på godt og ondt....
Vogel, Marlene
2016-01-01
Der Umgang mit interaktiven Schnittstellen technischer Geräte gehört heute zum Alltag vieler Menschen. Diese Schnittstellen werden durch die zunehmende Funktionalität der Geräte komplexer. Beispielsweise sind die heutigen Mobiltelefone, sogenannte Smartphones, mit ihrer unterstützenden und umfangreichen Funktionalität nicht mehr aus dem Leben vieler Menschen wegzudenken. Dabei ist es nicht nur der effiziente Umgang mit der Technik, der u. a. für die Kaufentscheidung eine Bedeutung hat. Vielme...
Clinical and radiological characteristic of the gastroesophageal reflux disease in children
International Nuclear Information System (INIS)
Brankov, O.; Racheva, G.; Totev, M.; Antonova, D.
2007-01-01
Gastroesophageal reflux (GER) in children is a normal physiologic process that can progress to gastroesophageal reflux disease (GERD) when pathologic symptoms and complications appear. The pathogenesis of GER is related to a decrease pressure and transient relaxations of the lower esophageal sphincter, which is the most important factors contributing to reflux. If the history and physical examination reveal concerns of GERD further evaluation is necessary: esophageal pH monitoring, endoscopy, barium swallowing. The gold standard for the diagnosis of GERD is the 24-hour pH probe. Barium contrast radiography is useful to detect anatomic abnormalities, such as gaped cardia, reflux of contrast material, hiatal hernia, esophageal stricture and shortened esophagus. When compared to esophageal pH monitoring, the upper Gl series is less sensitive and specific for the diagnosis of GER, but is helpful as widely used first-step diagnosis in cases with symptomatic GERD. (authors)
Discovering forgeries of modern art by the 14C Bomb Peak
Caforio, L.; Fedi, M. E.; Mandò, P. A.; Minarelli, F.; Peccenini, E.; Pellicori, V.; Petrucci, F. C.; Schwartzbaum, P.; Taccetti, F.
2014-01-01
Exploiting the anomalous behaviour of the atmospheric radiocarbon concentration in the years after 1955 (so-called "Bomb Peak"), an alleged painting by Fernard Léger was unambiguously proven to be a fake just by dating the canvas support. Some art historians had questioned the authenticity of the painting, and their suspicions were fuelled by some scientific examinations of the paint materials (X-ray radiography, SEM-EDS), compared to those of another work unquestionably attributed to Léger. The decisive argument to prove that it was a fake was provided by the radiocarbon date obtained from a sample of canvas of the painting, using Accelerator Mass Spectrometry at the INFN-Labec laboratory in Florence. Beyond any doubt, the cotton plant from which the canvas was produced was cut no earlier than 1959, i.e. four years after Léger's death, thus definitely confirming the concerns of a fake.
Heller Myotomy Versus Heller Myotomy With Dor Fundoplication for Achalasia
Richards, William O.; Torquati, Alfonso; Holzman, Michael D.; Khaitan, Leena; Byrne, Daniel; Lutfi, Rami; Sharp, Kenneth W.
2004-01-01
Objective: We sought to determine the impact of the addition of Dor fundoplication on the incidence of postoperative gastroesophageal reflux (GER) after Heller myotomy. Summary Background Data: Based only on case series, many surgeons believe that an antireflux procedure should be added to the Heller myotomy. However, no prospective randomized data support this approach. Patients and Methods: In this prospective, randomized, double-blind, institutional review board-approved clinical trial, patients with achalasia were assigned to undergo Heller myotomy or Heller myotomy plus Dor fundoplication. Patients were studied via 24-hour pH study and manometry at 6 months postoperatively. Pathologic GER was defined as distal esophageal time acid exposure time greater than 4.2% per 24-hour period. The outcome variables were analyzed on an intention-to-treat basis. Results: Forty-three patients were enrolled. There were no differences in the baseline characteristics between study groups. Pathologic GER occurred in 10 of 21 patients (47.6%) after Heller and in 2 of 22 patients (9.1%) after Heller plus Dor (P = 0.005). Heller plus Dor was associated with a significant reduction in the risk of GER (relative risk 0.11; 95% confidence interval 0.02–0.59; P = 0.01). Median distal esophageal acid exposure time was lower in the Heller plus Dor (0.4%; range, 0–16.7) compared with the Heller group (4.9%; range, 0.1–43.6; P = 0.001). No significant difference in surgical outcome between the 2 techniques with respect to postoperative lower-esophageal sphincter pressure or postoperative dysphagia score was observed. Conclusions: Heller Myotomy plus Dor Fundoplication was superior to Heller myotomy alone in regard to the incidence of postoperative GER. PMID:15319712
Directory of Open Access Journals (Sweden)
Edward Surjono
2016-10-01
Full Text Available Background Gastroesophageal reflux (OER is involuntary movement of gastric content into esophagus due to transient lower esophageal sphincter relaxation. This condition usually ignored by physician. Many GER cases have severe complication before properly managed. Ten years after incorporating GER into Indonesia pediatric training curriculum, the knowledge of GER among pediatrician need to be measured. Objectives To measure pediatrician's knowledge of GER/GERD in children. Methods This was a cross sectional study using questionnaire and interview. Result There were 387 respondents who filled the questionnaire and being interviewed. The majority of respondents were between 25-45 years old (33.6%. Respondents who graduated before the year 2000 were 48.3%, and after 2000 were 51.7%. Majority of respondents were general pediatrician (90.2% and 41.3% working in teaching hospitals Among pediatricians graduated after year 2000,6 6%,5 0.5% and 57.5% could gave more than 80% correct answer to questions about general knowledge, diagnosis and management of GERD as compared to 49.2%, 42.2% and 47% subjects graduated before year 2000. More pediatricians graduated before year 2000 answered the questions on general knowledge, diagnosis and management < 60% correctly compared to those graduated after year 2000 (42.2%, 25.2% and 28.3% vs. 14%,11.5% and 12%, respectively. Fifty five of 160 (34.4% respondents who working in teaching hospital gave more than 80% correct answer to questions about GERD. Compared to those working in non-teaching hospitals, only 17.6% were able to correctly answer more than 80% of questions. Conclusions Better knowledge about GER/GERD are found among pediatricians graduated after the topics has been introduced to the curriculum and among those practicing in teaching hospitals.
Brown, Rachel; Sam, Cecilia H Y; Green, Tim; Wood, Simon
2015-06-01
Chewing gum alleviates symptoms of gastro-esophageal reflux (GER) following a refluxogenic meal. GutsyGum(tm), a chewing gum developed to alleviate the symptoms of GER contains calcium carbonate, with a proprietary blend of licorice extract, papain, and apple cider vinegar (GiGs®). The efficacy of GutsyGum(tm) was determined in alleviating the symptoms of GER after a refluxogenic meal compared to placebo gum. This double-blind, placebo-controlled-crossover trial with a one-week washout between treatments had 24 participants with a history of GER consume a refluxogenic meal and then chew GutsyGum(tm) or placebo gum. Participants completed GER symptom questionnaires, consisting of symptom based 10 cm Visual Analogue Scales, immediately following the meal and then at regular intervals out to four hours postmeal. Adjusted mean ± SEM heartburn score (15-min postmeal to 240 min) was significantly lower in GutsyGum(tm) than in placebo gum treatment (0.81 ± 0.20 vs. 1.45 ± 0.20 cm; p = 0.034). Mean acid reflux score was significantly lower in GutsyGum(tm) than in placebo treatment (0.72 ± 0.19 vs. 1.46 ± 0.19 cm; p = 0.013). There were no significant differences for any of the secondary outcomes. However, pain approached significance with less pain reported in GutsyGum(tm) versus placebo treatment (0.4 ± 0.2 vs. 0.9 ± 0.2 cm; p = 0.081). Although nausea (p = 0.114) and belching (p = 0.154) were lower following GutsyGum(tm), the difference was not statistically significant. GutsyGum(tm) is more effective than a placebo gum in alleviating primary symptoms of heartburn and acid reflux (Clinical Trial Registration: ACTRN12612000973819).
Ramírez-Mayans, J A; Toro-Monjaraz, E M; Romero-Trujillo, J; Cervantes-Bustamante, R; Zárate-Mondragón, F; Montijo-Barrios, E; Cadena-León, J; Cazares-Méndez, M
2014-01-01
Cow's milk protein allergy (CMPA) is being seen more frequently on a daily basis in pediatric consultations. It shares symptoms with gastroesophageal reflux (GER), which can complicate the differential diagnosis. To attempt to corroborate the presence of acid GER in children with CMPA, as well as to find a characteristic profile through the 24-hour pH monitoring study in children with GER and CMPA METHODS: The intraesophageal pH monitoring studies performed on 47 children with CMPA were reviewed. The measurements in all the studies were carried out within a 24-hour period using Digitrapper® equipment with a multi-use GeroFlex® catheter, after calibration with pH 7 and pH 1 buffer solutions. Of the 47 children, 23 were boys (32.4%) and 24 were girls (33.8%) and the mean age was 5±3.7 years. Fourteen of the 47 children (29%) presented with GER, according to the result of the 24-hour intraesophageal measurement. Only 2 of the 47 patients studied fit the phasic profile. The findings show the existing relation between the two pathologies. Nevertheless, it is important to determine the presence of non-acid or weak acid reflux, because their existence can increase this association. Copyright © 2013 Asociación Mexicana de Gastroenterología. Published by Masson Doyma México S.A. All rights reserved.
Decentralisering i et flexicurity perspektiv
DEFF Research Database (Denmark)
Ilsøe, Anna
2007-01-01
Artiklen undersøger, hvordan decentrale forhandlinger bidrager til udviklingen af flexicurity for forskellige medarbejdergrupper på det danske arbejdsmarked. Med baggrund i casestudier af forhandling af fl eksibel arbejdstid på fem virksomheder i industrien argumenteres der for, at decentraliseri......Artiklen undersøger, hvordan decentrale forhandlinger bidrager til udviklingen af flexicurity for forskellige medarbejdergrupper på det danske arbejdsmarked. Med baggrund i casestudier af forhandling af fl eksibel arbejdstid på fem virksomheder i industrien argumenteres der for...
Estudio y análisis medioambiental
Gaona Sánchez, Adrián; Ferrer Camacho, Nerea
2014-01-01
El objetivo de este proyecto es encontrar soluciones sostenibles de construcción para ayuda humanitaria, realizadas en Níger por Médicos Sin Fronteras en dos tiempos de actuación, construcciones temporales y permanentes. La metodología consiste en una caracterización del paisaje de Níger, realizando una serie de fichas conceptuales en las que se analizan constructivamente y funcionalmente las viviendas tradicionales de diversas zonas del país. Se sigue el mismo procedimiento...
Ryger troværdigheden ned, når vi taler læreruddannelsen op?
DEFF Research Database (Denmark)
Holm, Claus
2009-01-01
Nu er vi ved at få talt læreruddannelsen op af sin lavstatus. Resultatet er, at flere søger uddannelsen. Så må vi håbe, at talen er troværdig, for ellers vil frafaldet stige.......Nu er vi ved at få talt læreruddannelsen op af sin lavstatus. Resultatet er, at flere søger uddannelsen. Så må vi håbe, at talen er troværdig, for ellers vil frafaldet stige....
DEFF Research Database (Denmark)
Klausen, Søren Harnow
2011-01-01
Artiklen søger at rehabilitere Descartes' filosofiske psykologi ved at vise at beskyldningerne om at han skulle være for ensidigt rationalistisk og underkende realiteten og betydningen af førrefleksiv bevidsthed, følelser og kropsbevidsthed er forfejlede.......Artiklen søger at rehabilitere Descartes' filosofiske psykologi ved at vise at beskyldningerne om at han skulle være for ensidigt rationalistisk og underkende realiteten og betydningen af førrefleksiv bevidsthed, følelser og kropsbevidsthed er forfejlede....
Eosinophilic Esophagitis in Two Patients with Systemic Sclerosis
Directory of Open Access Journals (Sweden)
Tracy M. Frech
2016-01-01
Full Text Available The gastrointestinal tract (GIT is the most common extracutaneous organ system damaged in systemic sclerosis (SSc and is the presenting feature in 10% of patients. The esophagus as the portion of the GIT is the most commonly affected and there is an association of gastroesophageal reflux (GER with SSc interstitial lung disease (ILD. Thus, an aggressive treatment for GER is recommended in all SSc patients with ILD; however, it is recognized that a long-term benefit to this treatment is needed to understand its impact. In this case report we discuss the presence of eosinophilic esophagitis (EoE in two SSc patients and discuss the role for early EGD in SSc patients with moderate-severe GER symptoms for tissue study. Assessment of esophageal biopsy specimens for the presence of eosinophils and possibly ANA can help elucidate disease pathogenesis and direct therapy, as the presence of EoE in SSc has important management considerations, particularly with regards to dietary modification strategies.
Land use patterns and SO2 and NO2 pollution in Ulaanbaatar, Mongolia.
Huang, Yu-Kai; Luvsan, Munkh-Erdene; Gombojav, Enkhjargal; Ochir, Chimedsuren; Bulgan, Jargal; Chan, Chang-Chuan
2013-07-01
We proposed to study spatial distribution and source contribution of SO2 and NO2 pollution in Ulaanbaatar, Mongolia. We collected 2-week ambient SO2 and NO2 concentration samples at 38 sites, which were classified by major sources of air pollution such as ger areas and/or major roads, in three seasons as warm (September, 2011), cold (November-December, 2011), and moderate (March, 2012) in Ulaanbaatar. The SO2 and NO2 concentrations were collected by Ogawa ambient air passive samplers and analyzed by ion chromatography and spectrophotometry methods, respectively. Stepwise regression models were used to estimate the contribution of emission proxies, such as the distance to major roads, ger areas, power plants, and city center, to the ambient concentrations of SO2 and NO2. We found that the SO2 and NO2 concentrations were significantly higher in the cold season than in the warm and moderate seasons at all 38 ambient sampling sites. The SO2 concentrations in 20 ger sites (46.60 ppb in the cold season and 17.82 ppb in the moderate season) were significantly higher than in 18 non-ger sites (23.35 ppb in the cold season and 12.53 ppb in the moderate season). The NO2 concentrations at 19 traffic/road sites (12.85 ppb in the warm season and 20.48 ppb in the moderate season) were significantly higher than those at 19 urban sites (7.60 ppb and 14.39 ppb in the moderate season). Multiple regression models show that SO2 concentrations decreased by 23% in the cold and 17% in the moderate seasons at 0.70 km from the ger areas, an average of all sampling sites, and by 29% in the moderate season at 4.83 km from the city center, an average of all sampling sites. Multiple regression models show that the NO2 concentrations at 4.83 km from the city center decreased by 38% in the warm and 29% in the moderate seasons. Our models also report that NO2 concentrations at 0.16 km from the main roads decreased by 15% and 9% in the warm and the moderate seasons, respectively, and by 16% in the
DEFF Research Database (Denmark)
Hollnagel, H.; Malterud, K.
1995-01-01
I artiklen beskrives vejen fra idé til projekt om selvvurderede helbredsressourcer. Der tages udgangspunkt i "sundhedsbrøken" beskrevet i de almenmedicinske lærebøger fra 1977: Hvis en persons belastninger gennem længere tid er for store i forhold til personens ressourcer, så er personens helbred......? Som læger er vi vant til den patogenetiske synsvinkel (pato=syg, genese=oprindelse) og spørger, hvordan opstår sygdom? Hvordan kan vi helbrede og forebygge sygdom? Udgivelsesdato: 1995...
Augmented reality som wearable
DEFF Research Database (Denmark)
Buhl, Mie; Rahn, Annette
2015-01-01
Artiklen omhandler design og implementering af Augmented Reality (AR) i form af en wearable i sygeplejerskeuddannelsens anatomiundervisning, mere specifikt undervisning i lungeanatomi og respiration, med fokus på potentialer for visuel læring. Projektet undersøger, hvordan en udviklet AR-applikat......Artiklen omhandler design og implementering af Augmented Reality (AR) i form af en wearable i sygeplejerskeuddannelsens anatomiundervisning, mere specifikt undervisning i lungeanatomi og respiration, med fokus på potentialer for visuel læring. Projektet undersøger, hvordan en udviklet AR...
DEFF Research Database (Denmark)
Pedersen, Jens Olaf Pepke
2016-01-01
I stå. Forskningen i den arabisk-islamiske verden nåede sit højdepunkt mellem det ottende og 12. århundrede, men siden gik den i stå. En Harvard-økonom forsøger at kaste lys over årsagerne.......I stå. Forskningen i den arabisk-islamiske verden nåede sit højdepunkt mellem det ottende og 12. århundrede, men siden gik den i stå. En Harvard-økonom forsøger at kaste lys over årsagerne....
Individualiseringens vindere og tabere
DEFF Research Database (Denmark)
Rasborg, Klaus
2013-01-01
Snarere end værdiforfald og egoisme er nutidens individualisering ensbetydende med fremkomsten af nye værdier, deltagelsesformer og politiske orienteringsmønstre. Der er imidlertid både vindere og tabere i individualiseringsspillet, hvilket artiklen forsøger at vise.......Snarere end værdiforfald og egoisme er nutidens individualisering ensbetydende med fremkomsten af nye værdier, deltagelsesformer og politiske orienteringsmønstre. Der er imidlertid både vindere og tabere i individualiseringsspillet, hvilket artiklen forsøger at vise....
Et nyt perspektiv på magt i det sociale arbejde
DEFF Research Database (Denmark)
Prieur, Annick; Henriksen, Lars Skov
2004-01-01
Artiklen er et reviewessay af to bøger: M. Järvinen, J. E. Larsen og N. Mortensen (red.): Det magtfulde møde mellem system og klient (2002) og M. Järvinen og N. Mik-Meyer (red.): At skabe en klient (2003).......Artiklen er et reviewessay af to bøger: M. Järvinen, J. E. Larsen og N. Mortensen (red.): Det magtfulde møde mellem system og klient (2002) og M. Järvinen og N. Mik-Meyer (red.): At skabe en klient (2003)....
Prügiveo hind hakkab olenema inimesest endast / Peep Aaviksoo ; interv. Jaan Rõõmussaar
Aaviksoo, Peep, 1956-
2004-01-01
Ilmunud ka: Stolitsa, 5. nov. 2004, lk. 3. AS-i Tallinna Prügila taotles prügi ladestamishinna tõstmist, ettevõtlusameti hinna ja tarbijakaitse osakond pidas taotletavat hinda liiga kõrgeks. Tallinna abilinnapea vastab küsimustele prügimajanduse kota
(Konstitutsiooniline) renvoi: kas põhiseaduslik nõue või kaera Trooja hobusele? / Berit Aaviksoo
Aaviksoo, Berit, 1978-
2015-01-01
Võrdsuspõhiõiguse ning pöörddiskrimineerimise kaotamise nõude mõjust Eesti õiguskorras. Artikkel põhineb 3. oktoobril 2014 Tartus 33. Eesti õigusteadlaste päevadel „Kümme aastat õiguslõimet“ peetud ettekandel
Sõjaraamatu hävitamisel on seos Eestiga / Hendrik Vosman, Tuuli Koch ; kommenteerinud Jaak Aaviksoo
Vosman, Hendrik
2011-01-01
Suurbritannia ajakirjaniku Toby Harndeni Afganistani sõda käsitlevast raamatust "Dead Men Risen: The Welsh Guards and the Real Story of Britain's War in Afganistan" ("Ülestõusnud surnud: Walesi kaardivägi ja tegelik lugu brittide sõjast Afganistanis"). Briti kaitseministeerium lükkab ümber Harndeni väite raamatu ümber puhkenud skandaali poliitilisest tagamaast, autori arvates kartis kaitseministeerium, et raamatus leiduv info võiks Eestit ärritada
International Development Research Centre (IDRC) Digital Library (Canada)
Il n'a pas été conçu pour guider la politique des États en cas d'attaque contre leurs ..... Une stratégie a été définie à cette occasion pour nous permettre de nous ...... et dont d'autres sont nouveaux, par exemple le recrutement d'enfants soldats.
Suhtlustarkvara Skype levib tohutu kiirusega / Gerli Ramler
Ramler, Gerli
2006-01-01
Skype'i Eesti turundusjuht Andrus Purde sõnul seab Skype pilgud ka traditsioonilise jaekaubanduse poole; Skype'i uutest toodetest. Kommenteerib Customstar OÜ juhatuse liige Väino Laisaar. Vt. samas: Elion veel Skype'i endale ohtlikuks ei pea
Elever undersøger akustik i klasselokaler
DEFF Research Database (Denmark)
Juhl, Peter Møller; Pedersen, Ellen Raben
2010-01-01
kroppens vigtigste sanser og er sammen med talen den altovervejende formidler af kommunikation mellem lærer og elev. Deltagerne i Masseeksperimentet fik tilsendt identiske forsøgsmaterialer, så de kunne undersøge de akustiske forhold i klasselokalet på samme måde landet rundt. I eksperimentet målte...... (ved katederet eller ved tavlen). Lydfilerne var tilsat kunstig støj i form af skratten og kratten for at simulere en normal undervisningssituation med den baggrundsstøj, der uundgåeligt følger med fra elever, naboklasser, larm fra gaden, græsslåning, udsugningsanlæg, computere og projektor etc....
Acid Reflux (GER and GERD) in Adults
... Treatment Eating, Diet, & Nutrition Clinical Trials Peptic Ulcers (Stomach Ulcers) Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Proctitis Definition & Facts Symptoms & ... Definition & Facts Symptoms & Causes Diagnosis Treatment Eating, ...
Øger social tillid den etniske tolerance?
DEFF Research Database (Denmark)
Simonsen, Kristina Bakkær; Thomsen, Jens Peter Frølund
2013-01-01
that the relationship between social trust and ethnic tolerance is very weak among those who strongly prefer national cultural homogeneity. This finding suggests that parts of the international literature have overestimated the ability of social trust to create inclusive and coherent societies. The empirical analysis......Does Social Trust Increase Ethnic Tolerance? An Analysis of Cultural Reservations Previous research has emphasized that social trust makes modern societies more cohesive. Social trust is commonly defined as a faith in the unknown other. A number of previous studies have shown that trusters are also...... tolerant toward ethnic minority members. This article contributes to social trust research by examining the extent to which the relationship between social trust and tolerance toward ethnic minority members is conditioned by the preference for national cultural homogeneity. The empirical analysis shows...
Acid Reflux (GER & GERD) in Children & Teens
... the National Institutes of Health (NIH) conduct and support basic and clinical research into many digestive disorders. Related News NIAID scientists identify cause, possible treatment for life-threatening gut condition Jun 29, 2017 An enzyme ...
Czech Academy of Sciences Publication Activity Database
Svoboda, Jiří
2006-01-01
Roč. 1, - (2006), s. 52-57 ISSN 0170-2971 Institutional research plan: CEZ:AV0Z80010507 Keywords : Moravia * Gravettian * Dolní Věstonice, Pavlov Subject RIV: AC - Archeology, Anthropology, Ethnology
Alicia Parra-Carriedo; Loren Cherem-Cherem; Daniela Galindo-De Noriega; Mary Carmen Díaz-Gutiérrez; Ana Bertha Pérez-Lizaur; César Hernández-Guerrero
2013-01-01
Introducción: La determinación del gasto energético en reposo (GER) se calcula cotidianamente a partir de fórmulas predictivas aunque el resultado varía dependiendo de la población. Objetivo: Comparar la determinación del GER mediante calorimetría indirecta y mediante las ecuaciones Harris-Benedict (HB), Mifflin (MF), Organización Mundial de la Salud (OMS), "Institute of Medicine" (IOM), Fórmula Rápida (FR) y Valencia (VA) en mujeres con grados de obesidad I a III. Métodos: Mujeres adultas me...
Aktionslæring og Aktionsforskning - Refleksioner over et kursusforløb i Internet marketing
DEFF Research Database (Denmark)
Rask, Morten
2002-01-01
Denne evaluering undersøger underviserens og de studerendes erfaringer med en kursusform som forsøger at koble aktionsforskning og undervisning ved brug af informations- og kommunikationsteknologi. Hensigten er at vise, hvorledes de studerendes, underviserens og virksomhedens reflektionsrum øges...... når denne kursusform er i anvendelse. Formålet er at skabe en bedre forståelse af sammenhængen mellem undervisning og aktionsforskning som faciliteres af brugen af informations- og kommunikationsteknologi som en integreret del af undervisningen. Evalueringen viser, at de studerende er glade for denne...
Videnssamfundet i det 12. og 13. århundrede. Forskning og formidling
DEFF Research Database (Denmark)
Bloch, David; Ebbesen, Sten
Bogen undersøger de metoder og de litterære genrer, ved hvilke middelalderens tænkere bedrev og formidlede deres forskning. Den argumenterer for, at de havde et særdeles velfungerende system, der sikrede muligheder for god formidling til de forskellige målgrupper.......Bogen undersøger de metoder og de litterære genrer, ved hvilke middelalderens tænkere bedrev og formidlede deres forskning. Den argumenterer for, at de havde et særdeles velfungerende system, der sikrede muligheder for god formidling til de forskellige målgrupper....
ESTUDO DA VIABILIDADE DA APLICAÇÃO DE TÉCNICAS DE GERENCIA DO CONHECIMENTO NA EDUCAÇÃO TECNOLOGICA
Lins, Hertz Wilton; Sival, Cláudio Rodrigues Muniz da
2010-01-01
Este trabalho tem o objetivo de examinar conceitos e aspectos da Gerência do Conhecimento (GC) que possam contribuir no desenvolvimento de ferramentas mais adaptadas para os desafios atuais da Educação tecnológica (ET). A Gerência do Conhecimento pode ser vista, essencialmente, como uma disciplina que fornece subsídios para o projeto de processos que, ao longo de seus ciclos de vida, se beneficiam da extração formal automática do conhecimento utilizado nos mesmos. A idéia principal é a utili...
Hvad snakker de om - hvad taler vi om? Danske soaps i genreanalytisk perspektiv
DEFF Research Database (Denmark)
From, Unni
2003-01-01
Afhandlingen har den danske soap som genstandsfelt og undersøger gennem en række tekstanalyser genrens konstituerende træk. I en empirisk publikumsundersøgelse sætter afhandlingen fokus på serien "Taxas" modtagelse i en dansk og en svensk kontekst.......Afhandlingen har den danske soap som genstandsfelt og undersøger gennem en række tekstanalyser genrens konstituerende træk. I en empirisk publikumsundersøgelse sætter afhandlingen fokus på serien "Taxas" modtagelse i en dansk og en svensk kontekst....
Virus kan påvises i spyt fra grise
DEFF Research Database (Denmark)
Heiselberg, Pia R.; Christensen, Sanne; Hjulsager, Charlotte Kristiane
2012-01-01
Svinedyrlæger har muligheden for at udskifte blodprøveglas og kanyler med reb til indsamling af spyt. DTU Veterinærinstituttet har valideret metoderne til at teste spyt for PCV2, PRRS- og Influenza virus, og laboratoriet modtager nu spytprøver rutinemæssigt.......Svinedyrlæger har muligheden for at udskifte blodprøveglas og kanyler med reb til indsamling af spyt. DTU Veterinærinstituttet har valideret metoderne til at teste spyt for PCV2, PRRS- og Influenza virus, og laboratoriet modtager nu spytprøver rutinemæssigt....
DEFF Research Database (Denmark)
Rasmussen, Rasmus Kjærgaard
2007-01-01
Denne artikel handler om, hvad konspirationsteorier er, og hvilken social, politisk og kulturel praksis dette komplekse fænomen er udtryk for. Med udgangspunkt i hypotesen om, at der eksisterer en global konspirationskultur, undersøger artiklen hvordan konspirationsteorier på globalt plan i disse...... år dels fungerer som en moddiskurs, dels som grundfortællinger om magt og ondskab. Jeg belyser disse pointer med udgangspunkt i to konspirationsteorier fra henholdsvis USA og Mellemøsten, der på hver deres måde søger at forklare angrebene den 11. september 2001....
DEFF Research Database (Denmark)
Bang, Peter Fibiger
2009-01-01
Denne artikel forsøger at syntetisere vores viden om de forskellige dimensioner af arbejde i antikken, rækkende lige fra overklassens kulturelle hegemoni, til slaveri, bondebrug og mange højt specialiserede håndværkere, der arbejdede i de antikke byers "bazaarer".......Denne artikel forsøger at syntetisere vores viden om de forskellige dimensioner af arbejde i antikken, rækkende lige fra overklassens kulturelle hegemoni, til slaveri, bondebrug og mange højt specialiserede håndværkere, der arbejdede i de antikke byers "bazaarer"....
Just War? Iraq in the Bonfire between Walzer, Zizek, Hardt and Negri
DEFF Research Database (Denmark)
Zangenberg, Mikkel
2008-01-01
Artiklen undersøger det generelle spørgsmål om retfærdig krig, og om relationen mellem intellektuelle og krig, ved at inspicere henholdsvis Michael Walzer, Slavoj Zizek, Michael Hardt og Antonio Negris manøvrer overfor USA's krig i Irak.......Artiklen undersøger det generelle spørgsmål om retfærdig krig, og om relationen mellem intellektuelle og krig, ved at inspicere henholdsvis Michael Walzer, Slavoj Zizek, Michael Hardt og Antonio Negris manøvrer overfor USA's krig i Irak....
DEFF Research Database (Denmark)
Munk-Hansen, Carsten
Fremstillingen påviser, at lov om forbrugerbeskyttelse ved erhvervelse af fast ejendom mv. lider af en række svagheder og at ankenævnspraksis bevæger sig væk fra retspraksis på en række områder.......Fremstillingen påviser, at lov om forbrugerbeskyttelse ved erhvervelse af fast ejendom mv. lider af en række svagheder og at ankenævnspraksis bevæger sig væk fra retspraksis på en række områder....
DEFF Research Database (Denmark)
Bonde, Anders
2012-01-01
Anmeldelse af koncertarrangementet "A Song for Bayes" på Skråen, Aalborg, d. 27. februar 2012 - et musikalsk eksperiment, der undersøger, om man kan lave musik ud fra Bayesianske net, og hvordan (http://bayesmusic.wordpress.com/hvad-er-en-sang-for-bayes/).......Anmeldelse af koncertarrangementet "A Song for Bayes" på Skråen, Aalborg, d. 27. februar 2012 - et musikalsk eksperiment, der undersøger, om man kan lave musik ud fra Bayesianske net, og hvordan (http://bayesmusic.wordpress.com/hvad-er-en-sang-for-bayes/)....
Religious Imagery in Popular Music Theatre
DEFF Research Database (Denmark)
Eigtved, Michael
2007-01-01
Artiklen undersøger hvordan religiøse billeder, narrative strategier og andre elementer er en del af musicalgenren. Der foretages en mere indgående analyse af Richard Rodgers' og Oscar Hammersteins forestilling Carousel samt af Andrew LLoyd Webber og Tim Rices forestilling Evita.......Artiklen undersøger hvordan religiøse billeder, narrative strategier og andre elementer er en del af musicalgenren. Der foretages en mere indgående analyse af Richard Rodgers' og Oscar Hammersteins forestilling Carousel samt af Andrew LLoyd Webber og Tim Rices forestilling Evita....
Directory of Open Access Journals (Sweden)
Simone Teresinha Protti
2010-09-01
Full Text Available Neste estudo analisamos a gerência das Unidades Básicas de Saúde no controle da Tuberculose em um município do interior de São Paulo. Participaram do estudo 14 gerentes; a coleta dos dados foi realizada por meio de um questionário fechado e uma questão aberta, e também por meio de entrevista com consentimento livre e esclarecido. Para o tratamento dos dados, utilizamos o Programa Statística 8.0 da Statsoft, e para os dados qualitativos, utilizamos a técnica de análise de conteúdo, modalidade temática. Fica explícita uma gerência técnico-burocrática, com debilidades nas dimensões do planejamento e organização das atividades dos serviços de saúde. Assim, os gerentes desta investigação necessitam incorporar aspectos do planejamento e organização como forma de viabilizar a política de controle da TB.En este estudio analizamos el gerenciamiento de las Unidades Básicas de Salud en el control de la Tuberculosis en un municipio del interior de San Pablo, Brasil. Participaron del estudio 14 gerentes. La recolección de datos fue realizada a través de un cuestionario cerrado y una pregunta abierta, más entrevista con consentimiento libre y esclarecido. Para el tratamiento de los datos, utilizamos el programa Statistica 8.0 de la compañía Starsoft; y para los datos cualitativos, se usó la técnica de análisis de contenidos, modalidad temática. Quedó evidenciada una gerencia técnico-burocrática, con debilidad en las dimensiones de planeamiento y organización de las actividades de los servicios de salud. De tal modo, los gerentes que participaron de esta investigación necesitan incorporar aspectos de planeamiento y organización como modo de viabilizar la política de control de la TB.In this study we analyzed the management of Basic Health Units in terms of Tuberculosis (TB control in a city in the interior of São Paulo state. Fourteen managers participated in the study. A closed questionnaire was administered and an
Gastroesophageal reflux: comparison of barium studies with 24-h pH monitoring
International Nuclear Information System (INIS)
Pan, John J.; Levine, Marc S.; Redfern, Regina O.; Rubesin, Stephen E.; Laufer, Igor; Katzka, David A.
2003-01-01
Objective: To determine the correlation between massive gastroesophageal reflux (GER) on barium studies and pathologic acid reflux on 24-h pH monitoring. Methods: A search of hospital records from January 1997 to January 2001 revealed 28 patients who underwent both barium studies and 24-h pH monitoring. The radiologic reports were reviewed to determine the presence and degree of GER. Patients with reflux to or above the thoracic inlet either spontaneously or with provocative maneuvers in the recumbent position were classified as having massive reflux, whereas the remaining patients with reflux below the thoracic inlet or no reflux comprised the control group. The pH monitoring reports were also reviewed to determine if pathologic acid reflux was present in the recumbent position. The findings on these studies were then compared to determine the frequency of pathologic acid reflux in the recumbent position on pH monitoring in patients with massive reflux on barium studies compared with the control group. Results: Massive GER was observed on barium studies in 11 (39%) of the 28 patients and reflux below the thoracic inlet or no reflux in the remaining 17 patients (61%) who comprised the control group. All 11 patients (100%) with massive reflux on barium studies had pathologic acid reflux on pH monitoring in the recumbent position compared with six (35%) of 17 patients in the control group (P=0.0009). The pH in the distal esophagus on pH monitoring was less than 4.0 for 13.1% of the recumbent period for patients with massive GER on barium studies compared with 6.2% of the recumbent period for the control group (P=0.0076). Conclusion: Although 24-h pH monitoring remains the gold standard for the detection of GER, our experience suggests that patients with massive reflux on barium studies are so likely to have pathologic acid reflux in the recumbent position that these individuals can be further evaluated and treated for their gastroesophageal reflux disease (GERD
Does Nissen fundoplication improve deglutition in children?
Soyer, Tutku; Yalçın, Şule; Demir, Numan; Karhan, Asuman Nur; Saltık-Temizel, İnci Nur; Demir, Hülya; Tanyel, Feridun Cahit
2017-01-01
Soyer T, Yalçın Ş, Demir N, Karhan AN, Saltık-Temizel İN, Demir H, Tanyel FC. Does Nissen fundoplication improve deglutition in children? Turk J Pediatr 2017; 59: 28-34. A prospective study was performed to evaluate the effect of Nissen fundoplication (NF) on deglutition in children. Children who underwent NF between 2011-2015 were evaluated for demographic features, clinical findings, diagnostic methods for gastroesophageal reflux (GER) and indications for NF. Penetration aspiration scale (PAS), functional oral intake scale (FOIS) and esophageal functions were evaluated by videoflouroscopy (VFS). Preoperative and postoperative VFS findings were compared to evaluate the effect of NF on clinical findings and deglutition. Twenty-three children with a mean age of 5.08 ± 3.7 years were included. Female to male ratio was 15:8. Recurrent respiratory infections (RTI) (n: 14, 60.8%), swallowing dysfunction (n:13, 56.5%) and vomiting (n:10, 43.4%) were the most common symptoms. Preoperatively GER was diagnosed with barium swallowing study (BSS) contrast graphs (n:20, 87%) and with 24-hour esophageal pH monitorization (n:8, 34.8%). In 39.1% of patients, medical treatment for GER was used with a mean duration of 8 ± 5.8 months. Indications for NF were swallowing dysfunction (n: 18, 78%), GER complications (n:6, 26%), associated anatomical problems (n:4, 17.3%) and unresponsiveness to medical treatment (n: 3, 13%). Postoperative barium swallowing study and 24-hour esophageal pH monitorization showed no GER after NF in 95% of patients. Number of RTI were significantly decreased after NF (preoperative vs postoperative infection rate 4.21 vs 1.6 respectively, p sophageal opening (UEO) was decreased when compared to preoperative VFS findings (p sophageal cleaning, esophageal motility, esophageal backflow and lower esophageal sphincter narrowing did not alter after NF (p > 0.05). FOIS were significantly improved after NF (p sophageal motility evaluated by VFS did not changed
Batista, E D; Detmann, E; Valadares Filho, S C; Titgemeyer, E C; Valadares, R F D
2017-08-01
In ruminants, urea recycling is considered an evolutionary advantage. The amount of urea recycled mainly depends of the nitrogen (N) intake and the amount of organic matter (OM) digested in the rumen. Because recycled N contributes to meeting microbial N requirements, accurate estimates of urea recycling can improve the understanding of efficiency of N utilization and N losses to the environment. The objective of this study was to evaluate urea kinetics and microbial usage of recycled urea N in ruminants using a meta-analytical approach. Treatment mean values were compiled from 25 studies with ruminants (beef cattle, dairy cows and sheep) which were published from 2001 to 2016, totalling 107 treatment means. The data set was analyzed according to meta-analysis techniques using linear or non-linear mixed models, taking into account the random variations among experiments. Urea N synthesized in the liver (UER) and urea N recycled to the gut (GER) linearly increased (PCP concentration and the ratio of CP to digestible OM (CP:DOM). Maximum curvature analyses identified 17% dietary CP as the point where there was a prominent increase in hepatic synthesis of urea N, likely due to an excess of dietary N leading to greater ammonia absorption. The GER:UER decreased with increasing dietary CP concentration (PCP⩾19%, GER:UER reached near minimal values. The fraction of UER eliminated as urinary urea N and the contribution of urea N to total urinary N were positively associated with dietary CP (PCP was 17%. The fractions of GER excreted in the feces and utilized for anabolism decreased, whereas the fraction of GER returned to the ornithine cycle increased with dietary CP concentration (PCP and CP:DOM increased (PCP/kg DOM. The models obtained in this study contribute to the knowledge on N utilization, and they could be used in feeding models to predict urea recycling and thus to improve formulation of diets to reduce N losses that contribute to air and water pollution.
Bellaïche, M; Bargaoui, K; Jung, C; Maigret, P; Clerson, P
2017-01-01
The supine sleeping position with the head higher than the legs has no impact on regurgitations in infants. Inclined ventral decubitus decreases regurgitations but is associated with an increased risk of sudden infant death syndrome (SIDS). The LUNE study aimed to evaluate the impact of regurgitations on the choice of sleeping position by pediatricians and parents. Cross-sectional case-control study (ratio 1:1) conducted in France in 2013. A representative sample of pediatricians recruited 3-week to 4-month-old breast- or formula-fed infants. Cases and controls were defined by the presence or absence of regurgitations. Collected data included Vandenplas codification for regurgitations (VD, range 0-6), associated symptoms, and variations in sleeping position since maternity hospital discharge. A total of 1347 cases and 1346 controls were recruited by 493 pediatricians. Regurgitations were evaluated at VD1 (minor, 22 % of cases), VD2 (mild, 47 % of cases), or VD≥3 (moderate to severe, 31 % of cases). At the maternity hospital, the supine position was recommended to 96 % of parents for SIDS prevention. Since discharge, parents asked questions about the relationship between sleeping position and regurgitations (79 % of infants with GER versus 45 % of controls). The sleeping position was modified at least once since maternity discharge (42 % of infants with GER versus 35 % of controls). At inclusion, 86 % of infants with GER and 86 % of controls were sleeping on their back. Fifty-one percent of infants with GER and 28 % of controls slept in an inclined position. Pediatricians repeated the prescription of dorsal decubitus for 91 % of infants with GER and recommended an inclined position in 70 %. Regurgitations had no impact on supine sleeping position. The inclined supine sleeping position was more frequent in infants with regurgitations with pediatricians' assent, which is not in agreement with evidence-based medicine. Copyright © 2016 Elsevier Masson
Gastroesophageal reflux: comparison of barium studies with 24-h pH monitoring
Energy Technology Data Exchange (ETDEWEB)
Pan, John J.; Levine, Marc S. E-mail: levine@oasis.rad.upenn.edu; Redfern, Regina O.; Rubesin, Stephen E.; Laufer, Igor; Katzka, David A
2003-08-01
Objective: To determine the correlation between massive gastroesophageal reflux (GER) on barium studies and pathologic acid reflux on 24-h pH monitoring. Methods: A search of hospital records from January 1997 to January 2001 revealed 28 patients who underwent both barium studies and 24-h pH monitoring. The radiologic reports were reviewed to determine the presence and degree of GER. Patients with reflux to or above the thoracic inlet either spontaneously or with provocative maneuvers in the recumbent position were classified as having massive reflux, whereas the remaining patients with reflux below the thoracic inlet or no reflux comprised the control group. The pH monitoring reports were also reviewed to determine if pathologic acid reflux was present in the recumbent position. The findings on these studies were then compared to determine the frequency of pathologic acid reflux in the recumbent position on pH monitoring in patients with massive reflux on barium studies compared with the control group. Results: Massive GER was observed on barium studies in 11 (39%) of the 28 patients and reflux below the thoracic inlet or no reflux in the remaining 17 patients (61%) who comprised the control group. All 11 patients (100%) with massive reflux on barium studies had pathologic acid reflux on pH monitoring in the recumbent position compared with six (35%) of 17 patients in the control group (P=0.0009). The pH in the distal esophagus on pH monitoring was less than 4.0 for 13.1% of the recumbent period for patients with massive GER on barium studies compared with 6.2% of the recumbent period for the control group (P=0.0076). Conclusion: Although 24-h pH monitoring remains the gold standard for the detection of GER, our experience suggests that patients with massive reflux on barium studies are so likely to have pathologic acid reflux in the recumbent position that these individuals can be further evaluated and treated for their gastroesophageal reflux disease (GERD
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 57 ... Query: 132 GERAAPPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRIL...AKRAPR 187 ... GER ... PPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAP+ Sbjct: 2 ... GERVEPPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK 57
Gastroesophageal reflux disease
International Nuclear Information System (INIS)
Kault, B.; Halvorsen, T.; Petersen, H.; Grette, K.; Myrvold, H.E.
1986-01-01
Radionucleotide scintigraphy and esophagoscopy with biopsy were carried out in 101 patients with symptoms strongly suggestive of gastroesophageal reflux (GER) disease. GER was visualized by scintigraphy in 86.1% of the patients. Endoscopic and histologic esophagitis were found in 68.1% and 58.4% of the patients, respectively, whereas both examinations taken together showed evidence of esophagitis in 82%. Histologic evidence of esophagitis was found in nearly all patients with severe endoscopic changes, and in 43.7% of the patients with no endoscopic abnormality. Scintigraphic reflux was demonstrated more frequently (p<0.05) in the patients with severe endoscopic esophagitis (97.5%) than in those with no or only mild endoscopic changes (78.6%). Scintigraphic reflux was found in 91.5% and 78.5% of the patients with and without histologic evidence of esophagitis (p=0.07). 15 of the 18 patients (83.3%) without endoscopic and histologic abnormalities in the esophagus had scintigraphic evidence of reflux. The present study strongly supports the clinical significance of scintigraphy in GER disease and confirms that esophageal biopsy specimens increase the sensitivity of endoscopic evaluation
DEFF Research Database (Denmark)
Pedersen, Anette F; Carlsen, Anders H; Vedsted, Peter
2015-01-01
Denne artikel undersøger, om variationen i raten af PSA-tests mellem alment praktiserende læger kan forklares af psykologiske faktorer som f.eks. lægens risikovillighed. Resultaterne viser, at lægens risikovillighed influerer på raten af PSA-tests. Forfatterne finder blandt andet, at patienter, som...... er registreret hos en læge med mange bekymringer for fejlbehandlinger, har større sandsynlighed for at få taget en PSA-test. Patienter, som er registreret hos en læge, som har en høj tolerance for flertydighed i lægearbejdet, har derimod mindre sandsynlighed for at få foretaget en PSA-test. Patienter......, som er registreret hos en læge med høj tolerance for flertydighed eller en tilbøjelighed til risikobetonet adfærd, har en mindre sandsynlighed for at få gentaget en tidligere normal PSA-test. Undersøgelsen bygger på spørgeskemabesvarelser fra 129 alment solo-praktiserende læger i Region Midtjylland...
Peeters, R P; Ng, L; Ma, M; Forrest, D
2015-05-15
Apoptosis underlies various forms of tissue remodeling during development. Prior to the onset of hearing, thyroid hormone (T3) promotes cochlear remodeling, which involves regression of the greater epithelial ridge (GER), a transient structure of columnar cells adjacent to the mechanosensory hair cells. We investigated the timecourse of apoptosis in the GER and the influence of ectopic T3 on apoptosis. In saline-treated mice, activated caspase 3-positive cells were detected in the GER between postnatal days 7 and 13 and appeared progressively along the cochlear duct from base to apex over developmental time. T3 given on P0 and P1 advanced the overall program of apoptosis and remodeling by ~4 days. Thyroid hormone receptor β was required for these actions, suggesting a receptor-mediated process of initiation of apoptosis. Finally, T3 given only at P0 or P1 resulted in deafness in adult mice, thus revealing a transient period of susceptibility to long-term damage in the neonatal auditory system. Published by Elsevier Ireland Ltd.
Gastroesophageal reflux disease. Scintigraphic, endoscopic and histologic considerations
Energy Technology Data Exchange (ETDEWEB)
Kault, B.; Halvorsen, T.; Petersen, H.; Grette, K.; Myrvold, H.E.
1986-01-01
Radionucleotide scintigraphy and esophagoscopy with biopsy were carried out in 101 patients with symptoms strongly suggestive of gastroesophageal reflux (GER) disease. GER was visualized by scintigraphy in 86.1% of the patients. Endoscopic and histologic esophagitis were found in 68.1% and 58.4% of the patients, respectively, whereas both examinations taken together showed evidence of esophagitis in 82%. Histologic evidence of esophagitis was found in nearly all patients with severe endoscopic changes, and in 43.7% of the patients with no endoscopic abnormality. Scintigraphic reflux was demonstrated more frequently in the patients with severe endoscopic esophagitis (97.5%) than in those with no or only mild endoscopic changes (78.6%). Scintigraphic reflux was found in 91.5% and 78.5% of the patients with and without histologic evidence of esophagitis. 15 of the 18 patients (83.3%) without endoscopic and histologic abnormalities in the esophagus had scintigraphic evidence of reflux. The present study strongly supports the clinical significance of scintigraphy in GER disease and confirms that esophageal biopsy specimens increase the sensitivity of endoscopic evaluation. 31 refs.
Emerging Geoscience Education Research at the University of British Columbia
Jones, F. M.; Harris, S.; Wieman, C.; Gilley, B.; Lane, E.; Caulkins, J.
2009-12-01
Geoscience education research (GER) in UBC’s Department of Earth and Ocean Sciences (EOS) began due to a well funded 5-yr Faculty of Science project called the Carl Wieman Science Education Initiative (CWSEI). This initiative takes an evidence-based, scientific approach to improving education by 1) establishing what students should learn; 2) scientifically measuring what students are learning; 3) adapting instruction and curricula using effective technologies and pedagogical research; and 4) disseminating and adopting what works. The presentation will discuss how this initiative has fostered a growing GER presence within our Department. CWSEI funding has enabled the EOS Department to hire 4 full-time Science Teaching and Learning Fellows (STLFs) who work directly with faculty to optimize courses and curricula. Much of the effort goes into developing active learning opportunities and rigorous ways to measure student learning and attitudes. Results serve as feedback for both students and instructors. Over 10 research projects have so far been initiated as a result of course and curriculum transformation. Examples include studies about: student attitudes towards Earth and Ocean Sciences; the effects of multiple instructors in courses; links between student in-class engagement and pedagogy; how certain instructional interventions promote metacognition; and others. Also, many modified courses use pre- and post-testing to measure learning gains. One undergraduate honors thesis, about assessing conceptual understanding of geological time, has been completed. Keys to fostering GER in our setting include: (1) faculty commitment to change, based on funding from CWSEI, (2) full-time Earth scientists (STLFs) who catalyze and support change, and (3) support from CWSEI science education experts. Specifically: - STLFs are trained Earth scientists but were not initially science education experts. Continuous support from CWSEI has been crucial for building expertise about how
Directory of Open Access Journals (Sweden)
Ekberg Olle
2006-03-01
Full Text Available Abstract Background Oxytocin is released in response to a meal. Further, mRNA for oxytocin and its receptor have been found throughout the gastrointestinal (GI tract. The aim of this study was therefore to examine whether oxytocin, or the receptor antagonist atosiban, influence the gastric emptying. Methods Ten healthy volunteers (five men were examined regarding gastric emptying at three different occasions: once during oxytocin stimulation using a pharmacological dose; once during blockage of the oxytocin receptors (which also blocks the vasopressin receptors and thereby inhibiting physiological doses of oxytocin; and once during saline infusion. Gastric emptying rate (GER was assessed and expressed as the percentage reduction in antral cross-sectional area from 15 to 90 min after ingestion of rice pudding. The assessment was performed by real-time ultrasonography. At the same time, the feeling of satiety was registered using visual satiety scores. Results Inhibition of the binding of endogenous oxytocin by the receptor antagonist delayed the GER by 37 % compared to saline (p = 0.037. In contrast, infusion of oxytocin in a dosage of 40 mU/min did not affect the GER (p = 0.610. Satiation scores areas in healthy subjects after receiving atosiban or oxytocin did not show any significant differences. Conclusion Oxytocin and/or vasopressin seem to be regulators of gastric emptying during physiological conditions, since the receptor antagonist atosiban delayed the GER. However, the actual pharmacological dose of oxytocin in this study had no effect. The effect of oxytocin and vasopressin on GI motility has to be further evaluated.
GÜÇ SİSTEMİ EMNiYET KONTROLÜ VE ZAMANLANMIŞ PETRİ AG MODELİNİN OLUŞTURULMASI
Directory of Open Access Journals (Sweden)
DAVUT HANBAY
2005-06-01
Full Text Available Bu çalışmada, güç sistemlerinin emniyet kontrolü için bilgisayar tabanh bir kontrol modeli oluşturulmuştur. Modellemede, dinamik olması ve grafiksel özelliği dolayısıyla Petri ağları tercih rctilnıiştir. Gerçekleştirilen model sayesinde sistem kontrolü daha etkili bir şekilde gl'r�·ckleştirilebilmektedir. Herhangi bir hata durun nı nda yerlerin sahip olduğu jetonların ':ı� e\\ inde oluşan hatanın tespiti daha kısa zamanda lwlirlen mcktedir. Gerçekleştirilen model, petri ağının ö7rlliğindcn dolayı sistem yapısında meydana gelecek dcti�i nı l ere d iğer ak ılı sistem yöntemleri ile elde rrlilrn nı o de lle r e oranla . daha kolay uyarlan ahilmektedir. Gerçekleştirilen modelin lıl'ııtcfinıi \\1isual object petri ağı benzetim programı ilc !,!erçekleştirilmiş ve modelin sorunsuz bir şekilde c�hştığı görülmüştür. Gerekli donanımlar kullaıııhllğında gerçek zamanlı uygulamalar için ıı,, guıı h ir nıodel olacaktır.
Directory of Open Access Journals (Sweden)
Özlem TOPER-KORKMAZ
2013-01-01
Full Text Available Temel Tepki Öğretimi (TTÖ Amerika Ulusal Otizm Merkezi (NAC, 2009 tarafından yayınlanmış olan Ulusal Standartlar Raporun’da otizmli çocukların eğitimde kullanılan bilimsel dayanaklı uygulamalardan bir tanesi olarak kabul edilmektedir. TTÖ hem uygulamalı davranış analizi ilkelerine dayanan hem de doğal bir öğretim yöntemidir. Yöntem öğrenci merkezli ve aile eğitimi esaslı olup çocuklara belli temel davranışları kazandırmayı ve buna bağlı olarakta hedeflenmeyen başka alanlarda da ilerlemeler sağlanacağını savunur. Bu çalışmada TTÖ’ne yönelik bir alan yazın çalışması amaçlanmış ve bu amaçla 1995 ile 2011 yılları arasında TTÖ ile gerçekleştirilmiş olan 16 etkililik araştırmasına ulaşılarak bu araştımalar betimsel olarak analiz edilmiştir. Elde edilen bulgular TTÖ’nün okul öncesi ve ilköğretim dönemindeki otizm spektrum bozukluğu gösteren çocuklara ifade edici dil becerilerinin kazandırılmasında, sosyal becerilerin ve oyun becerilerinin öğretiminde etkili olduğunu göstermektedir Pivotal Response Treatment (PRT is one of evidence based treatments identified in the US National Autism Center's National Standards Report published in 2009. PRT is a comprehensive instructional model based on developmental approach and applied behavior analysis principles to provide learning opportunities for supporting children in their natural environments. PRT is a student-centered and parent-training based procedure and advocates that if children achieve some pivotal behaviors, it provides positive effects on untargeted behaviors and also if these pivotal behaviors are achieved once, results will be common and generalizable. The purpose of this study is, by using descriptive analysis, to review the sixteen effectiveness studies of PRT published in 1995-2011. Results of review showed that PRT is an effective procedure on language skills, social skills and play skills of preschool and
Teresa Núñez-Vinaveirán; Manuel Sánchez; Pablo Millán; José Ramón Martínez-Méndez; Carmen Iglesias; César Casado-Pérez; Abelardo García-de-Lorenzo
2014-01-01
Introducción: La valoración de las necesidades calóricas del paciente quemado se ha basado en la medición del gasto energético en reposo (GER) mediante calorimetría indirecta, no siempre disponible en las unidades de quemados, o en su estimación mediante el uso de ecuaciones predictivas. Objetivos: analizar la historia y estado del arte del uso de las ecuaciones predictivas de GER en el paciente quemado crítico, y determinar su validez. Métodos: revisión bibliográfica de estudios y revisiones...
The Anthropological Cinema and Approach the Health of Indigenous Folk
Directory of Open Access Journals (Sweden)
Diana Milena BERRÍO CUARTAS
2017-03-01
Full Text Available The article aims to address the concept of anthropological or ethnographic cinema and its relevance in Latin America. As an example of anthropological cinema has been chosen Gerónima, Argentina film, directed by Raul Tosso, released in 1986 and based on the book by psychiatrist Jorge Luis Pellegrini. Gerónima relate the story of an Indian family intervened by a team of public health. The objectives are to present some ways of exploring cultural diversity in the film industry and analyze how health and preventive and curative interventions in different socio?cultural contexts values.
Er du bange for tandlægeskræk? [Are you afraid of dental fear?
DEFF Research Database (Denmark)
Moore, Rod
2010-01-01
Denne artikel handler om hvordan nervøse patienter, vi som tandlæger og samfundsmæssige image af tandlæger kan påvirke interaktioner i tandlægestolen. Disse tre perspektiver (Patient, tandlæge og samfundsmæssige image) gør fænomenet tandlægeskræk kompliceret og til tider forvirrende for både pati......, Dentist & Societal Image) make the phenomenon of dental phobia complicated and sometimes confusing for both patients and dentists. We dentists may be affected by our own stress, dissatisfaction and image perceptions....
La música de los "Armas", Andalusí, de la Curva del Niger
Reynaldo Fernández Manzano; Azucena Fernández Manzano; Ismaïl Diadie Haidara
2012-01-01
La música Arma en la Curva del Níger es como su pueblo, un crisol de formas nortefricanas, árabes, beréberes, moriscas y del África negra. Sin duda con esos elementos ha sido posible crear una cultura propia que se manifiesta en repertorios, fiestas y ceremonias. Las relaciones entre al-Ándalus y la Curva del Níger han sido frecuentes a lo largo de la Edad Media y de los inicios de la Edad Moderna. Su música y fiestas presentan interesantes paisajes sonoros. Junto al análisis de algunas canci...
Stephen Schwartz og den folkelige lyd
DEFF Research Database (Denmark)
Kreutzfeldt, Jacob
2013-01-01
Stephen Schwartz døde i foråret 2013. I denne artikel forsøger Jacob Kreutzfeldt, der gennemførte en række interviews med Schwartz gennem hans sidste år, at indkredse den æstetiske grundholdning, der prægede hans arbejde med radiomontagen i DR.......Stephen Schwartz døde i foråret 2013. I denne artikel forsøger Jacob Kreutzfeldt, der gennemførte en række interviews med Schwartz gennem hans sidste år, at indkredse den æstetiske grundholdning, der prægede hans arbejde med radiomontagen i DR....
DEFF Research Database (Denmark)
Dupont, Søren
Dette paper forsøger at trække nogle linjer til relationerne mellem fænomenologi og bevægelse, men også tid, rum og sted. Teoretikerne er Maurice Merleau-Ponty, Hannah Arendt og Daniel Stern. Til sidst diskuteres forholdet mellem fænomenologi og metode.......Dette paper forsøger at trække nogle linjer til relationerne mellem fænomenologi og bevægelse, men også tid, rum og sted. Teoretikerne er Maurice Merleau-Ponty, Hannah Arendt og Daniel Stern. Til sidst diskuteres forholdet mellem fænomenologi og metode....
DEFF Research Database (Denmark)
Kjems, Erik
2014-01-01
I takt med at megen af den information vi forsøger at fastholde med bl.a. geodata bliver tilgængelige som realtids information, må vores systemer og databeskrivelser nødvendigvis tilpasses disse nye udfordringer. Vores ønske om stadig flere informationer øger kravene til systemerne og organisatio...... organisationen omkring geodata. Når der er tale om "Big Data" og "Internet of Things" kan netop georeferencen spille en afgørende rolle, fordi den kan bidrage til at holde styr på datastrømmene. Er vores fælles nationale geodatagrundlag klar til denne rolle?...
Vold, svensk uro og Henning Mankell
DEFF Research Database (Denmark)
Hansen, Kim Toft
Paperet undersøger den fiktionelle repræsentation af vold hos Henning Mankell med fokus på Innan frosten fra 2002 og filmatiseringen heraf fra 2005, men med fyldige udblik til såvel andre af Mankells fortællinger og ikke mindst sociologiske og filosofiske diskussioner af volden, voldens forstyrre......Paperet undersøger den fiktionelle repræsentation af vold hos Henning Mankell med fokus på Innan frosten fra 2002 og filmatiseringen heraf fra 2005, men med fyldige udblik til såvel andre af Mankells fortællinger og ikke mindst sociologiske og filosofiske diskussioner af volden, voldens...
Effects of High Pressure on Bacillus licheniformis Spore Germination and Inactivation.
Borch-Pedersen, Kristina; Mellegård, Hilde; Reineke, Kai; Boysen, Preben; Sevenich, Robert; Lindbäck, Toril; Aspholm, Marina
2017-07-15
Bacillus and Clostridium species form spores, which pose a challenge to the food industry due to their ubiquitous nature and extreme resistance. Pressurization at 300 MPa likely triggers germination by opening dipicolinic acid (DPA) channels present in the inner membrane of the spores. In this work, we expose spores of Bacillus licheniformis , a species associated with food spoilage and occasionally with food poisoning, to high pressure (HP) for holding times of up to 2 h. By using mutant spores lacking one or several GRs, we dissect the roles of the GerA, Ynd, and GerK GRs in moderately HP (mHP; 150 MPa)-induced spore germination. We show that Ynd alone is sufficient for efficient mHP-induced spore germination. GerK also triggers germination with mHP, although at a reduced germination rate compared to that of Ynd. GerA stimulates mHP-induced germination but only in the presence of either the intact GerK or Ynd GR. These results suggests that the effectiveness of the individual GRs in mHP-induced germination differs from their effectiveness in nutrient-induced germination, where GerA plays an essential role. In contrast to Bacillus subtilis spores, treatment with very HP (vHP) of 550 MPa at 37°C did not promote effective germination of B. licheniformis spores. However, treatment with vHP in combination with elevated temperatures (60°C) gave a synergistic effect on spore germination and inactivation. Together, these results provide novel insights into how HP affects B. licheniformis spore germination and inactivation and the role of individual GRs in this process. IMPORTANCE Bacterial spores are inherently resistant to food-processing regimes, such as high-temperature short-time pasteurization, and may therefore compromise food durability and safety. The induction of spore germination facilitates subsequent inactivation by gentler processing conditions that maintain the sensory and nutritional qualities of the food. High-pressure (HP) processing is a nonthermal
Directory of Open Access Journals (Sweden)
Gustavo Almeida Fortunato
2008-10-01
Full Text Available OBJETIVO: Avaliar o perfil funcional do esôfago e a prevalência de refluxo gastroesofágico (RGE em pacientes candidatos a transplante pulmonar. MÉTODOS: Foram analisados prospectivamente, entre junho de 2005 e novembro de 2006, 55 pacientes candidatos a transplante pulmonar da Santa Casa de Misericórdia de Porto Alegre. Os pacientes foram submetidos a esofagomanometria estacionária e pHmetria esofágica ambulatorial de 24 h de um e dois eletrodos antes de serem submetidos ao transplante pulmonar. RESULTADOS: A esofagomanometria foi anormal em 80% dos pacientes e a pHmetria revelou RGE ácido patológico em 24%. Os sintomas digestivos apresentaram sensibilidade de 50% e especificidade de 61% para RGE. Dos pacientes com doença pulmonar obstrutiva crônica, 94% apresentaram alteração à manometria, e 80% apresentaram hipotonia do esfíncter inferior, que foi o achado mais freqüente. Pacientes com bronquiectasias apresentaram a maior prevalência de RGE (50%. CONCLUSÕES: O achado freqüente em pacientes com doença pulmonar avançada é RGE. Na população examinada, a presença de sintomas digestivos de RGE não foi preditiva de refluxo ácido patológico. A contribuição do RGE na rejeição crônica deve ser considerada e requer estudos posteriores para seu esclarecimento.OBJECTIVE: To assess the esophageal function profile and the prevalence of gastro-esophageal reflux (GER in lung transplant candidates. METHODS: From July of 2005 to November of 2006, a prospective study was conducted involving 55 candidates for lung transplantation at the Santa Casa de Misericórdia Hospital in Porto Alegre, Brazil. Prior to transplantation, patients underwent outpatient stationary esophageal manometry and 24-h esophageal pH-metry using one and two electrodes. RESULTS: Abnormal esophageal manometry was documented in 80% of the patients, and 24% of the patients presented pathological acid reflux. Digestive symptoms presented sensitivity and
Incentivos, competências e conhecimento: evidência na França e integração teórica
Directory of Open Access Journals (Sweden)
Fabrice Galia
2007-06-01
Full Text Available Este artigo examina a criação do conhecimento, bem como a partilha e a transferência de processos em firmas de manufatura na perspectiva da inovação. Primeiramente, usando dados franceses, mostra a complementariedade entre a gerência de recursos humanos e as práticas de gerência do conhecimento (HRM e KM, e seu impacto na inovação. Expõe a diversidade organizational das firmas. Três conjuntos ou pacotes de práticas organizationais são identificados como "sistemas das práticas HRM e de KM". Caracterizamos, respectivamente, (i firmas tradicionais na organização do trabalho; (ii firmas usando práticas de gestão de pessoal com incentivos e (iii firmas de aprendizagem, adicionando aos incentivos práticas de gerência do conhecimento. Correspondem aos modelos organizationais teóricos, includindo arquiteturas organizationais modernas, baseadas em incentivos para desenvolver competências e conhecimento, sem deixar de lado firmas inspiradas em tayloring. Os resultados empíricos permitem concluir que os pacotes das práticas de HRM e de KM produzem significativo e positivo impacto no desempenho da inovação, quando mudanças marginais em práticas individuais dão pouco resultado. Além disso, a fim de confirmar tais complementariedades, concentramo-nos em quatro práticas específicas usadas, principalmente, por firmas: gerência da equipe, dos incentivos, do treinamento e do conhecimento. Empregamos novo procedimento, baseado no conceito de supermodularidade, para estudar a complementaridade e a substitutabilidade em casos onde práticas organizationais múltiplas afetam o desempenho inovativo. Este procedimento baseia-se na limitação múltipla da desigualdade. Nossos resultados sugerem que as firmas usam certas práticas de maneira comum e sistematicamente, que explicam sinergias existentes. O resultado confirma a noção de que a gerência do conhecimento é mais eficaz quando acompanhada pela organização da equipe e por
Molecular selectivity of graphene-enhanced Raman scattering.
Huang, Shengxi; Ling, Xi; Liang, Liangbo; Song, Yi; Fang, Wenjing; Zhang, Jin; Kong, Jing; Meunier, Vincent; Dresselhaus, Mildred S
2015-05-13
Graphene-enhanced Raman scattering (GERS) is a recently discovered Raman enhancement phenomenon that uses graphene as the substrate for Raman enhancement and can produce clean and reproducible Raman signals of molecules with increased signal intensity. Compared to conventional Raman enhancement techniques, such as surface-enhanced Raman scattering (SERS) and tip-enhanced Raman scattering (TERS), in which the Raman enhancement is essentially due to the electromagnetic mechanism, GERS mainly relies on a chemical mechanism and therefore shows unique molecular selectivity. In this paper, we report graphene-enhanced Raman scattering of a variety of different molecules with different molecular properties. We report a strong molecular selectivity for the GERS effect with enhancement factors varying by as much as 2 orders of magnitude for different molecules. Selection rules are discussed with reference to two main features of the molecule, namely its molecular energy levels and molecular structures. In particular, the enhancement factor involving molecular energy levels requires the highest occupied molecular orbital (HOMO) and lowest unoccupied molecular orbital (LUMO) energies to be within a suitable range with respect to graphene's Fermi level, and this enhancement effect can be explained by the time-dependent perturbation theory of Raman scattering. The enhancement factor involving the choice of molecular structures indicates that molecular symmetry and substituents similar to that of the graphene structure are found to be favorable for GERS enhancement. The effectiveness of these factors can be explained by group theory and the charge-transfer interaction between molecules and graphene. Both factors, involving the molecular energy levels and structural symmetry of the molecules, suggest that a remarkable GERS enhancement requires strong molecule-graphene coupling and thus effective charge transfer between the molecules and graphene. These conclusions are further
Gadala-Maria, Daniel; Yaari, Gur; Uduman, Mohamed; Kleinstein, Steven H
2015-02-24
Individual variation in germline and expressed B-cell immunoglobulin (Ig) repertoires has been associated with aging, disease susceptibility, and differential response to infection and vaccination. Repertoire properties can now be studied at large-scale through next-generation sequencing of rearranged Ig genes. Accurate analysis of these repertoire-sequencing (Rep-Seq) data requires identifying the germline variable (V), diversity (D), and joining (J) gene segments used by each Ig sequence. Current V(D)J assignment methods work by aligning sequences to a database of known germline V(D)J segment alleles. However, existing databases are likely to be incomplete and novel polymorphisms are hard to differentiate from the frequent occurrence of somatic hypermutations in Ig sequences. Here we develop a Tool for Ig Genotype Elucidation via Rep-Seq (TIgGER). TIgGER analyzes mutation patterns in Rep-Seq data to identify novel V segment alleles, and also constructs a personalized germline database containing the specific set of alleles carried by a subject. This information is then used to improve the initial V segment assignments from existing tools, like IMGT/HighV-QUEST. The application of TIgGER to Rep-Seq data from seven subjects identified 11 novel V segment alleles, including at least one in every subject examined. These novel alleles constituted 13% of the total number of unique alleles in these subjects, and impacted 3% of V(D)J segment assignments. These results reinforce the highly polymorphic nature of human Ig V genes, and suggest that many novel alleles remain to be discovered. The integration of TIgGER into Rep-Seq processing pipelines will increase the accuracy of V segment assignments, thus improving B-cell repertoire analyses.
Dal Negro, R W; Guerriero, M; Micheletto, C
2012-12-01
The increase of basement membrane thickness (BMAT) represents a structural feature described as commonly characterizing airway remodelling in asthma, even if the non-atopic condition had been investigated only episodically from this point of view. Gastrooesophageal-reflux is a pathological condition which can frequently cause and/or sustain asthma in non-atopic individuals. The aim of the study was to measure BMT; some inflammatory mediators in BAL; cys-leucotrienes (LTE4) in urine; e-NO, and BHR to Methacholine (MCh) in mild atopic and in mild non-atopic, GER-related asthma. After their informed consent, 25 mild atopic (40.9 years +/- 13.1 sd, FEV1 = 95.9% pred. +/- 12.9 sd) and 39 non-atopic, GER-related asthmatics (57.3 years +/- 14.2 ds, FEVY1 = 101.3% pred. +/- 12.2 sd), nonsmoker and of a comparable asthma duration, underwent measurements of basal lung function and bronchial response to MCh (PD20 FEV1); endobronchial biopsies and BAL (in the right middle lobe), and a 24-h gastroesophageal pHmetry. Atopic GER-related asthma showed two distinct patterns of airway inflammation. The eosinophilic contribution to airway inflammation was systematically prevailing in the former group, such as: EOS = 10.7% +/- 13.4 sd vs 2.0% +/- 2.8 sd, p = 0.001; ECP = 344.9 mcg/l +/- 635.9 sd vs 59.2 mcg/l +/- 75.1 sd, p = 0.001. Data from the present study are suggesting that persistent mild atopic and mild GER-related asthma seem to represent two distinct phenotypes of asthma in terms of airway remodelling, and in particular of BMT involvement.
Seppel, G; Lenich, A; Imhoff, A B
2014-06-01
Reposition and fixation of unstable distal clavicle fractures with a low profile locking plate (Acumed, Hempshire, UK) in conjunction with a button/suture augmentation cerclage (DogBone/FibreTape, Arthrex, Naples, FL, USA). Unstable fractures of the distal clavicle (Jäger and Breitner IIA) in adults. Unstable fractures of the distal clavicle (Jäger and Breitner IV) in children. Distal clavicle fractures (Jäger and Breitner I, IIB or III) with marked dislocation, injury of nerves and vessels, or high functional demand. Patients in poor general condition. Fractures of the distal clavicle (Jäger and Breitner I, IIB or III) without marked dislocation or vertical instability. Local soft-tissue infection. Combination procedure: Initially the lateral part of the clavicle is exposed by a 4 cm skin incision. After reduction of the fracture, stabilization is performed with a low profile locking distal clavicle plate. Using a special guiding device, a transclavicular-transcoracoidal hole is drilled under arthroscopic view. Additional vertical stabilization is arthroscopically achieved by shuttling the DogBone/FibreTape cerclage from the lateral portal cranially through the clavicular plate. The two ends of the FibreTape cerclage are brought cranially via adjacent holes of the locking plate while the DogBone button is placed under the coracoid process. Thus, plate bridging is achieved. Finally reduction is performed and the cerclage is secured by surgical knotting. Use of an arm sling for 6 weeks. Due to the fact that the described technique is a relatively new procedure, long-term results are lacking. In the short term, patients postoperatively report high subjective satisfaction without persistent pain.
Directory of Open Access Journals (Sweden)
Javier Blasco-Alonso
2014-03-01
Full Text Available Introduction: The conventional 24-hour pH monitoring is the gold standard for the diagnosis of gastro-esophageal reflux (GER, a possible cause of Apparent Life Threatening Episodes (ALTE. However, multichannel intraluminal impedance (MII may provide advantages. Objectives: Comparison of the results of MII and pH monitoring in patients undergoing MII-pH monitoring in the 3-year study period because of having suffered from ALTE. Material and methods: Prospective study of MII-pH monitoring performed in our unit to infants 5 min per patient and clearance of 1.20 (IQ: 0.70-2.20 min/reflux. With pH monitoring analysis, 14 children (35.9 % could have been diagnosed as GER (8 mild, 4 moderate and 2 severe based on the classical criteria. MII identified a total of 8,895 events; only 3,219 among them were refluxes, with a median of 75 (IQ: 54-111 per patient, 1.30 (IQ: 1.3-2.6 episodes/hour. With MII-pH monitoring combination there were 21.60 (SD 15.21 acid reflux episodes, 67.33 weekly acid (SD 32.09 and 3.34 (SD 7.23 non-acid, being finally diagnosed 33 patients as GER. Conclusions: The association of pH monitoring and MII provides additional information that improves GER diagnostic performance without posing any additional risk to the infant patient. The non-acid/weekly acid refluxes, not detected by pH monitoring, account for a high percentage of episodes, this may have diagnostic and therapeutic significance, especially in infants. Further studies are needed to assess the normality of MMI in pediatric patients.
Gastro esophageal reflux: an over investigated entity in neonates and infants.
Khan, Zahid Anwar; Ahmad, Sarfraz; Sheikh, Muhammad Younus
2010-12-01
To determine the outcome of clinically suspected gastro esophageal reflux in neonates and infants. To find a protocol for evaluation of these patients in order to reduce unnecessary radiation to neonates and infants. Fifty three neonates and infants of up to 1 year of age with clinical suspicion of gastro esophageal reflux (GER) were referred for Upper gastro intestinal barium studies. This retrospective descriptive case study was carried out over a period of one year starting from October, 2006 to September, 2007. Positive cases were followed for another one year to see the final outcome. The neonate and infants of upto one year of age, referred from Neonatal intensive care unit (NICU), Paediatric ward and Out Patient Department (OPD) were included in this study. Out of 53 cases 32 were positive for G.E.R and no reflux could be identified in rest of the patients. Out of these positive cases only 4 had massive or severe G.E.R. These patients were prescribed conservative and medical treatment and were advised to follow up in the O.P.D where on subsequent follow ups the medical treatment was stopped as there were no further complaints .These patients showed normal weight gain on subsequent O.P.D visits. Other positive cases only had mild to moderate G.E.R and they were managed conservatively. These patients showed normal weight gain on subsequent O.P.D visits with complete resolution of symptoms. Regurgitation or gastro esophageal reflux is a common finding in the first 3 months of life (especially in preterm infants) and usually resolves by 6-12 months of age and should not be over investigated.
Public service motivation og udfordringer for offentligt ansatte
DEFF Research Database (Denmark)
Jacobsen, Christian Bøtcher
2012-01-01
Forskelle i omgivelserne betyder at udfordringerne varierer for organisationer, der leverer samme type offentlig service. Sociale udfordringer kan betyde, at medarbejderne må fokusere på de svageste og nedtone fokus på den brede gruppe af borgere. Derfor kan varierende grader af sociale udfordrin......Forskelle i omgivelserne betyder at udfordringerne varierer for organisationer, der leverer samme type offentlig service. Sociale udfordringer kan betyde, at medarbejderne må fokusere på de svageste og nedtone fokus på den brede gruppe af borgere. Derfor kan varierende grader af sociale...... udfordringer appellere til medarbejdere med forskellige typer motivation. Gennem et studie af offentligt ansatte børnetandlæger undersøger artiklen, hvordan to forskellige typer PSM hænger sammen med graden af sociale udfordringer. Artiklen bygger på spørgeskemadata om 245 børnetandlægers motivation samt et...... objektivt mål for kommunernes sociale udfordringer. Resultaterne viser en positiv sammenhæng mellem compassion og sociale udfordringer, mens sammenhængen er negativ for public interest. Resultatet peger på, at en organisations omgivelser har betydning for medarbejdernes motivation, og dette er af væsentlig...
Feature extraction with deep neural networks by a generalized discriminant analysis.
Stuhlsatz, André; Lippel, Jens; Zielke, Thomas
2012-04-01
We present an approach to feature extraction that is a generalization of the classical linear discriminant analysis (LDA) on the basis of deep neural networks (DNNs). As for LDA, discriminative features generated from independent Gaussian class conditionals are assumed. This modeling has the advantages that the intrinsic dimensionality of the feature space is bounded by the number of classes and that the optimal discriminant function is linear. Unfortunately, linear transformations are insufficient to extract optimal discriminative features from arbitrarily distributed raw measurements. The generalized discriminant analysis (GerDA) proposed in this paper uses nonlinear transformations that are learnt by DNNs in a semisupervised fashion. We show that the feature extraction based on our approach displays excellent performance on real-world recognition and detection tasks, such as handwritten digit recognition and face detection. In a series of experiments, we evaluate GerDA features with respect to dimensionality reduction, visualization, classification, and detection. Moreover, we show that GerDA DNNs can preprocess truly high-dimensional input data to low-dimensional representations that facilitate accurate predictions even if simple linear predictors or measures of similarity are used.
Directory of Open Access Journals (Sweden)
Darwich Gassan
2009-06-01
Full Text Available Abstract Background The intake of dietary fibre has been shown to reduce the risk of developing diabetes mellitus. The aim of this study was to compare the effects of commercial rye whole-meal bread containing whole kernels and white wheat bread on the rate of gastric emptying and postprandial glucose response in healthy subjects. Methods Ten healthy subjects took part in a blinded crossover trial. Blood glucose level and gastric emptying rate (GER were determined after the ingestion of 150 g white wheat bread or 150 g whole-meal rye bread on two different occasions after fasting overnight. The GER was measured using real-time ultrasonography, and was calculated as the percentage change in antral cross-sectional area 15 and 90 minutes after completing the meal. Results No statistically significant difference was found between the GER values or the blood glucose levels following the two meals when evaluated with the Wilcoxon signed rank sum test. Conclusion The present study revealed no difference in postprandial blood glucose response or gastric emptying after the ingestion of rye whole-meal bread compared with white wheat bread. Trial registration NCT00779298
An empirical investigation of attiribution for success and failure
Asanakutlu, Tuncer; Sahin, Tezcan Kesmer
2014-01-01
Çalışmanın amacı, cinsiyet, kişilik ve tanışıklık durumunun atfetme üzerinde farklılaşmaya neden olup olmadığının ve temel atfetme hatası ve kendine hizmet eden yükleme yanlılığının gerçekleşip gerçekleşmediğinin tespit edilmesidir. Amacın gerçekleştirilmesi için görgül bir çalışma yapılmıştır. Araştırmada maksatlı örnekleme kullanılmış olup, gönüllülük esasına bağlı olarak katılan toplam 52 öğrenci üzerinde ...
Risky alcohol use in Danish physicians
DEFF Research Database (Denmark)
Pedersen, Anette Fischer; Sørensen, Johanne Korsdal; Bruun, Niels Henrik
2016-01-01
Alkoholmisbrug er ikke velundersøgt hos danske læger. Denne undersøgelse viser, at omtrent 19 % af de adspurgte læger havde et risikobetonet alkoholforbrug. En høj grad af udbrændthed og aleksitymi, som er manglende evne til at genkende og beskrive følelser, var forbundet med øget sandsynlighed f......: 46), som var tilfældigt udvalgt blandt Lægeforeningens medlemmer. De besvarede anonymt et elektronisk spørgeskema, som bl.a. indeholdt danske versioner af the Alcohol Use Disorders Identification Test (AUDIT), the Maslach Burnout Inventory (MBI) og the Toronto Alexithymia Scale (TAS-20...
DEFF Research Database (Denmark)
Pedersen, Anne Marie Lynge
2016-01-01
millioner af dødsfald, især alkoholmisbrug. Cannabis er det mest almindeligt anvendte illegale stof i hele verden, men der produceres til stadighed nye stoffer på verdensmarkedet. Litteraturen om virkningerne af illegale stoffer på den orale sundhed er relativ sparsom på grund af vanskeligheder med...... bruksisme. Desuden er det velkendt, at overdreven indtagelse af alkohol øger risikoen for oral cancer betydeligt. Det er vigtigt, at tandlæger har et indgående kendskab til de kliniske manifestationer ved misbrug og de medicinske risici, der kan være ved behandling af patienter med misbrug, men også...
DEFF Research Database (Denmark)
Duedahl, Poul
2005-01-01
"Folk gjorde såmænd klogt i at gøre som jeg - jeg bruger kakkelovnen som arkiv" gentog tidligere konseilspræsident J.C. Christensen (1856-1930) ofte over for venner og bekendte. Selv destruerede han de fleste af sine breve, mens han var i live, og i mange år troede man, at hans dagbøger blev bræn...... anledning til nogle refleksioner over, hvad man skal stille op med dem; hvad det er, der får folk til at skrive dagbøger og hvad det er, der får folk til at skille sig af med dem igen....
Stereotyped perceptions of chronic pain
DEFF Research Database (Denmark)
Møller, Marie Østergaard
2010-01-01
Artiklen undersøger hvordan stærke sociale stereotyper former socialarbejderes tilgang til hjælpesøgende borgere. Den empiriske analyse fokuserer på betydningen af 'deservingness' kriterier, samt på hvordan paternalistiske og følelsesmæssige argumenter bliver brugt af socialarbejdere til at retfæ......Artiklen undersøger hvordan stærke sociale stereotyper former socialarbejderes tilgang til hjælpesøgende borgere. Den empiriske analyse fokuserer på betydningen af 'deservingness' kriterier, samt på hvordan paternalistiske og følelsesmæssige argumenter bliver brugt af socialarbejdere til...... at retfærdiggøre stereotype kategoriseringer....
Abrahamsson, Ola
2013-01-01
Denna uppsats behandlar hur olika föreställningar kring genus och sexualitet tar sig uttryck, dels i de videos som producerar på internet av karaktären Pewdiepie men också i det material som fansen genererar. Studien fokusera på en specifik videohändelse, en sekvens där Pewdiepie ikläder sig en rosa boa och bland annat säger säger ”It’s not called being gay. It’s called being fabulous!” samt vad som görs med denna händelse, hur den remedieras och tas i bruk av fansen. Detta har jag gjort geno...
DEFF Research Database (Denmark)
Brown, Norman R.; Lee, Peter J.; Krslak, Mirna
2009-01-01
Foreslår et paradigme - "Living in history" - til undersøgelse af forholdet mellem samtidshistorie og selvbiografisk hukommelse. Metoden spørger ikke direkte og altså ikke til den anknytning, man bevidst ville vælge at fremhæve, men undersøger indirekte, om der spontant associeres til samtidsbegi......Foreslår et paradigme - "Living in history" - til undersøgelse af forholdet mellem samtidshistorie og selvbiografisk hukommelse. Metoden spørger ikke direkte og altså ikke til den anknytning, man bevidst ville vælge at fremhæve, men undersøger indirekte, om der spontant associeres til...
Surinder S. Jodhka*, Caste / Kast Sistemi
Altıntaş, İhsan
2016-01-01
Bu kitap kast sisteminin daha iyi anlaşılmasında önemli bir role sahiptir. Yazar kast sitemini anlaşılır kılmak temel sorular ile başlar. Neden kast sisteminden bahsetmeliyiz? Yirmi birinci yüzyılda kast sisteminden nasıl bahsedilir? Bu sorular detaylı cevaplar ile donatılmaktadır. Kast sisteminin günümüzdeki gerçekliğinin kabul edilmesini vurgulayarak bu gerçeklikleri şöyle sıralamaktadır; gelenek-görenek, adetler, din ve özellikle eşitsizlik.
Analysis of giant electrorheological fluids.
Seo, Youngwook P; Seo, Yongsok
2013-07-15
The yield stress dependence on electric field strength for giant electrorheological (GER) fluids over the full range of electric fields was examined using Seo's scaling function which incorporated both the polarization and the conductivity models. If a proper scaling was applied to the yield stress data to collapse them onto a single curve, the Seo's scaling function could correctly fit the yield stress behavior of GER suspensions, even at very high electric field strengths. The model predictions were also compared with recently proposed Choi et al.'s model to allow a consideration of the universal framework of ER fluids. Copyright © 2013 Elsevier Inc. All rights reserved.
La música de los "Armas", Andalusí, de la Curva del Niger
Directory of Open Access Journals (Sweden)
Reynaldo Fernández Manzano
2012-01-01
Full Text Available La música Arma en la Curva del Níger es como su pueblo, un crisol de formas nortefricanas, árabes, beréberes, moriscas y del África negra. Sin duda con esos elementos ha sido posible crear una cultura propia que se manifiesta en repertorios, fiestas y ceremonias. Las relaciones entre al-Ándalus y la Curva del Níger han sido frecuentes a lo largo de la Edad Media y de los inicios de la Edad Moderna. Su música y fiestas presentan interesantes paisajes sonoros. Junto al análisis de algunas canciones se ofrece la transcripción de las partituras.
Nyt fra videnskaberne 2 : Faldforebyggelse
DEFF Research Database (Denmark)
Evron, Lotte
2012-01-01
faldforebyggelse samt barrierer og motivation for deltagelse i faldforebyggelsesprogrammer (McMahon et al 2011, Calhoun et al 2011, Evron et al, 2009, Bunn et al, 2008). I mit ph.d. projekt forsøger jeg at afdække det paradoks, at hvis faldforebyggelse både er godt for individet og samfundet, hvorfor deltager......Fald er et af de alvorligste sundhedsproblemer for ældre. Fysisk træning kan forebygge fald og spare samfund og individ for mange byrder (WHO, 2007) desværre deltager kun få i faldforebyggelsesprogrammer (Bunn et al, 2008). En ny gren inden for faldforskning undersøger opfattelser af fald og...
Fedme øger risikoen for hjerte-kar-sygdom
DEFF Research Database (Denmark)
Afzal, Shoaib; Nordestgaard, Børge Grønne
2016-01-01
Evidence from epidemiology, randomized intervention trials, and Mendelian randomization studies indicates that obesity is causally associated with increased burden of cardiovascular disease risk factors and increased risk of cardiovascular disease. This association is probably mediated...... by modifiable risk factors; thus indicating that primary prevention with weight loss and treatment of obesity-related risk factors for cardiovascular disease will reduce cardiovascular disease in the general population....
Püssi plaat saab 30aastaseks / Gerli Romanovitsh
Romanovitš, Gerli, 1977-
2004-01-01
Ilmunud ka: Severnoje Poberezhje, 22. dets. 2004, lk. 4. Aasta aega Šveitsi investeerimisfirmale Sorbes AG kuulunud Püssi Repo Vabrikud tähistab puitlaastvabrikute kombinaadi 30. sünnipäeva. Praegu toodetakse 170 000 m3 puitlaastplaati aastas
Sprogressourcer kontra ordbøger: Hvad er bedst?
DEFF Research Database (Denmark)
Leroyer, Patrick; Simonsen, Henrik Køhler
2018-01-01
into two groups. One group had access to four specially selected online dictionaries and the other group had access to online language resources. On the basis of the analysis of the screen recordings and the texts we were not able to identify significant differences in the quality of the texts translated......This article discusses whether language resources can replace dictionaries and whether there is a measurable quality of the texts translated and produced by means of dictionaries or language resources, respectively. We carried out a controlled experiment involving twenty test subjects divided...... and produced, and we conclude that the use of dictionaries over language resources does not seem to result in higher text quality....
Una nueva tabla mallorquina de Rafel Mòger
Directory of Open Access Journals (Sweden)
Llompart, P. Gabriel
2001-06-01
Full Text Available El taller pictórico de Rafel Moger fue con mucho, a juzgar por la tablajería que se ha conservado, el más notable que existió en la ciudad de Palma de Mallorca en el tercer cuarto del siglo XV. Lentamente se ha llegado a constituir el catálogo de sus pinturas religiosas y un relativo dossier documental de las religiosas y profanas, realizadas, perdidas y recuperadas a partir del tajo que abrieron los eruditos socios de la Arqueología Luliana, que se pusieron a trabajar a fines del siglo pasado, y, sobre todo, del maestro Chandler Rathfon Post que comenzó a recoger los frutos en su Historia de la Pintura hacia el año 1930.…
Gerência e competências gerais do enfermeiro
Directory of Open Access Journals (Sweden)
Aida Maris Peres
2006-01-01
Full Text Available Las políticas de educación por medio de las Directrices Curriculares Nacionales apuntan en direccionar a las instituciones de enseñanza superior para la formación de las siguientes competencias y habilidades generales de los profesionales de la salud: atención a la salud, toma de decisiones, comunicación, liderazgo, administración y gerencia, educación permanente. Como la mayoría de las competencias senãladas pueden ser caracterizadas como competencias gerenciales, el presente artículo pretende describirlas y relacionar los conocimientos necesarios para la formación de dichas competencias. Esa clasificación trajo algunas reflexiones conceptuales que permiten analizar el trabajo del enfermero y las relaciones entre la gerencia y la asistencia.
Assembly and Function of a Spore Coat-Associated Transglutaminase of Bacillus subtilis
Zilhão, Rita; Isticato, Rachele; Martins, Lígia O.; Steil, Leif; Völker, Uwe; Ricca, Ezio; Moran, Charles P.; Henriques, Adriano O.
2005-01-01
The assembly of a multiprotein coat around the Bacillus subtilis spore confers resistance to lytic enzymes and noxious chemicals and ensures normal germination. Part of the coat is cross-linked and resistant to solubilization. The coat contains ɛ-(γ-glutamyl)lysyl cross-links, and the expression of the gene (tgl) for a spore-associated transglutaminase was shown before to be required for the cross-linking of coat protein GerQ. Here, we have investigated the assembly and function of Tgl. We found that Tgl associates, albeit at somewhat reduced levels, with the coats of mutants that are unable to assemble the outer coat (cotE), that are missing the inner coat and with a greatly altered outer coat (gerE), or that are lacking discernible inner and outer coat structures (cotE gerE double mutant). This suggests that Tgl is present at various levels within the coat lattice. The assembly of Tgl occurs independently of its own activity, as a single amino acid substitution of a cysteine to an alanine (C116A) at the active site of Tgl does not affect its accumulation or assembly. However, like a tgl insertional mutation, the tglC116A allele causes increased extractability of polypeptides of about 40, 28, and 16 kDa in addition to GerQ (20 kDa) and affects the structural integrity of the coat. We show that most Tgl is assembled onto the spore surface soon after its synthesis in the mother cell under σK control but that the complete insolubilization of at least two of the Tgl-controlled polypeptides occurs several hours later. We also show that a multicopy allele of tgl causes increased assembly of Tgl and affects the assembly, structure, and functional properties of the coat. PMID:16267299
La médiation paysagère, levier d’un développement territorial durable ?
Directory of Open Access Journals (Sweden)
Laurent Lelli
2010-09-01
Full Text Available Cet article propose qu’une ingénierie de la participation appliquée au paysage puisse favoriser la sensibilisation de différents types d’acteurs à la définition et à la gestion des projets territoriaux pour accompagner la mise en oeuvre durable des politiques paysagères, sur la base de deux démarches opérées dans le Sud-Ouest de la France. Dans les Hautes-Corbières (Aude, Languedoc-Roussillon, la cartographie des unités de paysage, couplée à des photographies, a été utilisée comme outil de reconnaissance des caractères paysagers auprès d’acteurs du développement local. Sur la commune de Lagraulet-du-Gers (Gers, Midi-Pyrénées, différents participants ont été invités à utiliser le photo-reportage pour décrypter le parti d’aménagement d’un lotissement communal et à en discuter le sens et l’intérêt.This article hypothesizes that an engineering of participation in link with landscape notion may promote awareness of the different actors for the definition and management of territorial projects, and support a sustainable implementation of landscape policies. Two learning situations in south-western France are proposed. In the Hautes-Corbières (Aude, Languedoc-Roussillon, a map of the landscape units and photographs were proposed and used as tools for recognitionof landscape characters with various local actors. In Lagraulet-du-Gers municipality (Gers, Midi-Pyrenees, various participants were invited to use photojournalism to decrypt the planning choices implemented on a municipal housing estate and then discuss their meaning and interest.
ETIOLOGICAL FACTORS FOR VOCAL FOLD POLYP FORMATION
Directory of Open Access Journals (Sweden)
DAŠA GLUVAJIĆ
2016-05-01
Full Text Available Background: Vocal fold polyp is one of the most common causes for hoarseness. Many different etiological factors contribute to vocal fold polyp formation. The aim of the study was to find out whether the etiological factors for polyp formation have changed in the last 30 years.Methods: Eighty-one patients with unilateral vocal fold polyp were included in the study. A control group was composed of 50 volunteers without voice problems who matched the patients by age and gender. The data about etiological factors and the findings of phoniatric examination were obtained from the patients' medical documentation and from the questionnaires for the control group. The incidence of etiological factors was compared between the two groups. The program SPSS, Version 18 was used for statistical analysis.Results: The most frequent etiological factors were occupational voice load, GER, allergy and smoking. In 79% of patients 2 – 6 contemporary acting risk factors were found. Occupational voice load (p=0,018 and GER (p=0,004 were significantly more frequent in the patients than in the controls. The other factors did not significantly influence the polyp formation.Conclusions: There are several factors involved simultaneously in the formation of vocal fold polyps both nowadays and 30 years ago. Some of the most common factors remain the same (voice load, smoking, others are new (GER, allergy, which is probably due to the different lifestyle and working conditions than 30 years ago. Occupational voice load and GER were significantly more frequently present in the patients with polyp than in the control group. Regarding the given results it is important to instruct workers with professional vocal load about etiological factors for vocal fold polyp formation.
Gavini, S; Finn, R T; Lo, W-K; Goldberg, H J; Burakoff, R; Feldman, N; Chan, W W
2015-09-01
Gastroesophageal reflux (GER) has been associated with idiopathic pulmonary fibrosis (IPF), although the mechanism remains unclear. Gastroesophageal reflux/microaspiration may lead to lung fibrosis, while increased pulmonary workload may also worsen GER. Comparing the GER profile of IPF patients to chronic obstructive pulmonary disease (COPD) patients with similar lung function may help delineate the role of GER in IPF pathogenesis. This was a retrospective cohort study of IPF and COPD patients undergoing pre-lung transplant multichannel intraluminal impedance and pH study (MII-pH) off acid suppression at a tertiary center in 2008-2014. Patients with prior fundoplication were excluded. Baseline demographics, pulmonary function test, and MII-pH results were recorded. Univariate analyses were performed using Fisher's exact (binary variables) and Student's t (continuous variables) tests. Logistic regression was performed to adjust for potential confounders. A total of 90 subjects (54 IPF, 36 COPD) met inclusion criteria. Compared to COPD, IPF patients had increased total reflux episodes (65.9 vs 46.1, p = 0.02), proximal reflux episodes (30.3 vs 20.3, p = 0.04), and prevalence of abnormal total reflux episodes (38.9% vs 16.7%, p = 0.02). On multivariate analyses, abnormal total reflux episodes (OR: 4.9, p = 0.05) and bolus reflux exposure time (OR: 4, p = 0.04) remained significantly associated with IPF. Abnormal reflux was significantly more prevalent among IPF patients after controlling for lung disease severity. Gastroesophageal reflux/microaspiration likely plays a role in fibrosis in IPF. A significant portion of IPF patients had increased non-acid reflux. Therapies aiming to prevent reflux of gastric contents may be more beneficial than antisecretory medications alone in these patients. © 2015 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Yi JIN
2016-06-01
Full Text Available Objective To compare the diagnostic value of using 24-hour combined esophageal multichannel intraluminal impedance and pH monitoring (MII-pH in the diagnosis of gastro-esophageal reflux (GER and pH monitoring alone in critically ill patients. Methods A prospective observational study was performed including 116 critically ill adult patients admitted to ICU of Peking Haidian Hospital from Jul. 2013 to Dec. 2014. All the patients underwent 24-hour combined MⅡ-pH monitoring. GER episodes were recorded and its pH was recorded (acidic, weakly acidic and weakly alkaline and its composition was recorded (liquid, mixed and gas reflux. The results of the MⅡ-pH and the pH were monitored and compared. The demographic characteristics and clinical information were recorded. Results MⅡ-pH was monitored for 5024 episodes of GER in 115 of 116(99.1% patients, with a mean of 43.28±3.96 episodes per patient (median, 34 episodes; range, 0-196 episodes. The pH monitoring detected 1868 episodes (100% acid in only 54 of 116(46.6% patients, with a mean of 7.66±1.65 episodes per patient (median, 0 episodes; range, 0-81 episodes. The number of episode of all reflux and liquid reflux diagnosed by pH monitoring alone was less than those diagnosed by MⅡ-pH monitoring (P=0.000, and there was no correlation in the episodes number of all reflux and liquid reflux between the two techniques (r=0.119, 0.231. Only a moderate correlation was found in the number of episodes of acidic reflux between the two techniques (r=0.656. Conclusion MⅡ-pH monitoring is more sensitive than pH monitoring alone for establishing the diagnosis of GER. DOI: 10.11855/j.issn.0577-7402.2016.05.12
Tenca, A; Massironi, S; Pugliese, D; Consonni, D; Mauro, A; Cavalcoli, F; Franchina, M; Spampatti, M; Conte, D; Penagini, R
2016-02-01
Patients with chronic autoimmune atrophic gastritis (CAAG) often refer digestive symptoms and are prescribed antisecretory medications. Aims were to investigate: (i) gastro-esophageal reflux (GER), (ii) psychopathological profile, (iii) frequency of use and clinical benefit of antisecretory drugs. Prospective observational study on 41 CAAG patients who underwent: 24 h multichannel intra-luminal impedance-pH (MII-pH) monitoring off-therapy, standardized medical interview and psychological questionnaire (i.e., SCL-90R). The medical interview was repeated at least 1 month after MII-pH in patients who were using antisecretory drugs. Statistical analysis was performed calculating median (10th-90th percentiles) and risk ratios (RR) with 95% confidence interval. Median intra-gastric pH was 6.2 (4.6-7.0). One patient had acid reflux (AC) associated with symptoms, five had increased total reflux number and four had symptoms associated to non-acid reflux (NA) (patients referred as 'GER positive'). Using patients 'GER negative' with normal SCL-90R as reference, the RR of being symptomatic in patients GER positive was 2.1 (1.1-4.1) if SCL-90R was normal and 0.9 (0.5-1.7) if it was altered (difference in RR significant being p = 0.04). Seventeen/28 (61%) symptomatic patients were on antisecretory drugs, which were stopped in 16 of them according to results of MII-pH and clinical evaluation after 574 days (48-796) showed that symptoms were unchanged. In patients with CAAG (i) AC reflux rarely occurred whereas increased NA reflux was not infrequent both being related to symptoms in some patients, (ii) psychopathological profile has a role in symptoms' occurrence, (iii) antisecretory drugs were generally inappropriately used and clinically ineffective. © 2015 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
André Luis Calado Araújo
2007-12-01
Full Text Available Em sua primeira edição de 2005 a HOLOS - on line apresenta treze artigos contemplando todas as áreas de atuação do CEFET-RN sendo seis artigos inéditos e sete artigos apresentados no II Congresso de Iniciação Científica do CEFET-RN (CONGIC. Entre os artigos inéditos são discutidos temas na área de educação tais como a transdisciplinaridade no ensino da disciplina de física, a formação de professores com vistas ao uso de tecnologias de informação e comunicação, e o papel da escola no processo de transformação social do cidadão. Um artigo apresenta alguns critérios de avaliação e sustentabilidade de políticas públicas desenvolvidas no Brasil. Inseridos no contexto tecnológico são apresentados dois artigos abordando a caracterização geotécnica de solos no município de Natal e a produção agrícola do amaranto como forma alternativa de alimento. Como forma de incentivar ainda mais a participação da comunidade nos Congressos de Iniciação do CEFET-RN estamos também publicando um artigo de cada Gerência Educacional e da Unidade Descentralizada de Mossoró (UNED, apresentado no II CONGIC em novembro de 2004. Entre os temas discutidos estão: O trabalho desenvolvido por alunos do Curso Superior de Tecnologia em Lazer e Qualidade de Vida, Gerência Educacional de Tecnologia dos Serviços e da Gestão, em parceria com Associação de Pais e Amigos de Pessoas Portadoras de Deficiência dos Funcionários do Banco do Brasil, Núcleo Regional do Rio Grande do Norte (“Viver com arte e cultura”. As contribuições de Robert Boyle à química em face de uma visão interdisciplinar com a geografia – Gerência de Formação Educacional. As questões do semi-árido são discutidas no trabalho apresentado pelo Núcleo de Ciências e Tecnologia Ambientais (NECTA, baseado na UNED, abordando o desenvolvimento local e manejo da caatinga em um assentamento em Mossoró-RN. O estudo apresentado pela Gerência Educacional de
Can pay for performance improve the quality of primary care?
DEFF Research Database (Denmark)
Roland, Martin; Olesen, Frede
2016-01-01
I mange lande synes sundhedsvæsenet ikke at kunne tilbyde tilstrækkelig behandling af en lang række sygdomme. Højt kvalificerede læger er en afgørende faktor, men dygtige læger er ikke nok til at sikre god behandling. Derfor ses der nu mange steder efter nye incitamenter, som kan bidrage til at h...... til nye former for behandling og pleje. Vi har brug for mere forskning på dette område, hvis vi på et oplyst grundlag skal beslutte, om og evt. hvordan vi bedst indfører elementer af ”pay for perfomance” for at forbedre de services, der udbydes i sundhedsvæsenet....
DEFF Research Database (Denmark)
Hannibal, Sara Stefansen
HOT er en kvalitativ undersøgelse, der hvert år diskuterer og undersøger en lille udvalgt skare af danskkyndige fagpersoners bud på, hvad de er optagede af på literacyområdet her og nu – altså hvilke emner, de vil vurdere som aktuelle at forholde sig til i deres nuværende praksis.......HOT er en kvalitativ undersøgelse, der hvert år diskuterer og undersøger en lille udvalgt skare af danskkyndige fagpersoners bud på, hvad de er optagede af på literacyområdet her og nu – altså hvilke emner, de vil vurdere som aktuelle at forholde sig til i deres nuværende praksis....
Generic Entity Resolution in Relational Databases
Sidló, Csaba István
Entity Resolution (ER) covers the problem of identifying distinct representations of real-world entities in heterogeneous databases. We consider the generic formulation of ER problems (GER) with exact outcome. In practice, input data usually resides in relational databases and can grow to huge volumes. Yet, typical solutions described in the literature employ standalone memory resident algorithms. In this paper we utilize facilities of standard, unmodified relational database management systems (RDBMS) to enhance the efficiency of GER algorithms. We study and revise the problem formulation, and propose practical and efficient algorithms optimized for RDBMS external memory processing. We outline a real-world scenario and demonstrate the advantage of algorithms by performing experiments on insurance customer data.
Jamie Oliver i den gode smags tjeneste
DEFF Research Database (Denmark)
Leer, Jonatan
2014-01-01
det gode liv er i stigende grad blevet en central del af genren i dag, hvor særligt kogebogsforfatternes privatliv og livsstil – altså et selvbiografisk element – er blevet et bærende narrativ i mange kogebøger. Med sådanne iscenesættelser og dramatiseringer af forestillinger om det gode liv bevæger...... den gode sags tjeneste først og fremmest tjener til at skabe et positivt billede af tv-kokken/kogebogsforfatteren som etisk individ (og brand) på bekostning af de gastronomisk nødstedte. Det skal nævnes, at jeg i min læsning af Jamies kogebogs-kampskrift har ladet mig inspirere af den russisk...
DEFF Research Database (Denmark)
2. oplag 1993. Svensk udgave: Från Vikingar till Korsfarare, 1992. Tysk udgave: Wikinger Waráger Normannen. Die Skandinavier und Europa 800-1200, 1992. Fransk udgave i samarbejde med J.-P. Mohen & F.-X. Dillmann: Les Vikings . . . . Les Scandinaves et l'Europe 800-1200, 1992. Engelske og amerikan......2. oplag 1993. Svensk udgave: Från Vikingar till Korsfarare, 1992. Tysk udgave: Wikinger Waráger Normannen. Die Skandinavier und Europa 800-1200, 1992. Fransk udgave i samarbejde med J.-P. Mohen & F.-X. Dillmann: Les Vikings . . . . Les Scandinaves et l'Europe 800-1200, 1992. Engelske og...... amerikanske udgaver i samarbejde med D.M. Wilson: From Viking to Crusader. Scandinavia and Europe 800-1200, 1992...
DEFF Research Database (Denmark)
Knudsmark, Lena; Semke, Anja; Wiben, Henrik
Sundhed, krop og bevægelse indgår i Munksgaards serie af bøger til den pædagogiske assistentuddannelse. Bogen indeholder teori til fagene Sundhed i den pædagogiske praksis, Bevægelse og idræt samt Arbejdsmiljø og ergonomi. Udgangspunktet for bogens indhold er den pædagogiske praksis. Dvs. at begr......Sundhed, krop og bevægelse indgår i Munksgaards serie af bøger til den pædagogiske assistentuddannelse. Bogen indeholder teori til fagene Sundhed i den pædagogiske praksis, Bevægelse og idræt samt Arbejdsmiljø og ergonomi. Udgangspunktet for bogens indhold er den pædagogiske praksis. Dvs...
Kipling var racist og sexist. Men værd at læse
DEFF Research Database (Denmark)
Møller, Michael
2017-01-01
For over 100 år siden fik Rudyard Kipling Nobelprisen i Litteratur. Han var særdeles alsidig. Han skrev både digte, noveller og bøger, og han skrev både for børn, teenagere og voksne. Han skrev krigsdigte, han skrev digte, der hyldede erhvervslivet, han skrev digte for at fremme bedre pensioner t...... gamle soldater, og han skrev digte til børn. Også hans bøger var meget varierede. I dag er det vel hovedsagelig ' Junglebogen', som unge mennesker kender Kipling for, og det udelukkende på grund af Disney-filmen. Kiplings ry faldt umådeligt efter hans død...
International Nuclear Information System (INIS)
Nakajima, Kenichi; Inaki, Anri; Hiramatsu, Takashi; Hasegawa, Minoru; Fujimoto, Manabu; Takehara, Kazuhiko; Kinuya, Seigo
2009-01-01
Esophageal complications are common in patients with systemic sclerosis (SSc). The relationship between gastroesophageal reflux (GER) symptoms and dysmotility was examined in endoscopically confirmed patients suspected of having reflux esophagitis. A total of 32 patients with limited and diffuse type SSc (lSSc, dSSc) were examined based on a structured questionnaire score (QS) of GER symptoms, retention fraction of esophageal scintigraphy at 90 s (R 90 ) and gastric emptying time. The QS was significantly higher in the reflux esophagitis group than in the non-esophagitis group (5.4±3.5, 1.4±2.9, P=0.003). When the non-esophagitis group was further divided into lSSc and dSSc groups, R 90 was higher in the reflux esophagitis group (31±18%) and the non-esophagitis group with dSSc (34±32%) than in the non-esophagitis group with lSSc (8±3%, P=0.02). Both high R 90 ≥15% and QS≥4 indicated reflux esophagitis. Conversely, both normal R 90 and QS indicated no reflux esophagitis. A combination of esophageal scintigraphy and structured questionnaire demonstrated different aspects of esophageal dysfunction, namely dysmotility and GER. Patients with high QS and dysmotility may be indicated for further evaluation including endoscopic examination and medical treatment.(author)
Alg Pigmentlerinin Tekstilde Doğal Boyar Madde Olarak Kullanımı
Directory of Open Access Journals (Sweden)
Elif BAYRAKTAR
2018-04-01
Full Text Available Bu çalışmada, mikroalglerden Chlorella vulgaris Beyerinck (Beijerinck, Porphyridium cruentum (S.F.Gray Nageli ve Haematococcus pluvialis Flotow ve makroalglerden Ulva lactuca Linnaeus ve Gracilaria gracilis (Stackhouse M.Steentoft, L.M.Irvine & W.F.Farnham türlerinden pigment ekstraksiyonu gerçekleştirilmiş ve elde edilen pigmentlerin tekstil sanayiinde doğal boyar madde olarak kullanımı konusunda verimliliği araştırılmıştır. Kulanılan türlerden üç farklı çözgen aracılığıyla pigment ekstraksiyonu gerçekleştirilmiş ve her ekstrakt için 4 farklı mordanlama kimyasalı kullanılmıştır. Boyama işleminde yün iplikten faydalanılmıştır. Boyanan ipliklerin ışık haslığına göre değerlendirilmiştir. İplik boyamada en etkili olan türlerin U. lactuca ve G. gracilis olduğu tespit edilmiştir. En iyi mordanlama ise CuSO4, FeSO4 kimyasalları ile gerçekleştirilmiştir.
Charton, Eric
2011-01-01
Comprendre les dernières techniques de hacking pour agir et se protéger! Quelles sont les techniques des hackers pour asservir votre ordinateur, usurper votre identité, pirater vos mots de passe ou pénétrer dans l'intranet de votre entreprise? Comment se protéger de façon efficace et durable? Toutes les réponses à ces questions sont dans cet ouvrage qui explique chaque méthode de hacking et sa mise en pratique, puis détaille les contre-mesures à appliquer. Cette édition mise à jour vous apporte de nouvelles informations sur les outils logiciels de sécurité et expose les principes de la stéganographie. Elle présente également les coffres forts numériques, les logiciels d'anonymat, le phénomène des botnets ainsi que les méthodes de hacking dans les réseaux sociaux et micro-réseaux. Enfin, elle fait le point sur le droit et le piratage en 2011, prend en compte les dernières trouvailles technologiques, du carding au malware, et vous donne les moyens de vous en protéger. Grâce au Ha...
Influence of liquid phase on nanoparticle-based giant electrorheological fluid.
Gong, Xiuqing; Wu, Jinbo; Huang, Xianxiang; Wen, Weijia; Sheng, Ping
2008-04-23
We show that the chemical structures of silicone oils can have an important role in the giant electrorheological (GER) effect. The interaction between silicone oils and solid nanoparticles is found to significantly influence the ER effect. By increasing the kinematic viscosity of silicone oils, which is a function of siloxane chain length, sol-like, gel-like and clay-like appearances of the constituted ER fluids were observed. Different functional-group-terminated silicone oils were also employed as the dispersing media. Significant differences of yield stress were found. We systematically study the effect of siloxane chain lengths on the permeability of oils traveling through the porous spaces between the particles (using the Washburn method), oils adsorbed on the particles' surface (using FT-IR spectra), as well as their particle size distribution (using dynamic light scattering). Our results indicate the hydrogen bonds are instrumental in linking the silicone oil to GER solid particles, and long chain lengths can enhance the agglomeration of the GER nanoparticles to form large clusters. An optimal oil structure, with hydroxyl-terminated silicone oil and a suitable viscosity, was chosen which can create the highest yield stress of ∼300 kPa under a 5 kV mm(-1) DC electric field.
Exposure to PM2.5 and Blood Lead Level in Two Populations in Ulaanbaatar, Mongolia.
Enkhbat, Undarmaa; Rule, Ana M; Resnick, Carol; Ochir, Chimedsuren; Olkhanud, Purevdorj; Williams, D'Ann L
2016-02-15
Approximately 60% of the households in Ulaanbaatar live in gers (a traditional Mongolian dwelling) in districts outside the legal limits of the city, without access to basic infrastructure, such as water, sewage systems, central heating, and paved roads, in contrast to apartment residents. This stark difference in living conditions creates different public health challenges for Ulaanbaatar residents. Through this research study we aim to test our hypothesis that women living in gers burning coal in traditional stoves for cooking and heating during the winter are exposed to higher concentrations of airborne PM2.5 than women living in apartments in Ulaanbaatar, Mongolia, and this exposure may include exposures to lead in coal with effects on blood lead levels. This cross-sectional study recruited a total of 50 women, 40-60 years of age, from these two settings. Air sampling was carried out during peak cooking and heating times, 5:00 p.m.-11:00 p.m., using a direct-reading instrument (TSI SidePak™) and integrated polytetrafluoroethylene (PTFE) filters using the SKC Personal Environmental Monitor. Blood lead level (BLL) was measured using a LeadCare II rapid field test method. In our study population, measured PM2.5 geometric mean (GM) concentrations using the SidePak™ in the apartment group was 31.5 (95% CI:17-99) μg/m³, and 100 (95% CI: 67-187) μg/m³ in ger households (p < 0.001). The GM integrated gravimetric PM2.5 concentrations in the apartment group were 52.8 (95% CI: 39-297) μg/m³ and 127.8 (95% CI: 86-190) μg/m³ in ger households (p = 0.004). The correlation coefficient for the SidePak™ PM2.5 concentrations and filter based PM2.5 concentrations was r = 0.72 (p < 0.001). Blood Lead Levels were not statistically significant different between apartment residents and ger residents (p = 0.15). The BLL is statistically significant different (p = 0.01) when stratified by length of exposures outside of the home. This statistically significant difference
Lansoprazole for children with poorly controlled asthma: a randomized controlled trial.
Holbrook, Janet T; Wise, Robert A; Gold, Benjamin D; Blake, Kathryn; Brown, Ellen D; Castro, Mario; Dozor, Allen J; Lima, John J; Mastronarde, John G; Sockrider, Marianna M; Teague, W Gerald
2012-01-25
Asymptomatic gastroesophageal reflux (GER) is prevalent in children with asthma. Untreated GER has been postulated to be a cause of inadequate asthma control in children despite inhaled corticosteroid treatment, but it is not known whether treatment with proton pump inhibitors improves asthma control. To determine whether lansoprazole is effective in reducing asthma symptoms in children without overt GER. The Study of Acid Reflux in Children With Asthma, a randomized, masked, placebo-controlled, parallel clinical trial that compared lansoprazole with placebo in children with poor asthma control who were receiving inhaled corticosteroid treatment. Three hundred six participants enrolled from April 2007 to September 2010 at 19 US academic clinical centers were followed up for 24 weeks. A subgroup had an esophageal pH study before randomization. Participating children were randomly assigned to receive either lansoprazole, 15 mg/d if weighing less than 30 kg or 30 mg/d if weighing 30 kg or more (n = 149), or placebo (n = 157). The primary outcome measure was change in Asthma Control Questionnaire (ACQ) score (range, 0-6; a 0.5-unit change is considered clinically meaningful). Secondary outcome measures included lung function measures, asthma-related quality of life, and episodes of poor asthma control. The mean age was 11 years (SD, 3 years). The mean difference in change (lansoprazole minus placebo) in the ACQ score was 0.2 units (95% CI, 0.0-0.3 units). There were no statistically significant differences in the mean difference in change for the secondary outcomes of forced expiratory volume in the first second (0.0 L; 95% CI, -0.1 to 0.1 L), asthma-related quality of life (-0.1; 95% CI, -0.3 to 0.1), or rate of episodes of poor asthma control (relative risk, 1.2; 95% CI, 0.9-1.5). Among the 115 children with esophageal pH studies, the prevalence of GER was 43%. In the subgroup with a positive pH study, no treatment effect for lansoprazole vs placebo was observed for
Exposure to PM2.5 and Blood Lead Level in Two Populations in Ulaanbaatar, Mongolia
Directory of Open Access Journals (Sweden)
Undarmaa Enkhbat
2016-02-01
Full Text Available Approximately 60% of the households in Ulaanbaatar live in gers (a traditional Mongolian dwelling in districts outside the legal limits of the city, without access to basic infrastructure, such as water, sewage systems, central heating, and paved roads, in contrast to apartment residents. This stark difference in living conditions creates different public health challenges for Ulaanbaatar residents. Through this research study we aim to test our hypothesis that women living in gers burning coal in traditional stoves for cooking and heating during the winter are exposed to higher concentrations of airborne PM2.5 than women living in apartments in Ulaanbaatar, Mongolia, and this exposure may include exposures to lead in coal with effects on blood lead levels. This cross-sectional study recruited a total of 50 women, 40–60 years of age, from these two settings. Air sampling was carried out during peak cooking and heating times, 5:00 p.m.–11:00 p.m., using a direct-reading instrument (TSI SidePak™ and integrated polytetrafluoroethylene (PTFE filters using the SKC Personal Environmental Monitor. Blood lead level (BLL was measured using a LeadCare II rapid field test method. In our study population, measured PM2.5 geometric mean (GM concentrations using the SidePak™ in the apartment group was 31.5 (95% CI:17–99 μg/m3, and 100 (95% CI: 67–187 μg/m3 in ger households (p < 0.001. The GM integrated gravimetric PM2.5 concentrations in the apartment group were 52.8 (95% CI: 39–297 μg/m3 and 127.8 (95% CI: 86–190 μg/m3 in ger households (p = 0.004. The correlation coefficient for the SidePak™ PM2.5 concentrations and filter based PM2.5 concentrations was r = 0.72 (p < 0.001. Blood Lead Levels were not statistically significant different between apartment residents and ger residents (p = 0.15. The BLL is statistically significant different (p = 0.01 when stratified by length of exposures outside of the home. This statistically
Fortællinger fra supermarkedet
DEFF Research Database (Denmark)
Hermansen, Judy
2008-01-01
Health Branding projektet undersøger, hvad det er for nogle forestillinger forbrugerne har om sundt og usundt - og hvilket symbolunivers disse forestillinger artikulerer sig i. Udgivelsesdato: november...
Sverdlik, Risto
2009-01-01
Autori hinnangul on Eesti tervishoiusüsteem sotsialistlik ning suhteliselt sarnase tervishoiusüsteemiga riikides on samad probleemid: ravijärjekorrad ja kulude kasv. Singapuri tervishoiumudelist. Autor leiab, et keskse planeerimisega tervishoiusüsteemi puhul kannatavad kõige rohkem vaesed, turumajanduslikus süsteemis aga ravihinnad järjest väheneksid
Multi-Word Units in Monolingual Scandinavian Dictionaries
DEFF Research Database (Denmark)
Schoonderbeek Hansen, Inger
Referat af NFL (Nordisk Forening for Leksikografi) Symposium om Ordforbindelser i monolingvale nordiske ordbøger. Introduktion, referat af alle 13 foredrag og efterfølgende diskussion samt konklusion....
Bottom-up Experiments and Concrete Utopias
DEFF Research Database (Denmark)
Andersson, Lasse
2010-01-01
Artiklen undersøger hvorledes brugerdrevne experimenter kan udfordre den standardiserede erhvervsorienterede udgave af Oplevelsesbyen og via eksperimentet stimulerer lokalt forankrede og demokratiske udgaver af en oplevelses- og vidensbaseret by....
Tihii omut / Peeter Rebane ; interv. Aleksandra Manukjan
Rebane, Peeter, 1973-
2004-01-01
Uuest kohvikust ja gei-klubist "Angel" Tallinnas. Stiilse atmosfääri loomisel olid abiks stilist Gerly Tinn, graafikadisainer Rain Pikand ja reklaamifirma Division. Sisekujunduse tegi disainer John Gregg Suurbritanniast
OL Copenhagen 2020: Strategisk utopi?
DEFF Research Database (Denmark)
Østergaard, Katrine; Møller Christensen, Søren
2006-01-01
Ny rapport anbefaler, at København ansøger om værtskabet for sommer-OL i 2020. Kulturminister Brian Mikkelsen vil tidligst tage stilling til en reel ansøgning om tre år. Der er da også god grund til at tænke sig rigtig godt om, før man engagerer sig med verdens største event......Ny rapport anbefaler, at København ansøger om værtskabet for sommer-OL i 2020. Kulturminister Brian Mikkelsen vil tidligst tage stilling til en reel ansøgning om tre år. Der er da også god grund til at tænke sig rigtig godt om, før man engagerer sig med verdens største event...
Enfermedad por reflujo gastroesofágico en niños Disease due to gastroesophageal reflux in children
Directory of Open Access Journals (Sweden)
Leonor Adriana Castiblanco Galvis
1997-03-01
Full Text Available En niños normales el reflujo gastroesofágico (RGE es usualmente autolimitado. La enfermedad por RGE (ERGE causa severos problemas respiratorios, gastrointestinales y de alimentación. La ERGE es causa frecuente de morbilidad en niños. El propósito del presente artículo es describir la fisiopatología, las manifestaciones clínicas, el diagnóstico, el manejo y las complicaciones de la ERGE en niños. In normal infants gastroesophageal reflux (GER is usually self-limited but GER disease (GERD is a frequent cause of morbidity in childhood, causing severe respiratory, gastrointestinal and feeding problems. This review describes the pathophysiology, clinical aspects,diagnosis, treatment and complications of GERD in children.
Per-oral endoscopic myotomy (POEM) for esophageal achalasia.
Pescarus, Radu; Shlomovitz, Eran; Swanstrom, Lee L
2014-01-01
Per-oral endoscopic myotomy (POEM) is a new minimally invasive endoscopic treatment for achalasia. Since the first modern human cases were published in 2008, around 2,000 cases have been performed worldwide. This technique requires advanced endoscopic skills and a learning curve of at least 20 cases. POEM is highly successful with over 90 % improvement in dysphagia while offering patients the advantage of a low impact endoscopic access. The main long-term complication is gastroesophageal reflux (GER) with an estimated incidence of 35 %, similar to the incidence of GER post-laparoscopic Heller with fundoplication. Although POEM represents a paradigm shift in the treatment of achalasia, more long-term data are clearly needed to further define its role in the treatment algorithm of this rare disease.
Nicole Krauss’un Aşkın Tarihi Adlı Romanında Tarihi İzlekler
KALAY, Faruk
2014-01-01
Modern edebiyatta önemli Yahudi Amerikan yazarlarından olan Nicole Krauss Yahuditoplumundaki yabancılaşma, yalnızlık ve göç konularına değinir. Başarılı romanı olanAşkın Tarihi II. Dünya Savaşı süresince Holokost’a maruz kalan ve etkilerini hissedenYahudi karakterle ilgilidir. Tarihle bütünleşen bu karakterler gerçek hayattakiinsanlardan ve olaylardan esinlenmiştir. Krauss romanında postmodern teknikleri dekullanır. Örneğin iç içe anlatım tekniği okuyucuya romanın kurgusal mı yoksa gerçek mio...
DEFF Research Database (Denmark)
Ringgaard, Dan
med erindring og historie, til i højere grad at være et knudepunkt for globale kredsløb. Forfatteren søger svar på sine spørgsmål til stedet i litteraturen, i hvad der er tænkt og skrevet om stedet, og på stederne selv. I essays om blandt andet politikommissær Maigret, Graham Greenes eksotiske...... spioner, Thomas Bobergs rejsebøger, Inger Christensens og Morten Søndergaards digte, om litteraturens landmålere og korttegnere, om stedets teori – og på virkelige steder i Bahia, Brasilien: en lufthavn og et hotel, en storby, en mineby der nu ernærer sig ved turisme, og en palmeø udvikles en sans...
Le genre Sivanasua (Lophocyoninae, Hyaenodontidae, Creodonta, Mammalia
Directory of Open Access Journals (Sweden)
Morales, J.
1999-08-01
Full Text Available Two upper teeth from the lower Miocene of Le Chêne de Navere (Gers, France are interpreted as MI and M2 of Sivanasua viverroides. The genus is known in Europe by two species. The origin of the Lophocyoninae is re-evaluated. We consider the group as rooted in some African Hyaenodontoid Creodonta.Dos dientes del yacimiento mioceno (MN4b de Chêne de Navere (Gers, Francia se interpretan como MI y M2 de Sivanasua viverroides. El género Sivanasua está representado en Europa por dos especies. El origen de los Lophocyoninae se reconsidera, primero atribuidos a los Ailuridae y después relacionados con los Viverridae, aquí son considerados como emparentados a los Creodontos Hyaenodontidae africanos.
SAĞIR, Mehmet; TÜRKERİ, İlker
2015-01-01
Günümüz bilgi çağında işletmeler için ekonomik çıkarların gerçekleşmesi zorlu rekabet koşullarından geçmektedir. Bunun nedeni ise küreselleşmenin etkileri ile işletmenin çevresindeki çıkar gruplarının (paydaşların) beklentilerinin nitelik ve nicelik olarak değişmesi, özellikle de sosyal boyutlara taşınmasıdır. Sosyal değerleri yaratmak için gerçekleştirilen faaliyetler “sosyal sorumluluk” olarak nitelendirilirken, işletmelerin sosyal sorumluluk faaliyetlerinin kurumsal beklentilerle bağlantıl...
Dansk Almenmedicinsk Forskningsdag - DAF 2015
DEFF Research Database (Denmark)
Geyti, Christine Ladegaard
2015-01-01
Den 18. marts blev Dansk Almenmedicinsk Forskningsdag (DAF) afholdt i København. Arrangementet foregik i Domus Medicas flotte adelspalæ med prægtige lysekroner og hyggelige opholdsrum med bløde lænestole og gamle bøger op og ned ad væggene. Der blev nu ikke megen tid til at slænge sig, for progra......Den 18. marts blev Dansk Almenmedicinsk Forskningsdag (DAF) afholdt i København. Arrangementet foregik i Domus Medicas flotte adelspalæ med prægtige lysekroner og hyggelige opholdsrum med bløde lænestole og gamle bøger op og ned ad væggene. Der blev nu ikke megen tid til at slænge sig...
Art History in The Nordic Countries
DEFF Research Database (Denmark)
Dam Christensen, Hans; Karlholm, Dan; Rampley, Matthew
2012-01-01
Artiklen belyser kunsthistoriefagets udvikling i Danmark, Norge, Sverige og Finland siden midten af 1800-tallet og frem til i dag, hvorvisuel kultur-studier i stigende grad præger billedforskningen....
New atheistic approaches in the cognitive science of religion
DEFF Research Database (Denmark)
Geertz, Armin W.
2009-01-01
Bidraget diskuterer, hvorledes Dennetts og Dawkins bøger om religion kan opfattes som bidrag til nyere religionsteorier. Bidraget kritisk analyserer henholdsvis Breaking the spell (Dennett) og The God delusion (Dawkins)....
Directory of Open Access Journals (Sweden)
Eloá Otrenti
2011-06-01
Full Text Available Reflective Portfolio is a set of registers carried through students about their experiences in the process teach-learning. The objective of this work was to describe the meaning of the Reflective Portfolio use as method of evaluation in the Nursing Management Residence course. The dynamics of this experience is composed in three main parts: (1 “how I arrived at the course”, (2 “education situations” and (3 “my village”. The use of this methodology of evaluation was not restricted only to the filling of works, but a space of reflection about daily and chance of praxis theoretical. Finally, the experience of this instrument resulted in important ingredient for improvement of the attitudes in practical situations, stimulating, change of behavior and transformation of the professional behavior. Portfólio Reflexivo é um conjunto de registros realizados por estudantes a respeito de suas vivências no processo ensino-aprendizagem. Este trabalho tem como objetivo descrever o significado do uso do Portfólio Reflexivo como método de avaliação no curso de Residência em Gerência dos Serviços de Enfermagem da Universidade Estadual de Londrina-PR. A dinâmica dessa vivência compõe-se de três partes principais: (1 como cheguei ao curso, (2 situações de ensino e (3 minha aldeia. A utilização dessa metodologia de avaliação não se restringiu apenas ao arquivamento de trabalhos, mas sim como espaço de reflexão dos residentes em relação ao seu cotidiano e oportunidade de teorização da prática. A experiência adquirida resultou em importante ingrediente para melhoria das atitudes em situações práticas, e estimulou, assim, mudança de comportamento e transformação da conduta profissional.
Vene Kultuurikeskus = The Russian Culture Centre / Margit Mutso
Mutso, Margit, 1966-
2010-01-01
Tallinnas Mere puiestee 5 asuva hoone (arhitekt A. Kuznetsov, 1954) restaureerimisest. Arhitekt Niina Mäger, sisearhitekt Anne Tamverk. Ajaloolane Aleksandr Pantelejev. Žürii liikme Mait Summataveti hinnang kultuurkapitali aastapreemiale esitatud hoonele
Raivo Puusepp : Tartu kaubamaja idealistlik autor / Raivo Puusepp ; interv. Askur Alas
Puusepp, Raivo, 1960-
2005-01-01
Arhitekt Raivo Puusepaga äsjavalminud Tartu kaubamaja arhitektuurist, kõrghoonetest Tallinnas. Raivo Puusepa lühibiograafia. Oleg Sapozhnin Raivo Puusepast. Linnart Mäll, Enriko Talvistu ja Merle Jääger Tartu kaubamajast
Does surgery correct esophageal motor dysfunction in gastroesophageal reflux
International Nuclear Information System (INIS)
Russell, C.O.; Pope, C.E.; Gannan, R.M.; Allen, F.D.; Velasco, N.; Hill, L.D.
1981-01-01
The high incidence of dysphagia in patients with symptomatic gastroesophageal reflux (GER) but no evidence of peptic stricture suggests esophageal motor dysfunction. Conventional methods for detecting dysfunction (radiologic and manometric examinations) often fail to detect abnormality in these patients. Radionuclide transit (RT), a new method for detecting esophageal motor dysfunction, was used to prospectively assess function in 29 patients with symptomatic GER uncomplicated by stricture before and three months after antireflux surgery (HILL). The preoperative incidence of dysphagia and esophageal dysfunction was 73% and 52%, respectively. During operation (Hill repair), intraoperative measurement of the lower esophageal sphincter pressure was performed and the LESP raised to levels between 45 and 55 mmHg. The preoperative lower esophageal sphincter pressure was raised from a mean of 8.6 mmHg, to mean of 18.5 mmHg after operation. No patient has free reflux after operation. Postoperative studies on 20 patients demonstrated persistence of all preoperative esophageal dysfunction despite loss of dysphagia. RT has demonstrated a disorder of esophageal motor function in 52% of patients with symptomatic GER that may be responsible for impaired esophageal clearance. This abnormality is not contraindication to surgery. The results indicate that construction of an effective barrier to reflex corrects symptoms of reflux, even in the presence of impaired esophageal transit. Radionuclide transit is a safe noninvasive test for assessment of esophageal function