WorldWideScience

Sample records for aaps

  1. Automated Assessment of Postural Stability (AAPS)

    Science.gov (United States)

    2016-10-01

    testing. Technical Details The AAPS system has been developed in the C# programming language in the Microsoft Visual Studio 2015 programming...than was originally budgeted, because he has completed didactic coursework and is now devoted primarily to research. Despite being under budget

  2. Molecular evolution of plant AAP and LHT amino acid transporters

    Directory of Open Access Journals (Sweden)

    Mechthild eTegeder

    2012-02-01

    Full Text Available Nitrogen is an essential mineral nutrient and it is often transported within living organisms in its reduced form, as amino acids. Transport of amino acids across cellular membranes requires proteins, and here we report the phylogenetic analysis across taxa of two amino acid transporter families, the Amino Acid Permeases (AAPs and the Lysine-Histidine-like Transporters (LHTs. We found that the two transporter families form two distinct groups in plants supporting the concept that both are essential. AAP transporters seem to be restricted to land plants. They were found in Selaginella moellindorffii and Physcomitrella patens but not in Chlorophyte, Charophyte or Rhodophyte algae. AAPs were strongly represented in vascular plants, consistent with their major function in phloem (vascular tissue loading of amino acids for sink nitrogen supply. LHTs on the other hand appeared prior to land plants. LHTs were not found in chlorophyte algae Chlamydomonas reinhardtii and Volvox carterii. However, the characean alga Klebsormidium flaccidum encodes KfLHT13 and phylogenetic analysis indicates that it is basal to land plant LHTs. This is consistent with the hypothesis that characean algae are ancestral to land plants. LHTs were also found in both Selaginella moellindorffii and Physcomitrella patens as well as in monocots and eudicots. To date, AAPs and LHTs have mainly been characterized in Arabidopsis (eudicots and these studies provide clues to the functions of the newly identified homologs.

  3. Role for the A domain of unprocessed accumulation-associated protein (Aap) in the attachment phase of the Staphylococcus epidermidis biofilm phenotype.

    Science.gov (United States)

    Conlon, Brian P; Geoghegan, Joan A; Waters, Elaine M; McCarthy, Hannah; Rowe, Sarah E; Davies, Julia R; Schaeffer, Carolyn R; Foster, Timothy J; Fey, Paul D; O'Gara, James P

    2014-12-01

    The polysaccharide intercellular adhesin or the cell wall-anchored accumulation-associated protein (Aap) mediates cellular accumulation during Staphylococcus epidermidis biofilm maturation. Mutation of sortase, which anchors up to 11 proteins (including Aap) to the cell wall, blocked biofilm development by the cerebrospinal fluid isolate CSF41498. Aap was implicated in this phenotype when Western blots and two-dimensional (2D) electrophoresis revealed increased levels of the protein in culture supernatants. Unexpectedly, reduced levels of primary attachment were associated with impaired biofilm formation by CSF41498 srtA and aap mutants. In contrast to previous studies, which implicated Aap proteolytic cleavage and, specifically, the Aap B domains in biofilm accumulation, the CSF41498 Aap protein was unprocessed. Furthermore, aap appeared to play a less important role in the biofilm phenotype of S. epidermidis 1457, in which the Aap protein is processed. Anti-Aap A-domain IgG inhibited primary attachment and biofilm formation in strain CSF41498 but not in strain 1457. The nucleotide sequences of the aap gene A-domain region and cleavage site in strains CSF41498 and 1457 were identical, implicating altered protease activity in the differential Aap processing results in the two strains. These data reveal a new role for the A domain of unprocessed Aap in the attachment phase of biofilm formation and suggest that extracellular protease activity can influence whether Aap contributes to the attachment or accumulation phases of the S. epidermidis biofilm phenotype.

  4. Spectroscopic Classification of SN 2017aap as a Type Ia Supernova

    Science.gov (United States)

    Zhang, Jujia; Xin, Yuxin; Xu, Zhijian; Li, Wenxiong; Wang, Xiaofeng; Li, Bin; Zhao, Haibin; Wang, Lifan; Tan, Hanjie; Rui, Liming; Yang, Zesheng

    2017-02-01

    We obtained an optical spectrum (range 340-830 nm) of SN 2017aap (=PTSS-17die), discovered by the PMO-Tsinghua Supernova Survey (PTSS, http://www.cneost.org/ptss/), on UT Feb.02.9 2017 with the 2.4 m telescope (LJT + YFOSC) at LiJiang Gaomeigu Observatory of Yunnan Observatories (YNAO).

  5. Spectroscopic Classification of SN 2017aap as a Type Ia Supernova

    Science.gov (United States)

    Zhang, Jujia; Xin, Yuxin; Xu, Zhijian; Li, Wenxiong; Wang, Xiaofeng; Li, Bin; Zhao, Haibin; Wang, Lifan; Tan, Hanjie; Rui, Liming; Yang, Zesheng

    2017-02-01

    We obtained an optical spectrum (range 340-830 nm) of SN 2017aap (=PTSS-17die), discovered by the PMO-Tsinghua Supernova Survey (PTSS, http://www.cneost.org/ptss/), on UT Feb.02.9 2017 with the 2.4 m telescope (LJT + YFOSC) at LiJiang Gaomeigu Observatory of Yunnan Observatories (YNAO).

  6. Co-metabolic biodegradation of acetamiprid by Pseudoxanthomonas sp. AAP-7 isolated from a long-term acetamiprid-polluted soil.

    Science.gov (United States)

    Wang, Guangli; Zhao, Yanjiao; Gao, Hao; Yue, Wenlong; Xiong, Minghua; Li, Feng; Zhang, Hui; Ge, Wei

    2013-12-01

    An AAP-degrading bacterium, AAP-7, was isolated from AAP-polluted soil. AAP-7 was identified as Pseudoxanthomonas sp. on the basis of the comparative analysis of 16S rDNA sequences. The strain was able to transformate more than 80% AAP by means of co-metabolism and degraded AAP via hydrolysis or demethylation to form (E)-3-(((6-chloropyridin-3yl)methyl)(methyl)amino)acrylonitrile and N-((6-chloropyridin-3yl)methyl)-N-methylprop-1-en-2-amine, both of which transformed into ultimate product, which was 1-(6-chloropyridin-3yl)-N-methylmethanamine. A novel degradation pathway was proposed based on these metabolites. AAP could be transformed with a maximum specific degradation rate, half-saturation constant and inhibit constant of 1.775/36 h, 175.3 mg L(-1), and 396.5 mg L(-1), respectively, which proved that the degradation rate of AAP could be restrained at high AAP concentration. This paper highlights a significant potential use of co-metabolic cultures of microbial cells for the cleanup of AAP-contaminated soil.

  7. Scientific impact of presentations from the EURAPS and the AAPS meetings

    DEFF Research Database (Denmark)

    Khorasani, Hoda; Lassen, Mats Højbjerg; Kuzon, William

    2017-01-01

    INTRODUCTION: Presentation at scientific meetings is the usual first step to communicate new research findings. However, without subsequent, peer-reviewed publication, the wider propagation and the permanent documentation of important scholarly work may be lost. Our aim was to analyze and compare...... the publication status of the work presented at the European Association of Plastic Surgeons' (EURAPS) and at the American Association of Plastic Surgeons' (AAPS) annual meetings. MATERIALS AND METHODS: By using the abstract booklets from the annual meetings, all presentations given over a 10-year period (2000...... and EURAPS have the highest publication rates for surgical abstracts, indicating a high scientific value of these meetings....

  8. Autolytic Activity and Plasma Binding Study of Aap, a Novel Minor Autolysin of Streptococcus pneumoniae

    Directory of Open Access Journals (Sweden)

    Ramina Mahboobi

    2016-04-01

    Full Text Available Pneumococcal autolysins are enzymes involved in cell wall turnover and cellular division physiologically. They have been found to be involved in the pneumococcus pathogenesis. The aim of this study was to identify the autolytic activity of Spr1754 as a novel protein of Streptococcus pneumoniae. Moreover, the binding of the recombinant protein to plasma proteins was also determined. The spr1754 gene was amplified by PCR and cloned into the pET21a(+ prokaryotic expression vector. The constructed pET21a(+/spr1754 recombinant plasmid was transformed into E. coli Origami (DE3 and induced using IPTG. The recombinant protein of Spr1754 was purified by Ni-NTA affinity chromatography and confirmed by SDS-PAGE and Western blot analysis using anti-His tag monoclonal antibody. Autolytic activity and the ability of the recombinant protein in binding to plasma proteins were performed using zymogram analysis and western blot, respectively. The spr1754 with expected size was cloned and overexpressed in Escherichia coli Origami (DE3, successfully. After purification of the Spr1754 recombinant protein, the autolytic activity was observed by zymography. Of the four plasma proteins used in this study, binding of lactoferrin to Spr1754 recombinant protein was shown. The Spr1754 recombinant protein has a bifunctional activity, i.e., as being autolysin and lactoferrin binding and designated as Aap (autolytic/ adhesion/ pneumococcus. Nevertheless, characterization of the Aap needs to be followed using gene inactivation and cell wall localization.

  9. SELECTIVE EVALUATION OF TWO URINARY ENZYMES (NAG AND AAP BEFORE AND AFTER UNILATERAL SHOCK WAVE LITHOTRIPSY

    Directory of Open Access Journals (Sweden)

    M. R. Nikoobakht

    2006-09-01

    Full Text Available Biological effects extracorporeal shock wave lithotripsy (ESWL is not precisely known. We have evaluated two urinary enzymes activity N-acetyl-B-D-glucosamine (NAG and alanine amino peptidase (AAP before and after unilateral ESWL as markers for renal parenchymal damage. Forty eight patients with kidney stones (mean age 39 who had presented for the first time or at least one year after their previous lithotripsy underwent ESWL. Urinary specimens were collected before and after first, third and seventh days of lithotripsy and NAG, AAP were evaluated. These enzymes displayed the greatest activity 24 hours after ESWL with significant difference compared to the control group, (P < 0.05 versus 0.02. Elevation of urinary enzymes activity correlated with stone size particularly stones larger than 2 cm. These data suggest that there is some tubular and parenchymal damage induced by ESWL that needs time to get improved. The higher urinary enzyme activity in patients with larger stones ( > 2 cm is probably related to injury resulting from passage of smaller stones, produced after lithotripsy of a large stone, and it is suggested that these patients are treated with a safer procedure.

  10. Variation in the Management of Infants Hospitalized for Bronchiolitis Persists After the 2006 AAP Bronchiolitis Guidelines

    Science.gov (United States)

    Florin, Todd A.; Byczkowski, Terri; Ruddy, Richard M.; Zorc, Joseph J.; Test, Matthew; Shah, Samir S.

    2014-01-01

    Objective To describe variation across US pediatric hospitals in the utilization of resources not recommended for routine use by the AAP guideline for infants hospitalized with bronchiolitis and to examine the association between resource utilization and disposition outcomes. Study design We conducted a cross-sectional study of infants ≤12 months hospitalized for bronchiolitis from 2007-2012 at 42 hospitals contributing data to the Pediatric Health Information System. Patients with asthma were excluded. The primary outcome was hospital-level variation in utilization of five resources not recommended for routine use: albuterol, racemic epinephrine, corticosteroids, chest radiography and antibiotics. We also examined the association of resource utilization with length of stay (LOS) and readmission. Results 64,994 hospitalizations were analyzed. After adjustment for patient characteristics, albuterol (median, 52.4%; range, 3.5%-81%), racemic epinephrine (20.1%; 0.6%-78.8%), and chest radiography (54.9%; 24.1%-76.7%) had the greatest variation across hospitals. Utilization of albuterol, racemic epinephrine, and antibiotics did not change significantly over time compared with small decreases in corticosteroid (3.3%) and chest radiography (8.6%) use over the study period. Utilization of each resource was significantly associated with increased LOS without concomitant decreased odds of readmission. Conclusions Substantial use and variation in five resources not recommended for routine use by the AAP bronchiolitis guideline persists with increased utilization associated with increased LOS without the benefit of decreased readmission. Future work should focus on developing processes that can be widely disseminated and easily implemented to minimize unwarranted practice variation when evidence and guidelines exist. PMID:25015578

  11. Did the 2011 AAP recommendations on youth HIV testing change practice? Trends from a large urban adolescent program

    Directory of Open Access Journals (Sweden)

    Seetharaman S

    2017-04-01

    Full Text Available Sujatha Seetharaman,1 Cathryn L Samples,2 Maria Trent3 1Division of Adolescent Medicine, Stanford University Medical Center, Palo Alto, CA, 2Division of Adolescent Medicine, Boston Children’s Hospital, Harvard Medical School, Boston, MA, 3Division of General Pediatrics and Adolescent Medicine, Johns Hopkins Bloomberg School of Public Health, Johns Hopkins School of Medicine, Baltimore, MD, USA Purpose: The purpose of this study was to determine whether there is adherence to the October 2011 American Academy of Pediatrics (AAP recommendations for HIV screening in a large urban adolescent program with availability of a publicly funded program providing free, confidential, sexually transmitted infection (STI and HIV counseling and testing (then rapid or third generation HIV testing, nested in the same adolescent clinic.Methods: We conducted a retrospective chart review of HIV screening trends among 13- to 24-year-old patients tested for HIV during periods of January 2010 to June 2011 (18 months pre-AAP recommendations period and July 2011 to December 2012 (18-month period, which included 15 months after the AAP recommendations.Results: During the period of January 2010 to June 2011, there were 22 tests/1,000 medical visits (N = 824 of 37,520 medical visits, and during the period of July 2011 to December 2012, there were 27 tests/1,000 medical visits (N = 1,068 of 38,763 medical visits (p < 0.0001, odds ratio [OR] 1.26. The number of 13- to 18-year-old patients screened in the pre-AAP period was 150, compared to 297 in the second 18-month period (X2 = 43.3, df = 1, p < 0.0001. A summative risk profile score of 0–9 was created in the form of a continuous variable, with a risk score of 0 for those with no risk factor identified and 1 point for each risk behavior identified. The proportion of HIV test clients with zero-specified risk (a risk score of “0” increased from 2010 to 2012.Conclusion: Release of the 2011 AAP HIV testing guidelines

  12. Newborn Male Circumcision with Parental Consent, as Stated in the AAP Circumcision Policy Statement, Is Both Legal and Ethical.

    Science.gov (United States)

    Brady, Michael T

    2016-06-01

    Newborn male circumcision is a minor surgical procedure that has generated significant controversy. Accumulating evidence supports significant health benefits, most notably reductions in urinary tract infections, acquisition of HIV and a number of other sexually transmitted infections, penile cancer, phimosis, paraphimosis, balanitis and lichen sclerosis. While circumcision, like any surgical procedure, has risks for complications, they occur in less than 1 in 500 infants circumcised and most are minor and require minimal intervention. The CDC and the American Academy of Pediatrics (AAP) believe that health benefits of circumcision outweigh the risks. For this reason, the AAP believes that parents should be allowed to make the decision concerning circumcision of their male infants after receiving non-biased information on health risks and health benefits.

  13. [Neonatal hypoxic-ischemic nephropathy and urinary diagnostic indices: the utility of measuring tubular enzymes (NAG and AAP)].

    Science.gov (United States)

    Bertotti, A; De Marchi, S; Brovedani, P; Gaeta, G; Peratoner, L; Mangiarotti, M A

    1990-01-01

    Feto-neonatal hypoxia can cause a functional kidney impairment, which is often temporary and not clinically overt, but sometimes leading to acute renal failure. Hypoxic stress may result in a tubulo-interstitial damage, and kidney tubular enzymes determination has proved to be an easy, early, and non invasive method to define a tubular interstitial lesion. A major target of nephrotoxicity is the proximal tubular cell: alterations in brush-border membrane and cytoplasm result in increased turnover processes in the kidney cortex, following by a corresponding increased excretion of alanine-aminopeptidase (AAP) and N-acetyl-glucosaminidase (NAG) from the proximal tubular cells, long before glomerular or tubular functions are impaired. AAP and NAG excretion is directly correlated with the strength and the duration of toxic alteration of the proximal tubule. NAG and AAP have been already studied in the adults and the children; they have been chosen for this investigation with a double aim: 1) to define the amount of their urinary excretion in relation with gestational age at birth; 2) to evaluate if in the newborn, independently of the gestational age, their urinary concentration may be increased by ischaemic conditions caused by hypoxia. We studied 52 healthy newborns (7 preterm of 33-36 weeks and 45 full-term) and 16 newborns with feto-neonatal hypoxia (8 preterm of 26-36 weeks and full-term) at the forth day of life. Urinary NAG and AAP were assayed by colorimetric methods and the results expressed as mU/mg. creatininuria.(ABSTRACT TRUNCATED AT 250 WORDS)

  14. Role of the two-component regulatory system arlRS in ica operon and aap positive but non-biofilm-forming Staphylococcus epidermidis isolates from hospitalized patients.

    Science.gov (United States)

    Wu, Yang; Liu, Jingran; Jiang, Juan; Hu, Jian; Xu, Tao; Wang, Jiaxue; Qu, Di

    2014-11-01

    The ica operon and aap gene are important factors for Staphylococcus epidermidis biofilm formation. However, we found 15 out of 101 S. epidermidis strains isolated from patients had both the ica operon and the aap gene in the genome but could not form biofilms (ica(+)aap(+)/BF(-) isolates). Compared with standard strain RP62A, the 15 ica(+)aap(+)/BF(-) isolates had similar growth curves and initial attachment abilities, but had much lower apparent transcription levels of the icaA gene and significantly less production of polysaccharide intercellular adhesion (PIA). Furthermore, the expression of accumulation-associated protein in ica(+)aap(+)/BF(-) isolates was much weaker than in RP62A. The mRNA levels of icaADBC transcription-related regulatory genes, including icaR, sarA, rsbU, srrA, arlRS and luxS, were measured in the 15 ica(+)aap(+)/BF(-) clinical isolates. The mRNA levels of arlR and rsbU in all of the ica(+)aap(+)/BF(-) isolates were lower than in RP62A at 4 h. At 10 h, 14/15 of the isolates showed lower mRNA levels of arlR and rsbU than shown by RP62A. However, expression of sarA, luxS, srrA and icaR varied in different ica(+)aap(+)/BF(-) isolates. To further investigate the role of arlRS in biofilm formation, we analyzed icaA, sarA and rsbU transcription, PIA synthesis, Aap expression and biofilm formation in an arlRS deletion mutant of S. epidermidis strain 1457 and all were much less than in the wild type strain. This is consistent with the hypothesis that ArlRS may play an important role in regulating biofilm formation by the ica(+)aap(+)/BF(-)S. epidermidis clinical isolates and operate via both ica-dependent and Aap-dependent pathways.

  15. Tertiary Treatment of Effluent from Holston AAP (Army Ammunition Plant) Industrial Liquid Waste Treatment Facility. 4. Ultraviolet Radiation and Hydrogen Peroxide Studies: TNT, RDX, HMX, TAX, and SEX

    Science.gov (United States)

    1984-03-01

    AAP Technical Report INDUSTRIAL LIQUID WASTE TREATMENT FACILITY Feb 1983 - Aug 1983 IV. ULTRAVIOLET RADIATION AND HYDROGEN PEROXIDE 1. PERPnRUINe ORO ...ultraviolet light. The production of nitrate-nitrogen and loss of total organic carbon was reportedly indicative of the mineralization of TNT. 5...Treatment of Effluent from Holston AAP Industrial Liquid Waste Treatment Facility. II. Corona Oxidation Studies: TNT, RDX, HMX, TAX, and SEX. Technical

  16. Veracity and rhetoric in paediatric medicine: a critique of Svoboda and Van Howe's response to the AAP policy on infant male circumcision.

    Science.gov (United States)

    Morris, Brian J; Tobian, Aaron A R; Hankins, Catherine A; Klausner, Jeffrey D; Banerjee, Joya; Bailis, Stefan A; Moses, Stephen; Wiswell, Thomas E

    2014-07-01

    In a recent issue of the Journal of Medical Ethics,Svoboda and Van Howe commented on the 2012 changein the American Academy of Pediatrics (AAP) policy on newborn male circumcision, in which the AAP stated that benefits of the procedure outweigh the risks. Svoboda and Van Howe disagree with the AAP conclusions. We show here that their arguments against male circumcision are based on a poor understanding of epidemiology,erroneous interpretation of the evidence, selective citation of the literature, statistical manipulation of data, and circular reasoning. In reality, the scientific evidence indicates that male circumcision, especially when performed in the newborn period, is an ethically and medically sound low-risk preventive health procedure conferring a lifetime of benefits to health and well-being.Policies in support of parent-approved elective newborn circumcision should be embraced by the medical,scientific and wider communities.

  17. Distribution of Pathogenic Genes aatA, aap, aggR, among Uropathogenic Escherichia coli (UPEC) and Their Linkage with StbA Gene.

    Science.gov (United States)

    Nazemi, A; Mirinargasi, M; Merikhi, N; Sharifi, S H

    2011-07-01

    Urinary tract infection (UTI) with E. coli (UPEC) is one of the most common bacterial infections among human beings. In addition to the host predisposing factors, genes are also proposed to have an important role in the occurrence of UTIs. This study investigated the distribution of three pathogenic genes including aggR, aap and aatA among UPEC infected samples and their linkage with stbA, the essential gene for maintaining of pAA plasmid. A total of 244 samples were collected from patients with UTIs through clinical laboratories located in western side of Tehran (Iran) during years 2008-2009. E. coli isolation was performed according to standard laboratory methods. DNAs were extracted from samples using Boiling method, and the presence of aap, aggR, aatA and stbA genes were investigated by PCR. No pathogenic genes (aap, aggR, aatA) were found in 104 out of 244 UPEC samples, while 14 of them were carrying stbA gene. Out of 140 UPEC samples with pathogenic genes, 94 (46.6%) were carrying aap gene, 52 (23%) aggR gene, and 80 (35.4%) aatA gene. A total of 18 samples were also carrying all pathogenic genes together. Moreover, 44 out of 144 samples were carrying stbA gene. The results obtained by this study showed that the aggR, aap and aatA pathogenic genes have different existence patterns in different E. coli strains that infect different organs. Our study also showed that these three plasmid genes in EAEC strains are able to transpose in the genome and change their level of linkage with pAA plasmid essential gene stbA. Meanwhile, this study confirmed that aggR, aap and aatA genes are not specific to only EAEC strains.

  18. 2012 AAPS National Biotech Conference Open Forum: a perspective on the current state of immunogenicity prediction and risk management.

    Science.gov (United States)

    Rajadhyaksha, Manoj; Subramanyam, Meena; Rup, Bonnie

    2013-10-01

    The immunogenicity profile of a biotherapeutic is determined by multiple product-, process- or manufacturing-, patient- and treatment-related factors and the bioanalytical methodology used to monitor for immunogenicity. This creates a complex situation that limits direct correlation of individual factors to observed immunogenicity rates. Therefore, mechanistic understanding of how these factors individually or in concert could influence the overall incidence and clinical risk of immunogenicity is crucial to provide the best benefit/risk profile for a given biotherapeutic in a given indication and to inform risk mitigation strategies. Advances in the field of immunogenicity have included development of best practices for monitoring anti-drug antibody development, categorization of risk factors contributing to immunogenicity, development of predictive tools, and development of effective strategies for risk management and mitigation. Thus, the opportunity to ask "where we are now and where we would like to go from here?" was the main driver for organizing an Open Forum on Improving Immunogenicity Risk Prediction and Management, conducted at the 2012 American Association of Pharmaceutical Scientists' (AAPS) National Biotechnology Conference in San Diego. The main objectives of the Forum include the following: to understand the nature of immunogenicity risk factors, to identify analytical tools used and animal models and management strategies needed to improve their predictive value, and finally to identify collaboration opportunities to improve the reliability of risk prediction, mitigation, and management. This meeting report provides the Forum participant's and author's perspectives on the barriers to advancing this field and recommendations for overcoming these barriers through collaborative efforts.

  19. The AAPS National Biotechnology Conference.

    Science.gov (United States)

    Kenrick, Margaret

    2011-09-01

    Leading off the event, specialized workshops with panels of experts were conducted that brough together students and scientists to the current advances in their specialty. Delivery of therapeutics across the blood-brain barrier for the treatment of neurological conditions such as pain, Alzheimer's and Parkinson's disease is a field of great development with an expanding aging population of patients. Manoj Rajadhyaksha, Pfizer, Inc. and Saileta Prabhu, Genentech, Inc., brought together a panel describing the anatomy of the CNS and improvements in drug delivery. The conference that followed expanded upon the current approaches.

  20. Economic evaluation of carbon adsorption/ion exchange wastewater-treatment options for Sunflower AAP (Army Ammunition Plant) NQ (nitroguanidine) wastewater-treatment facility. Final report, October 1986-July 1987

    Energy Technology Data Exchange (ETDEWEB)

    Balasco, A.A.; Cheng, G.C.; Field, E.L.; Vejins, V.R.

    1987-07-31

    The objective of this subtask was to provide an estimate of the capital investment and operating costs for the wastewater-treatment technology option involving activated-carbon adsorption and ion exchange for primary separation, and multiple-effect evaporation and spray drying for volume reduction. During the course of this study, however, it became evident that the process economics could be significantly improved of the ion-exchange step was eliminated from the process scheme. The bases for the system design, plant operation, and cost evaluation were provided to Arthur D. Little by Sunflower AAP personnel to make certain that direct comparisons could be made with other treatment options under consideration.

  1. The Possibility of Building Nuclear Power Plant Free from Severe Accident Risk PWR NPP with advanced all passive safety cooling systems (AAP SCS)%发展无严重事故风险核电站的曙光具有完全非能动安全冷却系统的压水堆核电站

    Institute of Scientific and Technical Information of China (English)

    肖宏才

    2013-01-01

    A complete set of advanced all passive safety cooling systems (AAP SCS) for PWR NPP,actuated by natural force has been put forward in the article.Here the natural force mainly means the fore,which created by change of pressure distribution in the first loop of PWR as a result of operational regime conversion from one to another,including occurrence of accident situation.Correspondent safety cooling system will be actuated naturally and then put it into passive operation after occurring some kind of accident,so accidental situation will be mitigated right after it's occurrence and core residual heat will be naturally moved from the active core to the ultimate heat sink.There is no need to rely on automatic control system,any active equipment and human actions in all working process of the AAP SCS,which can reduce the probability of severe accident to zero,so as to exclude the need of evacuation plan around AAP nuclear power plant and eliminate the public's concern and doubt about nuclear power safety.Implementation of the AAP SCS concept is only based on use of evolutionary measures and state-of-the-art technology.So at present time it can be used for design of new-type third generation PWR nuclear power plant without severe accident risk,and for modernization of existing second generation nuclear power plant.%本文提出了用自然力直接触发启动压水堆核电站一整套完全非能动的停堆安全冷却系统.这里的自然力主要是指一回路运行工况转换时由于其压力分布变化所形成的压差力.在这一系统中,当进行停堆或发生某种一回路事故工况时,相应的安全冷却系统便自然地投入运行,立即缓解事故后果,将事故时一回路释放的能量及堆芯余热非能动地排入最终热阱.在全过程中不依靠自动控制系统、能动设备及任何人为因素的介入,即可确保对堆芯余热无限期的安全冷却能力,完全避免压水堆核电站发生向环境泄漏放射性物

  2. Bronchiolitis management before and after the AAP guidelines.

    Science.gov (United States)

    Parikh, Kavita; Hall, Matthew; Teach, Stephen J

    2014-01-01

    Evidence-based practice guidelines for bronchiolitis management published by the American Academy of Pediatrics in 2006 recommend supportive care with limited diagnostic testing and treatment. We sought to determine the impact of these guidelines on the treatment of hospitalized children. We analyzed data on inpatients with bronchiolitis aged 1 to 24 months from the Pediatric Health Information System, an administrative billing database, from November 1, 2004 to March 31, 2012. We compared trends in use of diagnostic and treatment resources before and after the publication of the guidelines by using segmented time series. A total of 41 pediatric hospitals contributed data to yield 130,262 patients; 58% were male, and 59% were publicly insured. Median age was 4.0 months (interquartile range, 2-9). Unadjusted analysis showed improvement in utilization rates before and after guidelines for diagnostic tests and for medications; however, there was no decreased use of antibiotics. A segmented regression analysis also demonstrated differences in rates of change before and after guidelines, with significant improvement for chest radiography, steroids, and bronchodilators (P guidelines was associated with significant reductions in the use of diagnostic and therapeutic resources.

  3. Aap, Noot, Mustafa… : Het effect van taalafstand en koloniaal verleden op leesprestaties

    NARCIS (Netherlands)

    Kooistra, Jan-Paul; Ultee, Wout; Pelzer, Ben

    2008-01-01

    Summary A is for apple, B is for Bushra: The influence of language distance and colonial experience on reading This study examines the effect of the distance between origin language and destination language on the reading skills of immigrant students, by building upon insights on the development of

  4. Cultural bias in the AAP's 2012 Technical Report and Policy Statement on male circumcision

    DEFF Research Database (Denmark)

    Frisch, Morten; Aigrain, Yves; Barauskas, Vidmantas

    2013-01-01

    associations and societies for pediatrics, pediatric surgery, and pediatric urology in Northern Europe. To these authors, only 1 of the arguments put forward by the American Academy of Pediatrics has some theoretical relevance in relation to infant male circumcision; namely, the possible protection against......The American Academy of Pediatrics recently released its new Technical Report and Policy Statement on male circumcision, concluding that current evidence indicates that the health benefits of newborn male circumcision outweigh the risks. The technical report is based on the scrutiny of a large...... in a Western context, and they do not represent compelling reasons for surgery before boys are old enough to decide for themselves....

  5. AAPS-FDA workshop white paper : Microdialysis principles, application and regulatory perspectives

    NARCIS (Netherlands)

    Chaurasia, Chandra S.; Mueller, Markus; Bashaw, Edward D.; Benfeldt, Eva; Bolinder, Jan; Bullock, Ross; Bungay, Peter M.; de Lange, Elisabeth C. M.; Derendorf, Hartmut; Elmquist, William F.; Hammarlund-Udenaes, Margareta; Joukhadar, Christian; Kellogg, Dean L.; Lunte, Craig E.; Nordstrom, Carl Henrik; Rollema, Hans; Sawchuk, Ronald J.; Cheung, Belinda W. Y.; Shah, Vinod P.; Stahle, Lars; Ungerstedt, Urban; Welty, Devin F.; Yeo, Helen

    Many decisions in drug development and medical practice are based on measuring blood concentrations of endogenous and exogenous molecules. Yet most biochemical and pharmacological events take place in the tissues. Also, most drugs with few notable exceptions exert their effects not within the

  6. The child neurology clinical workforce in 2015: Report of the AAP/CNS Joint Taskforce.

    Science.gov (United States)

    Kang, Peter B; Bale, James F; Mintz, Mark; Joshi, Sucheta M; Gilbert, Donald L; Radabaugh, Carrie; Ruch-Ross, Holly

    2016-09-27

    More than a decade has passed since the last major workforce survey of child neurologists in the United States; thus, a reassessment of the child neurology workforce is needed, along with an inaugural assessment of a new related field, neurodevelopmental disabilities. The American Academy of Pediatrics and the Child Neurology Society conducted an electronic survey in 2015 of child neurologists and neurodevelopmental disabilities specialists. The majority of respondents participate in maintenance of certification, practice in academic medical centers, and offer subspecialty care. EEG reading and epilepsy care are common subspecialty practice areas, although many child neurologists have not had formal training in this field. In keeping with broader trends, medical school debts are substantially higher than in the past and will often take many years to pay off. Although a broad majority would choose these fields again, there are widespread dissatisfactions with compensation and benefits given the length of training and the complexity of care provided, and frustrations with mounting regulatory and administrative stresses that interfere with clinical practice. Although not unique to child neurology and neurodevelopmental disabilities, such issues may present barriers for the recruitment of trainees into these fields. Creative approaches to enhance the recruitment of the next generation of child neurologists and neurodevelopmental disabilities specialists will benefit society, especially in light of all the exciting new treatments under development for an array of chronic childhood neurologic disorders. © 2016 American Academy of Neurology.

  7. Cultural bias in the AAP's 2012 Technical Report and Policy Statement on male circumcision

    NARCIS (Netherlands)

    Frisch, M.; Aigrain, Y.; Barauskas, V.; Bjarnason, R.; Boddy, S.A.; Czauderna, P.; Gier, R.P.E. de; Jong, T.P. de; Fasching, G.; Fetter, W.; Gahr, M.; Graugaard, C.; Greisen, G.; Gunnarsdottir, A.; Hartmann, W.; Havranek, P.; Hitchcock, R.; Huddart, S.; Janson, S.; Jaszczak, P.; Kupferschmid, C.; Lahdes-Vasama, T.; Lindahl, H.; Macdonald, N.; Markestad, T.; Martson, M.; Nordhov, S.M.; Palve, H.; Petersons, A.; Quinn, F.; Qvist, N.; Rosmundsson, T.; Saxen, H.; Soder, O.; Stehr, M.; Loewenich, V.C. von; Wallander, J.; Wijnen, R.

    2013-01-01

    The American Academy of Pediatrics recently released its new Technical Report and Policy Statement on male circumcision, concluding that current evidence indicates that the health benefits of newborn male circumcision outweigh the risks. The technical report is based on the scrutiny of a large numbe

  8. Review of an Atlas of Pediatric Surgery in the Tropics (AAPS)

    African Journals Online (AJOL)

    Annals of Medical and Health Sciences Research | May-Jun 2014 | Vol 4 | Issue 3 |. 461. Children ... the provision of health care. ... Neurosurgery, Radiology, and Anesthesia. ... images, especially X-rays are of poor quality, perhaps digital.

  9. AAPS-FDA workshop white paper : Microdialysis principles, application and regulatory perspectives

    NARCIS (Netherlands)

    Chaurasia, Chandra S.; Mueller, Markus; Bashaw, Edward D.; Benfeldt, Eva; Bolinder, Jan; Bullock, Ross; Bungay, Peter M.; DeLange, Elizabeth C. M.; Derendorf, Hartmut; Elmquist, William F.; Hammarlund-Udenaes, Margareta; Joukhadar, Christian; Kellogg, Dean L.; Lunte, Craig E.; Nordstrom, Carl Henrik; Rollema, Hans; Sawchuk, Ronald J.; Cheung, Belinda W. Y.; Shah, Vinod P.; Stahle, Lars; Ungerstedt, Urban; Welty, Devin F.; Yeo, Helen

    2007-01-01

    Many decisions in drug development and medical practice are based on measuring blood concentrations of endogenous and exogenous molecules. Yet most biochemical and pharmacological events take place in the tissues. Also, most drugs with few notable exceptions exert their effects not within the bloods

  10. AAPS and US FDA Crystal City VI workshop on bioanalytical method validation for biomarkers.

    Science.gov (United States)

    Lowes, Steve; Ackermann, Bradley L

    2016-02-01

    Crystal City VI Workshop on Bioanalytical Method Validation of Biomarkers, Renaissance Baltimore Harborplace Hotel, Baltimore, MD, USA, 28-29 September 2015 The Crystal City VI workshop was organized by the American Association of Pharmaceutical Scientists in association with the US FDA to continue discussion on the bioanalysis of biomarkers. An outcome of the Crystal City V workshop, convened following release of the draft FDA Guidance for Industry on Bioanalytical Methods Validation in 2013 was the need to have further discussion on biomarker methods. Biomarkers ultimately became the sole focal point for Crystal City VI, a meeting attended by approximately 200 people and composed of industry scientists and regulators from around the world. The meeting format included several panel discussions to maximize the opportunity for dialogue among participants. Following an initial session on the general topic of biomarker assays and intended use, more focused sessions were held on chromatographic (LC-MS) and ligand-binding assays. In addition to participation by the drug development community, significant representation was present from clinical testing laboratories. The experience of this latter group, collectively identified as practitioners of CLIA (Clinical Laboratory Improvement Amendments), helped shape the discussion and takeaways from the meeting. While the need to operate within the framework of the current BMV guidance was clearly acknowledged, a general understanding that biomarker methods validation cannot be adequately depicted by current PK-centric guidelines emerged as a consensus from the meeting. This report is not intended to constitute the official proceedings from Crystal City VI, which is expected to be published in early 2016.

  11. Aap, Noot, Mustafa...: Het effect van taalafstand en koloniaal verleden op leesprestaties

    NARCIS (Netherlands)

    Kooistra, J.P.; Ultee, W.C.; Pelzer, B.J.

    2008-01-01

    This study examines the effect of the distance between origin language and destination language on the reading skills of immigrant students, by building upon insights on the development of world languages, obtained from human population genetics. Lower-level research units are 1759 first-generation

  12. Aap, Noot, Mustafa… : Het effect van taalafstand en koloniaal verleden op leesprestaties

    NARCIS (Netherlands)

    Kooistra, Jan-Paul; Ultee, Wout; Pelzer, Ben

    2008-01-01

    Summary A is for apple, B is for Bushra: The influence of language distance and colonial experience on reading This study examines the effect of the distance between origin language and destination language on the reading skills of immigrant students, by building upon insights on the development of

  13. Out of step: fatal flaws in the latest AAP policy report on neonatal circumcision.

    Science.gov (United States)

    Svoboda, J Steven; Van Howe, Robert S

    2013-07-01

    The American Academy of Pediatrics recently released a policy statement and technical report on circumcision, in both of which the organisation suggests that the health benefits conferred by the surgical removal of the foreskin in infancy definitively outweigh the risks and complications associated with the procedure. While these new documents do not positively recommend neonatal circumcision, they do paradoxically conclude that its purported benefits 'justify access to this procedure for families who choose it,' claiming that whenever and for whatever reason it is performed, it should be covered by government health insurance. The policy statement and technical report suffer from several troubling deficiencies, ultimately undermining their credibility. These deficiencies include the exclusion of important topics and discussions, an incomplete and apparently partisan excursion through the medical literature, improper analysis of the available information, poorly documented and often inaccurate presentation of relevant findings, and conclusions that are not supported by the evidence given.

  14. NACO-SDI imaging of known companion host stars from the AAPS and Keck planet search surveys

    CERN Document Server

    Jenkins, J S; Biller, B; O'Toole, S J; Pinfield, D J; Close, L; Tinney, C G; Butler, R P; Wittenmyer, R; Carter, B; Day-Jones, A C

    2010-01-01

    Direct imaging of brown dwarfs as companions to solar-type stars can provide a wealth of well-constrained data to "benchmark" the physics of such objects, since quantities like metallicity and age can be determined from their well-studied primaries. We present results from an adaptive optics imaging program on stars drawn from the Anglo-Australian and Keck Planet Search projects, with the aim of directly imaging known cool companions. Simulations have modeled the expected contrast ratios and separations of known companions using estimates of orbital parameters available from current radial-velocity data and then a selection of the best case objects were followed-up with high contrast imaging to attempt to directly image these companions. These simulations suggest that only a very small number of radial-velocity detected exoplanets with consistent velocity fits and age estimates could potentially be directly imaged using the VLT's Simultaneous Differential Imaging system and only under favorable conditions. We...

  15. Onderzoek naar de mogelijke inductie van leuco-myelo-encephalopathie door inhalatoire blootstelling van een aap aan pyrolisaat van versneden heroine

    NARCIS (Netherlands)

    van der Laan JW; Timmerman A; Marra M; Wolters EC; Loeber JG; Dormans JAMA; Schipper MEI; Boot R

    1986-01-01

    Nadat vanaf 1980 enige tientallen personen het slachtoffer zijn geworden van een heroine-leuko-encephalopathie als gevolg van het "chinezen" van vnl. heroine zijn gedurende twee jaar geen slachtoffers gemeld. Twee slachtoffers in 1984, die bovendien een grote hoeveelheid heroine in het b

  16. Periodontitis and systemic diseases : a record of discussions of working group 4 of the Joint EFP/AAP Workshop on Periodontitis and Systemic Diseases

    NARCIS (Netherlands)

    Linden, Gerry J; Herzberg, Mark C; van Winkelhoff, Arie

    2013-01-01

    BACKGROUND: There has been an explosion in research into possible associations between periodontitis and various systemic diseases and conditions. AIM: To review the evidence for associations between periodontitis and various systemic diseases and conditions, including chronic obstructive pulmonary

  17. Periodontitis and systemic diseases : a record of discussions of working group 4 of the Joint EFP/AAP Workshop on Periodontitis and Systemic Diseases

    NARCIS (Netherlands)

    Linden, Gerry J; Herzberg, Mark C; van Winkelhoff, Arie

    2013-01-01

    BACKGROUND: There has been an explosion in research into possible associations between periodontitis and various systemic diseases and conditions. AIM: To review the evidence for associations between periodontitis and various systemic diseases and conditions, including chronic obstructive pulmonary

  18. Periodontitis and systemic diseases : a record of discussions of working group 4 of the Joint EFP/AAP Workshop on Periodontitis and Systemic Diseases

    NARCIS (Netherlands)

    Linden, Gerry J; Herzberg, Mark C; van Winkelhoff, Arie

    BACKGROUND: There has been an explosion in research into possible associations between periodontitis and various systemic diseases and conditions. AIM: To review the evidence for associations between periodontitis and various systemic diseases and conditions, including chronic obstructive pulmonary

  19. Protecting Children from Carbon Monoxide Poisoning

    Science.gov (United States)

    ... AAP Advertise with AAP Advertising on AAP.org Advertising on AAP Journals & Publications AAP Mailing and eMail List Corporate Relationships Conflict of Interest and Industry Relations Sponsorships Corporate Friends of Children Fund Corporate Relationship Guidelines Help/Feedback It looks ...

  20. Sports Injury Prevention Tip Sheet

    Science.gov (United States)

    ... Commemorative Giving Employment at AAP Advertise with AAP Advertising on AAP.org Advertising on AAP Journals & Publications AAP Mailing and eMail ... Help/Feedback a a a print email share Facebook Twitter 2017 Sports Injury Prevention Tip Sheet 3/ ...

  1. Iron Supplements Reduce Behavior Problems in Low Birth Weight Infants

    Science.gov (United States)

    ... Commemorative Giving Employment at AAP Advertise with AAP Advertising on AAP.org Advertising on AAP Journals & Publications AAP Mailing and eMail ... Help/Feedback a a a print email share Facebook Twitter Iron Supplements Reduce Behavior Problems in Low ...

  2. Purification and characterization of novel cationic peroxidases from Asparagus acutifolius L. with biotechnological applications.

    Science.gov (United States)

    Guida, Vincenzo; Cantarella, Maria; Chambery, Angela; Mezzacapo, Maria C; Parente, Augusto; Landi, Nicola; Severino, Valeria; Di Maro, Antimo

    2014-08-01

    Four novel basic peroxidases, named AaP-1, AaP-2, AaP-3, and AaP-4, were purified from Asparagus acutifolius L. seeds by cation-exchange and gel filtration chromatographies. The four proteins showed a similar electrophoretic mobility of 46 kDa while, by MALDI-TOF MS, different Mr values of 42758.3, 41586.9, 42796.3, and 41595.5 were determined for AaP-1, AaP-2, AaP-3, and AaP-4, respectively. N-terminal sequences of AaPs 1-4 up to residue 20 showed a high percentage of identity with the peroxidase from Glycine max. In addition, AaP-1, AaP-2, AaP-3, and AaP-4 were found to be glycoproteins, containing 21.75, 22.27, 25.62, and 18.31 % of carbohydrates, respectively. Peptide mapping and MALDI-TOF MS analysis of AaPs 1-4 showed that the structural differences between AaP-1 and AaP-2 and AaP-3 and AaPs-4 were mainly due to their glycan content. We also demonstrate that AaPs were able to remove phenolic compounds from olive oil mill wastewaters with a higher catalytic efficiency with respect to horseradish peroxidase, thus representing candidate enzymes for potential biotechnological applications in the environmental field.

  3. Gum Disease and Men

    Science.gov (United States)

    ... Recordings AAP Speakers List 2017 Annual Meeting Publications Journal of Periodontology JOP Online How to Subscribe Missing-Issue Claim Form Back-Issue Order Form JOP Editors Submit Manuscript Clinical Advances in Perio CAP Editors AAP Clinical and ...

  4. Gum Graft Surgery

    Science.gov (United States)

    ... Recordings AAP Speakers List 2017 Annual Meeting Publications Journal of Periodontology JOP Online How to Subscribe Missing-Issue Claim Form Back-Issue Order Form JOP Editors Submit Manuscript Clinical Advances in Perio CAP Editors AAP Clinical and ...

  5. Gum Disease Symptoms

    Science.gov (United States)

    ... Recordings AAP Speakers List 2017 Annual Meeting Publications Journal of Periodontology JOP Online How to Subscribe Missing-Issue Claim Form Back-Issue Order Form JOP Editors Submit Manuscript Clinical Advances in Perio CAP Editors AAP Clinical and ...

  6. Peri-Implant Diseases

    Science.gov (United States)

    ... Recordings AAP Speakers List 2017 Annual Meeting Publications Journal of Periodontology JOP Online How to Subscribe Missing-Issue Claim Form Back-Issue Order Form JOP Editors Submit Manuscript Clinical Advances in Perio CAP Editors AAP Clinical and ...

  7. Gum Disease and Women

    Science.gov (United States)

    ... Recordings AAP Speakers List 2017 Annual Meeting Publications Journal of Periodontology JOP Online How to Subscribe Missing-Issue Claim Form Back-Issue Order Form JOP Editors Submit Manuscript Clinical Advances in Perio CAP Editors AAP Clinical and ...

  8. Gum Disease in Children

    Science.gov (United States)

    ... Recordings AAP Speakers List 2017 Annual Meeting Publications Journal of Periodontology JOP Online How to Subscribe Missing-Issue Claim Form Back-Issue Order Form JOP Editors Submit Manuscript Clinical Advances in Perio CAP Editors AAP Clinical and ...

  9. American Academy of Pediatrics

    Science.gov (United States)

    ... and the diseases they prevent. Media and Children Communication Toolkit Tools to help pediatricians discuss with parents ... Donate Now Employment at AAP Advertise with AAP Corporate Relationships Help/Feedback Privacy Statement Contact Us Terms ...

  10. NCBI nr-aa BLAST: CBRC-CFAM-25-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-25-0003 gb|AAP74617.1|AF484337_1 NADH dehydrogenase subunit 4 [Venerupis (Ruditapes) philip...pinarum] gb|AAP74624.1|AF484338_1 NADH dehydrogenase subunit 4 [Venerupis (Ruditapes) philip...pinarum] gb|AAP74638.1|AF484340_1 NADH dehydrogenase subunit 4 [Venerupis (Ruditapes) philippinarum] AAP74617.1 5.1 30% ...

  11. NCBI nr-aa BLAST: CBRC-PCAP-01-0207 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0207 gb|AAP74585.1|AF484332_8 NADH dehydrogenase subunit 5 [Venerupis philip...pinarum] gb|AAP74592.1|AF484333_13 NADH dehydrogenase subunit 5 [Venerupis philippinarum] gb|AAP74613....1|AF484336_18 NADH dehydrogenase subunit 5 [Venerupis philippinarum] AAP74585.1 0.72 29% ...

  12. 78 FR 6113 - Office of Clinical and Preventive Services Indigenous Child Health-Strong Communities, Healthy...

    Science.gov (United States)

    2013-01-29

    ... registration and logistics for meeting. The AAP will subcontract with an organization to assist with these... registration takes approximately one hour to complete ] and SAM registration will take 3-5 business days to... planning will be managed and the specific role of AAP. Describe the AAP's program objectives as they...

  13. Area Array Technology Evaluations for Space and Military Applications

    Science.gov (United States)

    Ghaffarian, Reza

    1996-01-01

    The Jet Propulsion Laboratory (JPL) is currently assessing the use of Area Array Packaging (AAP) for National Aeronautics and Space Administration (NASA) spaceflight applications. this work is being funded through NASA Headquarters, Code Q. The paper discusses background of AAP, objectives, and uses of AAP.

  14. NCBI nr-aa BLAST: CBRC-AGAM-02-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0015 gb|AAP56247.1| deltamethrin resistance-associated NYD-OP1 [Culex pipi...ens pallens] gb|AAP56248.1| deltamethrin resistance-associated NYD-OP2 [Culex pipiens pallens] AAP56247.1 0.0 86% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-02-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0007 gb|AAP56249.1| deltamethrin resistance-associated NYD-OP3 [Culex pipi...ens pallens] gb|AAP56250.1| deltamethrin resistance-associated NYD-OP4 [Culex pipiens pallens] AAP56249.1 0.0 86% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-02-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0008 gb|AAP56249.1| deltamethrin resistance-associated NYD-OP3 [Culex pipi...ens pallens] gb|AAP56250.1| deltamethrin resistance-associated NYD-OP4 [Culex pipiens pallens] AAP56249.1 0.0 86% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-02-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0015 gb|AAP56249.1| deltamethrin resistance-associated NYD-OP3 [Culex pipi...ens pallens] gb|AAP56250.1| deltamethrin resistance-associated NYD-OP4 [Culex pipiens pallens] AAP56249.1 0.0 86% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-02-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0008 gb|AAP56247.1| deltamethrin resistance-associated NYD-OP1 [Culex pipi...ens pallens] gb|AAP56248.1| deltamethrin resistance-associated NYD-OP2 [Culex pipiens pallens] AAP56247.1 0.0 86% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-02-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0005 gb|AAP56249.1| deltamethrin resistance-associated NYD-OP3 [Culex pipi...ens pallens] gb|AAP56250.1| deltamethrin resistance-associated NYD-OP4 [Culex pipiens pallens] AAP56249.1 1e-178 81% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-02-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0007 gb|AAP56247.1| deltamethrin resistance-associated NYD-OP1 [Culex pipi...ens pallens] gb|AAP56248.1| deltamethrin resistance-associated NYD-OP2 [Culex pipiens pallens] AAP56247.1 0.0 86% ...

  1. NCBI nr-aa BLAST: CBRC-ATHA-05-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-05-0006 gb|AAP45159.1| Plant viral-response family protein [Solanum bulboca...stanum] gb|AAP45189.1| Plant viral-response family protein [Solanum bulbocastanum] AAP45159.1 4e-13 23% ...

  2. Characterization of aspartyl aminopeptidase from Toxoplasma gondii

    Science.gov (United States)

    Zheng, Jun; Cheng, Ziying; Jia, Honglin; Zheng, Yonghui

    2016-01-01

    Aminopeptidases have emerged as new promising drug targets for the development of novel anti-parasitic drugs. An aspartyl aminopeptidase-like gene has been identified in the Toxoplasma gondii genome (TgAAP), although its function remains unknown. In this study, we characterized TgAAP and performed functional analysis of the gene product. Firstly, we expressed a functional recombinant TgAAP (rTgAAP) protein in Escherichia coli, and found that it required metal ions for activity and showed a substrate preference for N-terminal acidic amino acids Glu and Asp. Then, we evaluated the function and drug target potential of TgAAP using the CRISPR/Cas9 knockout system. Western blotting demonstrated the deletion of TgAAP in the knockout strain. Indirect immunofluorescence analysis showed that TgAAP was localized in the cytoplasm of the wild-type parasite, but was not expressed in the knockout strain. Phenotype analysis revealed that TgAAP knockout inhibited the attachment/invasion, replication, and substrate-specific activity in T. gondii. Finally, the activity of drug CID 23724194, previously described as targeting Plasmodium and malarial parasite AAP, was tested against rTgAAP and the parasite. Overall, TgAAP knockout affected the growth of T. gondii but did not completely abolish parasite replication and growth. Therefore, TgAAP may comprise a useful adjunct drug target of T. gondii. PMID:27678060

  3. Structure and function of the adhesive type IV pilus of Sulfolobus acidocaldarius.

    Science.gov (United States)

    Henche, Anna-Lena; Ghosh, Abhrajyoti; Yu, Xiong; Jeske, Torsten; Egelman, Edward; Albers, Sonja-Verena

    2012-12-01

    Archaea display a variety of type IV pili on their surface and employ them in different physiological functions. In the crenarchaeon Sulfolobus acidocaldarius the most abundant surface structure is the aap pilus (archaeal adhesive pilus). The construction of in frame deletions of the aap genes revealed that all the five genes (aapA, aapX, aapE, aapF, aapB) are indispensible for assembly of the pilus and an impact on surface motility and biofilm formation was observed. Our analyses revealed that there exists a regulatory cross-talk between the expression of aap genes and archaella (formerly archaeal flagella) genes during different growth phases. The structure of the aap pilus is entirely different from the known bacterial type IV pili as well as other archaeal type IV pili. An aap pilus displayed 3 stranded helices where there is a rotation per subunit of ∼138° and a rise per subunit of ∼5.7 Å. The filaments have a diameter of ∼110 Å and the resolution was judged to be ∼9 Å. We concluded that small changes in sequence might be amplified by large changes in higher-order packing. Our finding of an extraordinary stability of aap pili possibly represents an adaptation to harsh environments that S. acidocaldarius encounters.

  4. CAM Highlights (FY 82)

    Science.gov (United States)

    1982-11-01

    5507 Nathaniel Scott 880-6430 (201)328-6430 Nathaniel Scott 880-6430 (201)328-6430 Loyd Woodham 746-4948 (205)876-4948 Frank Estock 795-7099 (717...Crane AAA, Attn: SARCN-QAM6, Mr Cdr, Hawthorne AAP, Attn: SARHW-CO Cdr, Holston AAP, Attn: SARHO-CO Cdr, Indiana AAP, Attn: SARIN-CO Cdr

  5. Manufacturing Methods and Technology Project Summary Reports

    Science.gov (United States)

    1982-12-01

    MORE INFORMATION 1 Additional information can be obtained from the project officer, Mr. Nathaniel Scott, ARRADCOM, AV 880-6945 or Commercial (201...QAM6, Mr. S. R. Caswell Cdr, Hawthorne AAP, Attn: SARHW-CO Cdr, Holston AAP, Attn: SARHO-CO Cdr, Indiana AAP, Attn: SARIN-CO AII-3 DRXIB-MT

  6. NCBI nr-aa BLAST: CBRC-OCUN-01-0785 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0785 gb|AAP41476.1| immediate early protein ICP0 [Cercopithecine herpe...svirus 1] gb|AAP41493.1| immediate early protein ICP0 [Cercopithecine herpesvirus 1] AAP41476.1 0.029 31% ...

  7. NCBI nr-aa BLAST: CBRC-OANA-01-1968 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1968 gb|AAP13045.1| NADH dehydrogenase subunit 2 [Pseudochaenichthys georgia...nus] gb|AAP13046.1| NADH dehydrogenase subunit 2 [Pseudochaenichthys georgianus] AAP13045.1 0.17 23% ...

  8. Microdose study of 14C-acetaminophen with accelerator mass spectrometry to examine pharmacokinetics of parent drug and metabolites in healthy subjects.

    Science.gov (United States)

    Tozuka, Z; Kusuhara, H; Nozawa, K; Hamabe, Y; Ikushima, I; Ikeda, T; Sugiyama, Y

    2010-12-01

    A study of the pharmacokinetics of (14)C-labeled acetaminophen (AAP) was performed in healthy Japanese subjects receiving an oral microdose of the drug. After separation by high-performance liquid chromatography (HPLC), the levels of AAP and its metabolites in the pooled plasma specimens were quantified using accelerator mass spectrometry (AMS). The total body clearance (CL(tot))/bioavailability (F) of AAP was within the variation in the reported values at therapeutic doses, indicating the linearity of AAP pharmacokinetics. AAP-glucuronide (Glu) and AAP-4-O-sulfate satisfied the criteria of safety testing of drug metabolites. AMS could detect AAP-Cys, the active metabolite of AAP conjugated with cysteine, in the urine. Probenecid prolonged the systemic elimination of total radioactivity and caused a marked decrease in AAP-Glu levels in plasma. Probenecid likely inhibited the glucuronidation of AAP and the renal elimination of AAP-4-O-sulfate. Microdosing of (14)C-labeled drug followed by AMS is a powerful tool that can be used in the early phase of drug development for pharmacokinetic analysis of drugs and their metabolites and for detecting the formation of active metabolites in humans.

  9. Book Trade Research and Statistics. Prices of U.S. and Foreign Published Materials; Book Title Output and Average Prices: 2001 Final and 2002 Preliminary Figures; Book Sales Statistics, 2002: AAP Preliminary Estimates; U.S. Book Exports and Imports:2002; Number of Book Outlets in the United States and Canada; Review Media Statistics.

    Science.gov (United States)

    Sullivan, Sharon G.; Grabois, Andrew; Greco, Albert N.

    2003-01-01

    Includes six reports related to book trade statistics, including prices of U.S. and foreign materials; book title output and average prices; book sales statistics; book exports and imports; book outlets in the U.S. and Canada; and numbers of books and other media reviewed by major reviewing publications. (LRW)

  10. Korean Medication Algorithm Project for Bipolar Disorder: third revision

    Science.gov (United States)

    Woo, Young Sup; Lee, Jung Goo; Jeong, Jong-Hyun; Kim, Moon-Doo; Sohn, Inki; Shim, Se-Hoon; Jon, Duk-In; Seo, Jeong Seok; Shin, Young-Chul; Min, Kyung Joon; Yoon, Bo-Hyun; Bahk, Won-Myong

    2015-01-01

    Objective To constitute the third revision of the guidelines for the treatment of bipolar disorder issued by the Korean Medication Algorithm Project for Bipolar Disorder (KMAP-BP 2014). Methods A 56-item questionnaire was used to obtain the consensus of experts regarding pharmacological treatment strategies for the various phases of bipolar disorder and for special populations. The review committee included 110 Korean psychiatrists and 38 experts for child and adolescent psychiatry. Of the committee members, 64 general psychiatrists and 23 child and adolescent psychiatrists responded to the survey. Results The treatment of choice (TOC) for euphoric, mixed, and psychotic mania was the combination of a mood stabilizer (MS) and an atypical antipsychotic (AAP); the TOC for acute mild depression was monotherapy with MS or AAP; and the TOC for moderate or severe depression was MS plus AAP/antidepressant. The first-line maintenance treatment following mania or depression was MS monotherapy or MS plus AAP; the first-line treatment after mania was AAP monotherapy; and the first-line treatment after depression was lamotrigine (LTG) monotherapy, LTG plus MS/AAP, or MS plus AAP plus LTG. The first-line treatment strategy for mania in children and adolescents was MS plus AAP or AAP monotherapy. For geriatric bipolar patients, the TOC for mania was AAP/MS monotherapy, and the TOC for depression was AAP plus MS or AAP monotherapy. Conclusion The expert consensus in the KMAP-BP 2014 differed from that in previous publications; most notably, the preference for AAP was increased in the treatment of acute mania, depression, and maintenance treatment. There was increased expert preference for the use of AAP and LTG. The major limitation of the present study is that it was based on the consensus of Korean experts rather than on experimental evidence. PMID:25750530

  11. Korean Medication Algorithm Project for Bipolar Disorder: third revision.

    Science.gov (United States)

    Woo, Young Sup; Lee, Jung Goo; Jeong, Jong-Hyun; Kim, Moon-Doo; Sohn, Inki; Shim, Se-Hoon; Jon, Duk-In; Seo, Jeong Seok; Shin, Young-Chul; Min, Kyung Joon; Yoon, Bo-Hyun; Bahk, Won-Myong

    2015-01-01

    To constitute the third revision of the guidelines for the treatment of bipolar disorder issued by the Korean Medication Algorithm Project for Bipolar Disorder (KMAP-BP 2014). A 56-item questionnaire was used to obtain the consensus of experts regarding pharmacological treatment strategies for the various phases of bipolar disorder and for special populations. The review committee included 110 Korean psychiatrists and 38 experts for child and adolescent psychiatry. Of the committee members, 64 general psychiatrists and 23 child and adolescent psychiatrists responded to the survey. The treatment of choice (TOC) for euphoric, mixed, and psychotic mania was the combination of a mood stabilizer (MS) and an atypical antipsychotic (AAP); the TOC for acute mild depression was monotherapy with MS or AAP; and the TOC for moderate or severe depression was MS plus AAP/antidepressant. The first-line maintenance treatment following mania or depression was MS monotherapy or MS plus AAP; the first-line treatment after mania was AAP monotherapy; and the first-line treatment after depression was lamotrigine (LTG) monotherapy, LTG plus MS/AAP, or MS plus AAP plus LTG. The first-line treatment strategy for mania in children and adolescents was MS plus AAP or AAP monotherapy. For geriatric bipolar patients, the TOC for mania was AAP/MS monotherapy, and the TOC for depression was AAP plus MS or AAP monotherapy. The expert consensus in the KMAP-BP 2014 differed from that in previous publications; most notably, the preference for AAP was increased in the treatment of acute mania, depression, and maintenance treatment. There was increased expert preference for the use of AAP and LTG. The major limitation of the present study is that it was based on the consensus of Korean experts rather than on experimental evidence.

  12. Transcriptional regulation of cytosol and membrane alanyl-aminopeptidase in human T cell subsets.

    Science.gov (United States)

    Bukowska, Alicja; Tadje, Janine; Arndt, Marco; Wolke, Carmen; Kähne, Thilo; Bartsch, Jaqueline; Faust, Jürgen; Neubert, Klaus; Hashimoto, Yuichi; Lendeckel, Uwe

    2003-04-01

    Aminopeptidase inhibitors strongly affect the proliferation and function of immune cells in man and animals and are promising agents for the pharmacological treatment of inflammatory or autoimmune diseases. Membrane alanyl-aminopeptidase (mAAP) has been considered as the major target of these anti-inflammatory aminopeptidase inhibitors. Recent evidence also points to a role of the cytosol alanyl-aminopeptidase (cAAP) in the immune response. In this study we used quantitative RT-PCR to determine the mRNA expression of both cAAP and mAAP in resting and activated peripheral T cells and also in CD4+, CD8+, Th1, Th2 and Treg (CD4+ CD25+) subpopulations. Both mAAP and cAAP mRNAs were expressed in all cell types investigated, and in response to activation their expression appeared to be upregulated in CD8+ cells, but downregulated in Treg cells. In CD4+ cells, mAAP and cAAP mRNAs were affected in opposite ways in response to activation. The cAAP-specific inhibitor, PAQ-22, did not affect either cAAP or mAAP expression in activated CD4+ or CD8+ cells, whereas in activated Treg cells it markedly upregulated the mRNA levels of both aminopeptidases. The non-discriminatory inhibitor, phebestin, significantly increased the amount of mAAP and cAAP mRNA in CD4+ and that of cAAP in Treg cells.

  13. [Thoughts and strategies of developing an international standard of nomenclature and location of auricular acupuncture points].

    Science.gov (United States)

    Wang, Lei; Zhou, Li-Qun; Zhao, Bai-Xiao

    2011-02-01

    The new development on the international standard of nomenclature and location of auricular acupoints (AAP) was stated in this paper. The similarities and differences of the auricular acupuncture system in various countries were compared in this paper in order to provide suggestions and strategies for international standard of no menclature and location of AAP. In this paper, the international standard of AAP as a common language for international academic exchanges, the guidance for beginners and a basis for further research was mentioned. There were similarities and differences in the nomenclature and location of AAP in China and abroad. It was worthwhile to clarify the similarities and differences in order to promote the process of international standard of AAP. The five basic principles for the international standard of AAP are the basic research of auricular anatomy, the total auricular acupuncture points, principles for nomenclature, the practicality and the accuracy.

  14. Differences between African Americans and Whites in reactions to affirmative action programs in hiring, promotion, training, and layoffs.

    Science.gov (United States)

    Levi, Ariel S; Fried, Yitzhak

    2008-09-01

    This study examines the reactions of African Americans and Whites to affirmative action programs (AAPs) applied to 4 human resource activities: hiring, promotion, training, and layoffs. The results of a scenario-based experimental study conducted on a large sample (N > 800) of advanced undergraduate and MBA business school participants generally supported the hypothesis that human resource activity elicited systematic differences in reaction to AAPs between African Americans and Whites. The authors also replicated previous research on the effect of AAP strength and prior discrimination by the organization on reactions to AAPs. Results indicated that AAP strength levels moderated racial differences in reaction to AAPs, while the moderating role of prior discrimination by the organization was not supported. Implications for future research are discussed.

  15. Reactions to two versions of affirmative action among whites, blacks, and Hispanics.

    Science.gov (United States)

    Kravitz, D A; Klineberg, S L

    2000-08-01

    Houston-area Whites (n = 414), Blacks (n = 392), American-born Hispanics (n = 162), and Hispanic immigrants (n = 177) evaluated a self-defined "typical" affirmative action plan (AAP) and a tiebreak AAP that applies under conditions of equal qualifications and underrepresentation. Whites preferred Tiebreak; Blacks and Hispanics preferred the typical AAP. The groups differed in beliefs about the procedures and fairness of affirmative action (AA), perceptions of workplace discrimination, and political orientations. Perceived fairness predicted support for both AAPs in all American-born groups, but the impact of other predictors varied greatly across AAPs and ethnic groups. The results clarify the bases for Whites' opposition to AA as they construe it. The results also underscore the importance of specifying the AAP procedures, of uncovering the predictors of AA attitudes among target-group members, and of conducting separate analyses in each ethnic community.

  16. Preparation and pharmaceutical evaluation of acetaminophen nano-fiber tablets: Application of a solvent-based electrospinning method for tableting.

    Science.gov (United States)

    Hamori, Mami; Nagano, Kana; Kakimoto, Sayaka; Naruhashi, Kazumasa; Kiriyama, Akiko; Nishimura, Asako; Shibata, Nobuhito

    2016-03-01

    In this study, we developed nano-fiber-based tablets with acetaminophen (AAP; LogPow=0.51) for controlled-release delivery systems and evaluated in vitro drug dissolution and in vivo pharmacokinetics in rats. Nano-fibers made from methacrylic acid copolymer S (MAC; EUDRAGIT S100) and containing AAP were prepared using a solvent-based electrospinning (ES) method. In vitro dissolution rate profiles of AAP showed tableting pressure-dependent decreases and pH-dependent increases. The results of tablet tracking by X-ray irradiation showed tablets based on MAC nano-fibers did not disintegrate in the upper intestinal lumen and had the properties of a long-term-acting tablet. In addition, the in vitro release profiles of AAP from nano-fiber tablets prepared by dissolving MAC with AAP (NFT), nano-fiber tablets prepared by adsorbing AAP to drug-free MAC nano-fibers (NFTadso), and tablets prepared by adsorbing half the amount of AAP to MAC nano-fibers containing the remaining amount of AAP (NFThalf) showed independent controlled-release aspects of AAP compared with physical mixture tablets (PMT). In vivo pharmacokinetic studies in rats after intraduodenal administration of 14 mg/rat AAP in NFT, NFTadso, and NFThalf demonstrated that all these tablets based on MAC nano-fibers showed sustained-release profiles compared with PMT, and showed ultra-sustained release properties for AAP. These new tablets based on MAC nano-fibers did not disintegrate in the intestine in the lower pH region, and the tablets could regulate the release of AAP in a pH-dependent manner. The ES method is a useful technique to prepare nano-fibers and showed promising results as an oral delivery system for sustained-release regulation. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  17. Acetaminophen induces apoptosis in rat cortical neurons.

    Directory of Open Access Journals (Sweden)

    Inmaculada Posadas

    Full Text Available BACKGROUND: Acetaminophen (AAP is widely prescribed for treatment of mild pain and fever in western countries. It is generally considered a safe drug and the most frequently reported adverse effect associated with acetaminophen is hepatotoxicity, which generally occurs after acute overdose. During AAP overdose, encephalopathy might develop and contribute to morbidity and mortality. Our hypothesis is that AAP causes direct neuronal toxicity contributing to the general AAP toxicity syndrome. METHODOLOGY/PRINCIPAL FINDINGS: We report that AAP causes direct toxicity on rat cortical neurons both in vitro and in vivo as measured by LDH release. We have found that AAP causes concentration-dependent neuronal death in vitro at concentrations (1 and 2 mM that are reached in human plasma during AAP overdose, and that are also reached in the cerebrospinal fluid of rats for 3 hours following i.p injection of AAP doses (250 and 500 mg/kg that are below those required to induce acute hepatic failure in rats. AAP also increases both neuronal cytochrome P450 isoform CYP2E1 enzymatic activity and protein levels as determined by Western blot, leading to neuronal death through mitochondrial-mediated mechanisms that involve cytochrome c release and caspase 3 activation. In addition, in vivo experiments show that i.p. AAP (250 and 500 mg/kg injection induces neuronal death in the rat cortex as measured by TUNEL, validating the in vitro data. CONCLUSIONS/SIGNIFICANCE: The data presented here establish, for the first time, a direct neurotoxic action by AAP both in vivo and in vitro in rats at doses below those required to produce hepatotoxicity and suggest that this neurotoxicity might be involved in the general toxic syndrome observed during patient APP overdose and, possibly, also when AAP doses in the upper dosing schedule are used, especially if other risk factors (moderate drinking, fasting, nutritional impairment are present.

  18. Auricularia auricular polysaccharide-low molecular weight chitosan polyelectrolyte complex nanoparticles: Preparation and characterization

    Directory of Open Access Journals (Sweden)

    Wei Xiong

    2016-06-01

    Full Text Available Novel polyelectrolyte complex nanoparticles (AAP/LCS NPs were prepared in this study and these were produced by mixing negatively charged auricularia auricular polysaccharide (AAP with positively charged low molecular weight chitosan (LCS in an aqueous medium. The AAP was extracted and purified from auricularia auricular, and then characterized by micrOTOF-Q mass spectrometry, UV/Vis spectrophotometry, moisture analyzer and SEM. The yield, moisture, and total sugar content of the AAP were 4.5%, 6.2% and 90.12% (w/w, respectively. The AAP sample was water-soluble and exhibited white flocculence. The characteristics of AAP/LCS NPs, such as the particle size, zeta potential, morphology, FT-IR spectra, DSC were investigated. The results obtained revealed that the AAP/LCS NPs had a spherical shape with a diameter of 223 nm and a smooth surface, and the results of the FT-IR spectra and DSC investigations indicated that there was an electrostatic interaction between the two polyelectrolyte polymers. Bovine serum albumin (BSA, pI = 4.8 and bovine hemoglobin (BHb, pI = 6.8 were used as model drugs to investigate the loading and release features of the AAP/LCS NPs. The results obtained showed that the AAP/LCS NPs had a higher entrapment efficiency (92.6% for BHb than for BSA (81.5%. The cumulative release of BSA and BHb from AAP/LCS NPs after 24 h in vitro was 95.4% and 91.9%, respectively. The in vitro release demonstrated that AAP/LCS NPs provided a sustained release matrix suitable for the delivery of protein drugs. These studies demonstrate that AAP/LCS NPs have a very promising potential as a delivery system for protein drugs.

  19. Aerobic Anoxygenic Phototrophic Bacteria in the Mid-Atlantic Bight and the North Pacific Gyre. Revised

    Science.gov (United States)

    Cottrell, Matthew T.; Mannino, Antonio; Kirchman, David L.

    2005-01-01

    The abundance of aerobic anoxygenic phototrophic (AM) bacteria, cyanobacteria and heterotrophs was examined in the Mid-Atlantic Bight and the central North Pacific gyre using infrared fluorescence microscopy coupled with image analysis and flow cytometry. AAP bacteria comprised 5% to 16% of total prokaryotes in the Atlantic but only 5% or less in the Pacific. In the Atlantic, AAP bacterial abundance was as much as 2-fold higher than Prochlorococcus and 10-folder higher than Synechococcus. In contrast, Prochlorococcus outnumbered AAP bacteria 5- to 50-fold in the Pacific. In both oceans, subsurface abundance maxima occurred within the photic zone, and AAP bacteria were least abundant below the 1% light depth. Concentrations of bacteriochlorophyll a (BChl a) were low (approx.1%) compared to chlorophyll a. Although the BChl a content of AAP bacteria per cell was typically 20- to 250-fold lower than the divinyl-chlorophyll a content of Prochlorococcus, in shelf break water the pigment content of AAP bacteria approached that of Prochlorococcus. The abundance of AAP bacteria rivaled some groups of strictly heterotrophic bacteria and was often higher than the abundance of known AAP genera (Erythrobacter and Roseobacter spp.). The distribution of AAP bacteria in the water column, which was similar in the Atlantic and the Pacific, was consistent with phototrophy.

  20. 78 FR 57874 - Federal Property Suitable as Facilities to Assist the Homeless

    Science.gov (United States)

    2013-09-20

    ... Assistant Secretary for Community Planning and Development, HUD. ACTION: Notice. SUMMARY: This Notice... kitchen Reasons: Extensive deterioration Tennessee J0139 Milan AAP Milan TN 38358 Landholding Agency:...

  1. PRECIPITATION EFFECTS ON SOIL CHARACTERISTICS IN TROPICAL RAIN FORESTS OF THE CHOCO BIOGEOGRAPHICAL REGION

    Directory of Open Access Journals (Sweden)

    Harley Quinto Mosquera

    2016-01-01

    Full Text Available Average annual precipitation (AAP is one of the principal environmental factors that regulates processes in terrestrial ecosystems. The effect of AAP on the availability of edaphic nutrients is poorly understood, especially in tropical zones with high rainfall. In order to evaluate the effects of high AAP on the availability of soil N, P, and K, physicochemical parameters were measured in soils of three tropical rainforests in the Chocó biogeographical region with different AAPs (7,500, 8,000, and 10,000 mm yr-1. Furthermore, a bibliographical review was carried out that including studies for distinct tropical Ultisols and AAP ranging from 1,800 to 10,000 mm yr-1. The evaluated soils presented extreme acidity with high contents of Al, organic matter (OM and total N, and low quantities of P, Mg, and Ca. The K concentrations were intermediate and the effective cation exchange capacity (ECEC was low. On the other hand, in the evaluation of the influence of the AAP on the availability of N, P, and K in the soil, contrasting tendencies were observed. On one side, a positive curvilinear relationship was found between the availability of N and the increase in the AAP. On the other side, the available P content significantly decreased with increasing AAP. In conclusion, the excessive AAP resulted in increases in total N and low availability of P, thereby altering the dynamics of the nutrients and the carbon balance of the tropical forest

  2. Ascorbic acid 6-palmitate suppresses gap-junctional intercellular communication through phosphorylation of connexin 43 via activation of the MEK-ERK pathway.

    Science.gov (United States)

    Lee, Kyung Mi; Kwon, Jung Yeon; Lee, Ki Won; Lee, Hyong Joo

    2009-01-15

    Although the health benefits of dietary antioxidants have been extensively studied, their potential negative effects remain unclear. L-Ascorbic acid 6-palmitate (AAP), a synthetic derivative of ascorbic acid (AA), is widely used as an antioxidant and preservative in foods, vitamins, drugs, and cosmetics. Previously, we found that AA exerted an antitumor effect by protecting inhibition of gap-junctional intercellular communication (GJIC), which is closely associated with tumor progression. In this study, we examined whether AAP, an amphipathic derivative of AA, has chemopreventive effects using a GJIC model. AAP and AA exhibited dose-dependent free radical-scavenging activities and inhibited hydrogen peroxide (H(2)O(2))-induced intracellular reactive oxygen species (ROS) production in normal rat liver epithelial cells. Unexpectedly, however, AAP did not protect against the inhibition of GJIC induced by H(2)O(2); instead, it inhibited GJIC synergistically with H(2)O(2). AAP inhibited GJIC in a dose-dependent and reversible manner. This inhibitory effect was not due to the conjugated lipid structure of AAP, as treatment with palmitic acid alone failed to inhibit GJIC under the same conditions. The inhibition of GJIC by AAP was restored in the presence of mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) kinase (MEK) inhibitor U0126, but not in the presence of other signal inhibitors and antioxidant (PKC inhibitors, EGFR inhibitor, NADPH oxidase inhibitor, catalase, vitamin E, or AA), indicating the critical involvement of MEK signaling in the GJIC inhibitory activity of AAP. Phosphorylation of ERK and connexin 43 (Cx43) was observed following AAP treatment, and this was reversed by U0126. These results suggest that the AAP-induced inhibition of GJIC is mediated by the phosphorylation of Cx43 via activation of the MEK-ERK pathway. Taken together, our results indicate that AAP has a potent carcinogenic effect, and that the influence of dietary

  3. Enzymuria in neonates receiving continuous intravenous infusion of gentamicin

    DEFF Research Database (Denmark)

    Colding, H; Brygge, K; Brendstrup, L;

    1992-01-01

    with non-treatment periods in the same newborn infant (33 infants). The same tendency applied to AAP. Newborn infants receiving continuous intravenous infusion of gentamicin were not found to be at greater risk of nephrotoxicity than those receiving intermittent gentamicin treatment, using NAG and AAP...

  4. Pediatric Microdose Study of [14C]Paracetamol to Study Drug Metabolism Using Accelerated Mass Spectrometry: Proof of Concept

    NARCIS (Netherlands)

    M.G. Mooij (Miriam); E. van Duijn (Esther); C.A.J. Knibbe (Catherijne); A.D. Windhorst (Albert); N.H. Hendrikse (N. Harry); W.H.J. Vaes (Wouter H. J.); E. Spaans (Edwin); B.O. Fabriek (Babs); H. Sandman (Hugo); D. Grossouw (Dimitri); L.M. Hanff (Lidwien); P.J.J.M. Janssen (Paul); B.C.P. Koch (Birgit C. P.); D. Tibboel (Dick); S.N. de Wildt (Saskia)

    2014-01-01

    textabstractResults: Ten infants (aged 0.1–83.1 months) were included; one was excluded as he vomited shortly after administration. In nine patients, [14C]AAP and metabolites in blood samples were detectable at expected concentrations: median (range) maximum concentration (Cmax) [14C]AAP 1.68

  5. Pediatric Microdose Study of [14C]Paracetamol to Study Drug Metabolism Using Accelerated Mass Spectrometry: Proof of Concept

    NARCIS (Netherlands)

    Mooij, M.G.; Duijn, E. van; Knibbe, C.A.J.; Windhorst, A.D.; Hendrikse, N.H.; Vaes, W.H.J.; Spaans, E.; Fabriek, B.O.; Sandman, H.; Grossouw, D.; Hanff, L.M.; Janssen, P.J.J.M.; Koch, B.C.P.; Tibboel, D.; de Wildt, S.N.

    2014-01-01

    Results: Ten infants (aged 0.1–83.1 months) were included; one was excluded as he vomited shortly after administration. In nine patients, [14C]AAP and metabolites in blood samples were detectable at expected concentrations: median (range) maximum concentration (Cmax) [14C]AAP 1.68 (0.75–4.76) ng/L,

  6. Amino Acid Transporters Are Localized to Transfer Cells of Developing Pea Seeds1

    Science.gov (United States)

    Tegeder, Mechthild; Offler, Christina E.; Frommer, Wolf B.; Patrick, John W.

    2000-01-01

    To determine the nature and cellular localization of amino acid transport in pea seeds, two cDNA clones belonging to the AAP family of H+/amino acid co-transporters (PsAAP1 and PsAAP2) were isolated from a cotyledon cDNA library of pea (Pisum sativum L.). Functional expression in the yeast amino acid uptake mutants 22Δ6AAL and 22Δ8AA showed that PsAAP1 mediates transport of neutral, acidic, and basic amino acids. RNA-blot analyses showed that PsAAP1 is expressed in seeds and vegetative organs, including amino acid sinks and sources, whereas PsAAP2 could not be detected. For developing seeds, transcripts of PsAAP1 were detected in coats and cotyledons, with seed coats giving a weak signal. In cotyledons, expression was highest in epidermal-transfer-cell-enriched tissue. RNA in situ hybridization analysis showed that PsAAP1 was predominantly present in epidermal transfer cells forming the outer surface of cotyledons, which abuts the seed coats. Overall, our observations suggest that this transporter, which is localized in transfer cells of cotyledons, might play a role in the uptake of the full spectrum of amino acids released from seed coats. PMID:10677425

  7. Reference: 579 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available amounts, and plants frequently make use of these nitrogen sources. The goal of this study was to identify tr...ant role of AAP1 for efficient use of nitrogen sources present in the rhizosphere. AAP1 transports uncharged

  8. A plasma membrane association module in yeast amino acid transporters

    NARCIS (Netherlands)

    Popov-Čeleketić, Dušan; Bianchi, Frans; Ruiz, Stephanie J; Meutiawati, Febrina; Poolman, Bert

    2016-01-01

    Amino acid permeases (AAPs) in the plasma membrane (PM) of Saccharomyces cerevisiae are responsible for the uptake of amino acids and involved in regulation of their cellular levels. Here, we report on a strong and complex module for PM association found in the C-terminal tail of AAPs. Using in sili

  9. Metabolic Signature of Antipsychotics Used in the Treatment of Autism

    Science.gov (United States)

    2015-10-01

    Atypical antipsychotics (AAP) are prescribed to patients with autism spectrum disorders with symptoms of aggression or agitation, stereotypic behavior...AAP directly Increase the size of rat adipocytes Subcutaneous adipose explants from Sprague Dawley male rats (N=8) were incubated in DMEM/F12 and 5

  10. NCBI nr-aa BLAST: CBRC-GGOR-01-1322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-1322 gb|AAP44475.1| transient receptor potential cation channel subfam...ily M member 4 splice variant C [Homo sapiens] gb|EAW52460.1| transient receptor potential cation channel, subfamily M, member 4, isoform CRA_a [Homo sapiens] AAP44475.1 3e-28 87% ...

  11. Protective effects of diallyl disulfide against acetaminophen-induced nephrotoxicity: A possible role of CYP2E1 and NF-κB.

    Science.gov (United States)

    Ko, Je-Won; Shin, Jin-Young; Kim, Jeong-Won; Park, Sung-Hyeuk; Shin, Na-Rae; Lee, In-Chul; Shin, In-Sik; Moon, Changjong; Kim, Sung-Ho; Kim, Sung-Hwan; Kim, Jong-Choon

    2017-04-01

    Diallyl disulfide (DADS) is a degradation product of allicin which is contained in garlic. This study investigated the protective effects of DADS against acetaminophen (AAP)-induced nephrotoxicity and the molecular mechanisms of nephroprotective effects in rats. AAP caused severe nephrotoxicity as evidenced by significant increases in renal tubular cell apoptosis, mitochondria-mediated apoptosis, and up-regulation of nuclear transcription factor kappa-B (NF-κB), cyclooxygenase-2 (Cox-2), and tumor necrosis factor-α (TNF-α) in the kidney with histopathological alterations. After AAP administration, glutathione content and activities of catalase, superoxide dismutase, and glutathione reductase were significantly decreased whereas malondialdehyde content was significantly increased, indicating that AAP-induced kidney injury was mediated through oxidative stress. In contrast, DADS pretreatment significantly attenuated AAP-induced nephrotoxic effects, including oxidative damage, histopathological lesions, and apoptotic changes in the kidney. DADS also attenuated AAP-induced up-regulation of NF-κB, Cox-2, and TNF-α in the kidney, and microsomal CYP2E1 expression in liver and kidney. These results indicated that DADS could prevent AAP-induced nephrotoxicity. The protective effects of DADS might be due to its ability to decrease metabolic activation of AAP by inhibiting CYP2E1 and its potent antioxidant, antiapoptotic, and antiinflammatory effects via inhibition of NF-κB. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. 48 CFR 307.104 - General procedures.

    Science.gov (United States)

    2010-10-01

    ... standard format for an AAP. The template for the plan is available on the ASFR/OGAPA/DA Internet Web site. For the data elements specified in the AAP format, the HCA/CCO may include information in addition to... monitoring. (4) The HCA/CCO and Small Business Specialist (SBS) in the Office of Small and...

  13. A plasma membrane association module in yeast amino acid transporters

    NARCIS (Netherlands)

    Popov-Čeleketić, Dušan; Bianchi, Frans; Ruiz, Stephanie J; Meutiawati, Febrina; Poolman, Bert

    2016-01-01

    Amino acid permeases (AAPs) in the plasma membrane (PM) of Saccharomyces cerevisiae are responsible for the uptake of amino acids and involved in regulation of their cellular levels. Here, we report on a strong and complex module for PM association found in the C-terminal tail of AAPs. Using in

  14. Kinetics, dynamics and localization of basic amino acid transporters in Saccharomyces cerevisiae

    NARCIS (Netherlands)

    Bianchi, Frans

    2016-01-01

    Amino acid permeases (AAPs) in the plasma membrane (PM) of Saccharomyces cerevisiae are responsible for the uptake and regulation of the cellular levels of amino acids. The focus of my thesis is on the AAP’s responsible for the uptake of basic amino acids. Curiously these AAPs have been reported to

  15. Rapid induction of hepatocyte growth factor mRNA after administration of gomisin A, a lignan component of shizandra fruits.

    Science.gov (United States)

    Shiota, G; Yamada, S; Kawasaki, H

    1996-11-01

    Gomisin A (Go), a lignan component of shizandra fruits, protects the liver from injury by acetaminophen (AAP). One of its possible mechanisms is supposed to be related to the suppression of lipid peroxidation. Since hepatocyte growth factor (HGF) was reported to prevent hepatotoxin-induced liver damage, we tested HGF as the intermediary of Go effects. Simultaneous analyses of HGF mRNA expression and liver histology in rats were performed at 6 and 24 hr after treatment with AAP, Go or both. HGF mRNA rapidly expressed at 6 hr after Go treatment, while no HGF mRNA was observed at 6 hr after AAP treatment. Induction of HGF mRNA at 24 hr was observed after treatment with AAP or AAP plus Go. Histological findings indicate that massive necrosis and vacuolization in the liver of rats treated with both AAP and Go were reduced in comparison with rats treated with AAP only. These data suggest that Go rapidly induces HGF mRNA through different mechanisms from AAP-induced liver injury.

  16. Increasing Availability to and Ascertaining Value of Asthma Action Plans in Schools through Use of Technology and Community Collaboration

    Science.gov (United States)

    Hanson, Tabitha K.; Aleman, Martha; Hart, Lacey; Yawn, Barbara

    2013-01-01

    Background: Approximately 9% of school-aged children in the United States have asthma. Since 1997, the Asthma Action Plan (AAP) has been recommended as an asthma self-management tool for individuals with asthma. In the school setting, the use of the AAP has been primarily dependent on communication between the family and the school through a paper…

  17. Pediatric Microdose Study of [14C]Paracetamol to Study Drug Metabolism Using Accelerated Mass Spectrometry: Proof of Concept

    NARCIS (Netherlands)

    Mooij, M.G.; Duijn, E. van; Knibbe, C.A.J.; Windhorst, A.D.; Hendrikse, N.H.; Vaes, W.H.J.; Spaans, E.; Fabriek, B.O.; Sandman, H.; Grossouw, D.; Hanff, L.M.; Janssen, P.J.J.M.; Koch, B.C.P.; Tibboel, D.; de Wildt, S.N.

    2014-01-01

    Results: Ten infants (aged 0.1–83.1 months) were included; one was excluded as he vomited shortly after administration. In nine patients, [14C]AAP and metabolites in blood samples were detectable at expected concentrations: median (range) maximum concentration (Cmax) [14C]AAP 1.68 (0.75–4.76) ng/L,

  18. Pediatric Microdose Study of [14C]Paracetamol to Study Drug Metabolism Using Accelerated Mass Spectrometry: Proof of Concept

    NARCIS (Netherlands)

    M.G. Mooij (Miriam); E. van Duijn (Esther); C.A.J. Knibbe (Catherijne); A.D. Windhorst (Albert); N.H. Hendrikse (N. Harry); W.H.J. Vaes (Wouter H. J.); E. Spaans (Edwin); B.O. Fabriek (Babs); H. Sandman (Hugo); D. Grossouw (Dimitri); L.M. Hanff (Lidwien); P.J.J.M. Janssen (Paul); B.C.P. Koch (Birgit C. P.); D. Tibboel (Dick); S.N. de Wildt (Saskia)

    2014-01-01

    textabstractResults: Ten infants (aged 0.1–83.1 months) were included; one was excluded as he vomited shortly after administration. In nine patients, [14C]AAP and metabolites in blood samples were detectable at expected concentrations: median (range) maximum concentration (Cmax) [14C]AAP 1.68 (0.75–

  19. Increasing Availability to and Ascertaining Value of Asthma Action Plans in Schools through Use of Technology and Community Collaboration

    Science.gov (United States)

    Hanson, Tabitha K.; Aleman, Martha; Hart, Lacey; Yawn, Barbara

    2013-01-01

    Background: Approximately 9% of school-aged children in the United States have asthma. Since 1997, the Asthma Action Plan (AAP) has been recommended as an asthma self-management tool for individuals with asthma. In the school setting, the use of the AAP has been primarily dependent on communication between the family and the school through a paper…

  20. TEMPLATE POLYMERIZATION OF N-VINYLIMIDAZOLE ALONG POLY(METHACRYLIC ACID) IN WATER .3. MOLECULAR-WEIGHTS OF THE FORMED POLYMERS

    NARCIS (Netherlands)

    VANDEGRAMPEL, HT; TAN, YY; CHALLA, G

    1991-01-01

    The molecular weights of polymers formed in the template polymerization of N-vinylimidazole (VIm) along poly(methacrylic acid) (PMAA) in water at 50-degrees-C using 2,2'-azobis(2-amidinopropane)-2HCl (AAP) as initiator were determined for variable [PMAA] to [VIm]0 ratios, [VIm]0, [AAP]0, and templat

  1. Kinetic, spectroscopic, and X-ray crystallographic characterization of the functional E151H aminopeptidase from Aeromonas proteolytica.

    Science.gov (United States)

    Bzymek, Krzysztof P; Moulin, Aaron; Swierczek, Sabina I; Ringe, Dagmar; Petsko, Gregory A; Bennett, Brian; Holz, Richard C

    2005-09-13

    Glutamate151 (E151) has been shown to be catalytically essential for the aminopeptidase from Vibrio proteolyticus (AAP). E151 acts as the general acid/base during the catalytic mechanism of peptide hydrolysis. However, a glutamate residue is not the only residue capable of functioning as a general acid/base during catalysis for dinuclear metallohydrolases. Recent crystallographic characterization of the D-aminopeptidase from Bacillus subtilis (DppA) revealed a histidine residue that resides in an identical position to E151 in AAP. Because the active-site ligands for DppA and AAP are identical, AAP has been used as a model enzyme to understand the mechanistic role of H115 in DppA. Substitution of E151 with histidine resulted in an active AAP enzyme exhibiting a kcat value of 2.0 min(-1), which is over 2000 times slower than r AAP (4380 min(-1)). ITC experiments revealed that ZnII binds 330 and 3 times more weakly to E151H-AAP compared to r-AAP. UV-vis and EPR spectra of CoII-loaded E151H-AAP indicated that the first metal ion resides in a hexacoordinate/pentacoordinate equilibrium environment, whereas the second metal ion is six-coordinate. pH dependence of the kinetic parameters kcat and K(m) for the hydrolysis of L-leucine p-nitroanilide (L-pNA) revealed a change in an ionization constant in the enzyme-substrate complex from 5.3 in r-AAP to 6.4 in E151H-AAP, consistent with E151 in AAP being the active-site general acid/base. Proton inventory studies at pH 8.50 indicate the transfer of one proton in the rate-limiting step of the reaction. Moreover, the X-ray crystal structure of [ZnZn(E151H-AAP)] has been solved to 1.9 A resolution, and alteration of E151 to histidine does not introduce any major conformational changes to the overall protein structure or the dinuclear ZnII active site. Therefore, a histidine residue can function as the general acid/base in hydrolysis reactions of peptides and, through analogy of the role of E151 in AAP, H115 in DppA likely

  2. Use of the adult attachment projective picture system in psychodynamic psychotherapy with a severely traumatized patient.

    Science.gov (United States)

    George, Carol; Buchheim, Anna

    2014-01-01

    The following case study is presented to facilitate an understanding of how the attachment information evident from Adult Attachment Projective Picture System (AAP) assessment can be integrated into a psychodynamic perspective in making therapeutic recommendations that integrate an attachment perspective. The Adult Attachment Projective Picture System (AAP) is a valid representational measure of internal representations of attachment based on the analysis of a set of free response picture stimuli designed to systematically activate the attachment system (George and West, 2012). The AAP provides a fruitful diagnostic tool for psychodynamic-oriented clinicians to identify attachment-based deficits and resources for an individual patient in therapy. This paper considers the use of the AAP with a traumatized patient in an inpatient setting and uses a case study to illustrate the components of the AAP that are particularly relevant to a psychodynamic conceptualization. The paper discusses also attachment-based recommendations for intervention.

  3. Extraction and characterization of the auricularia auricular polysaccharide

    Science.gov (United States)

    Zhang, Q. T.

    2016-07-01

    To study a new protein drugs carrier, the Auricularia auricular polysaccharide (AAP) was extracted and purified from Auricularia auricular, and then characterized by the micrOTOF-Q mass spectrometer, UV/Vis spectrophotometer, moisture analyzer and SEM. The results showed that the AAP sample was water- soluble and white flocculence, its molecular weight were 20506.9 Da∼⃒63923.7 Da, and the yield, moisture, and total sugar contents of the AAP were 4.5%, 6.2% and 90.12%(w/w), respectively. The results of the SEM revealed that the AAP dried by vacuum were spherical particles with a smooth surface, and the AAP freeze-dried had continuous porous sheet shape with the loose structure.

  4. Acetaminophen induces human neuroblastoma cell death through NFKB activation.

    Directory of Open Access Journals (Sweden)

    Inmaculada Posadas

    Full Text Available Neuroblastoma resistance to apoptosis may contribute to the aggressive behavior of this tumor. Therefore, it would be relevant to activate endogenous cellular death mechanisms as a way to improve neuroblastoma therapy. We used the neuroblastoma SH-SY5Y cell line as a model to study the mechanisms involved in acetaminophen (AAP-mediated toxicity by measuring CYP2E1 enzymatic activity, NFkB p65 subunit activation and translocation to the nucleus, Bax accumulation into the mitochondria, cytochrome c release and caspase activation. AAP activates the intrinsic death pathway in the SH-SY5Y human neuroblastoma cell line. AAP metabolism is partially responsible for this activation, because blockade of the cytochrome CYP2E1 significantly reduced but did not totally prevent, AAP-induced SH-SY5Y cell death. AAP also induced NFkB p65 activation by phosphorylation and its translocation to the nucleus, where NFkB p65 increased IL-1β production. This increase contributed to neuroblastoma cell death through a mechanism involving Bax accumulation into the mitochondria, cytochrome c release and caspase3 activation. Blockade of NFkB translocation to the nucleus by the peptide SN50 prevented AAP-mediated cell death and IL-1β production. Moreover, overexpression of the antiapoptotic protein Bcl-x(L did not decrease AAP-mediated IL-1β production, but prevented both AAP and IL-1β-mediated cell death. We also confirmed the AAP toxic actions on SK-N-MC neuroepithelioma and U87MG glioblastoma cell lines. The results presented here suggest that AAP activates the intrinsic death pathway in neuroblastoma cells through a mechanism involving NFkB and IL-1β.

  5. Diversity and Distribution of Freshwater Aerobic Anoxygenic Phototrophic Bacteria across a Wide Latitudinal Gradient

    Science.gov (United States)

    Ferrera, Isabel; Sarmento, Hugo; Priscu, John C.; Chiuchiolo, Amy; González, José M.; Grossart, Hans-Peter

    2017-01-01

    Aerobic anoxygenic phototrophs (AAPs) have been shown to exist in numerous marine and brackish environments where they are hypothesized to play important ecological roles. Despite their potential significance, the study of freshwater AAPs is in its infancy and limited to local investigations. Here, we explore the occurrence, diversity and distribution of AAPs in lakes covering a wide latitudinal gradient: Mongolian and German lakes located in temperate regions of Eurasia, tropical Great East African lakes, and polar permanently ice-covered Antarctic lakes. Our results show a widespread distribution of AAPs in lakes with contrasting environmental conditions and confirm that this group is composed of different members of the Alpha- and Betaproteobacteria. While latitude does not seem to strongly influence AAP abundance, clear patterns of community structure and composition along geographic regions were observed as indicated by a strong macro-geographical signal in the taxonomical composition of AAPs. Overall, our results suggest that the distribution patterns of freshwater AAPs are likely driven by a combination of small-scale environmental conditions (specific of each lake and region) and large-scale geographic factors (climatic regions across a latitudinal gradient). PMID:28275369

  6. The hydrological context determines the beta-diversity of aerobic anoxygenic phototrophic bacteria in European Arctic seas but does not favor endemism

    Directory of Open Access Journals (Sweden)

    Anne-Catherine eLehours

    2015-07-01

    Full Text Available Despite an increasing number of studies over the last 15 years, aerobic anoxygenic photoheterotrophic (AAP bacteria remain a puzzling functional group in terms of physiology, metabolism, and ecology. To contribute to a better knowledge of their environmental distribution, the present study aims at analyzing their diversity and structure at the boundary between the Norwegian, Greenland, and Barents Seas. The polymorphism of a marker gene encoding a sub-unit of the photosynthetic apparatus (pufM gene was analyzed and attempted to be related to environmental parameters. The Atlantic or Arctic origin of water masses had a strong impact on the AAP bacterial community structure whose populations mostly belonged to the Alpha- and Gammaproteobacteria. A majority (> 60 % of pufM sequences were affiliated to the Gammaproteobacteria reasserting that this class often represents the major component of the AAP bacterial community in oceanic regions. Two alphaproteobacterial groups dominate locally suggesting that they can constitute key players in this marine system transiently. We found that temperature is a major determinant of alpha diversity of AAP bacteria in this marine biome with specific clades emerging locally according to the partitioning of water masses. Whereas we expected specific AAP bacterial populations in this peculiar and newly explored ecosystem, most pufM sequences were highly related to sequences retrieved elsewhere. This observation highlights that the studied area does not favor AAP bacteria endemism but also opens new questions about the truthfulness of biogeographical patterns and on the extent of AAP bacterial diversity.

  7. Monoclonal antibodies against accumulation-associated protein affect EPS biosynthesis and enhance bacterial accumulation of Staphylococcus epidermidis.

    Directory of Open Access Journals (Sweden)

    Jian Hu

    Full Text Available Because there is no effective antibiotic to eradicate Staphylococcus epidermidis biofilm infections that lead to the failure of medical device implantations, the development of anti-biofilm vaccines is necessary. Biofilm formation by S. epidermidis requires accumulation-associated protein (Aap that contains sequence repeats known as G5 domains, which are responsible for the Zn(2+-dependent dimerization of Aap to mediate intercellular adhesion. Antibodies against Aap have been reported to inhibit biofilm accumulation. In the present study, three monoclonal antibodies (MAbs against the Aap C-terminal single B-repeat construct followed by the 79-aa half repeat (AapBrpt1.5 were generated. MAb(18B6 inhibited biofilm formation by S. epidermidis RP62A to 60% of the maximum, while MAb(25C11 and MAb(20B9 enhanced biofilm accumulation. All three MAbs aggregated the planktonic bacteria to form visible cell clusters. Epitope mapping revealed that the epitope of MAb(18B6, which recognizes an identical area within AapBrpt constructs from S. epidermidis RP62A, was not shared by MAb(25C11 and MAb(20B9. Furthermore, all three MAbs were found to affect both Aap expression and extracellular polymeric substance (EPS, including extracellular DNA and PIA biosynthesis in S. epidermidis and enhance the cell accumulation. These findings contribute to a better understanding of staphylococcal biofilm formation and will help to develop epitope-peptide vaccines against staphylococcal infections.

  8. A polyphenol extract of Hibiscus sabdariffa L. ameliorates acetaminophen-induced hepatic steatosis by attenuating the mitochondrial dysfunction in vivo and in vitro.

    Science.gov (United States)

    Lee, Chao-Hsin; Kuo, Chih-Yi; Wang, Chau-Jong; Wang, Chi-Ping; Lee, Yi-Ru; Hung, Chi-Nan; Lee, Huei-Jane

    2012-01-01

    Oxidative stress is the major contributor to acetaminophen (AAP)-caused liver damage. It promotes mitochondrial oxidative stress and collapses the mitochondrial membrane potential to cause cell death. We have previously shown that a polyphenol extract of Hibiscus sabdariffa L. (HPE) potentiated the antioxidative effect. We further examined in this study the possible mechanism of HPE against AAP-caused liver damage. BABL/c mice were orally fed with HPE (100, 200 or 300 mg/kg) for two weeks prior to an i.p. injection of 1000 mg/kg of AAP. The mice were decapitated 6 h after the AAP injection to collect the blood and liver for further determination. The results show that pretreating with HPE increased the level of glutathione (GSH), decreased the level of lipid peroxidation, and increased catalase activity in the liver. A histopathological evaluation shows that HPE could decrease AAP-induced liver sterosis accompanied by a decreased expression of AIF, Bax, Bid, and p-JNK in the liver. An in vitro assay revealed that HPE could reduce AAP-induced death of BABL/c normal liver cells (BNLs), reverse the lost mitochondrial potency and improve the antioxidative status, similarly to the results of the in vivo assay. We show in this study that HPE possessed the ability to protect the liver from AAP-caused injury. The protective mechanism might be regulated by decreasing oxidative stress and attenuating the mitochondrial dysfunction.

  9. Patterns in Abundance, Cell Size and Pigment Content of Aerobic Anoxygenic Phototrophic Bacteria along Environmental Gradients in Northern Lakes.

    Directory of Open Access Journals (Sweden)

    Lisa Fauteux

    Full Text Available There is now evidence that aerobic anoxygenic phototrophic (AAP bacteria are widespread across aquatic systems, yet the factors that determine their abundance and activity are still not well understood, particularly in freshwaters. Here we describe the patterns in AAP abundance, cell size and pigment content across wide environmental gradients in 43 temperate and boreal lakes of Québec. AAP bacterial abundance varied from 1.51 to 5.49 x 105 cells mL-1, representing <1 to 37% of total bacterial abundance. AAP bacteria were present year-round, including the ice-cover period, but their abundance relative to total bacterial abundance was significantly lower in winter than in summer (2.6% and 7.7%, respectively. AAP bacterial cells were on average two-fold larger than the average bacterial cell size, thus AAP cells made a greater relative contribution to biomass than to abundance. Bacteriochlorophyll a (BChla concentration varied widely across lakes, and was not related to AAP bacterial abundance, suggesting a large intrinsic variability in the cellular pigment content. Absolute and relative AAP bacterial abundance increased with dissolved organic carbon (DOC, whereas cell-specific BChla content was negatively related to chlorophyll a (Chla. As a result, both the contribution of AAP bacteria to total prokaryotic abundance, and the cell-specific BChla pigment content were positively correlated with the DOC:Chla ratio, both peaking in highly colored, low-chlorophyll lakes. Our results suggest that photoheterotrophy might represent a significant ecological advantage in highly colored, low-chlorophyll lakes, where DOC pool is chemically and structurally more complex.

  10. Patterns in Abundance, Cell Size and Pigment Content of Aerobic Anoxygenic Phototrophic Bacteria along Environmental Gradients in Northern Lakes.

    Science.gov (United States)

    Fauteux, Lisa; Cottrell, Matthew T; Kirchman, David L; Borrego, Carles M; Garcia-Chaves, Maria Carolina; Del Giorgio, Paul A

    2015-01-01

    There is now evidence that aerobic anoxygenic phototrophic (AAP) bacteria are widespread across aquatic systems, yet the factors that determine their abundance and activity are still not well understood, particularly in freshwaters. Here we describe the patterns in AAP abundance, cell size and pigment content across wide environmental gradients in 43 temperate and boreal lakes of Québec. AAP bacterial abundance varied from 1.51 to 5.49 x 105 cells mL-1, representing bacterial abundance. AAP bacteria were present year-round, including the ice-cover period, but their abundance relative to total bacterial abundance was significantly lower in winter than in summer (2.6% and 7.7%, respectively). AAP bacterial cells were on average two-fold larger than the average bacterial cell size, thus AAP cells made a greater relative contribution to biomass than to abundance. Bacteriochlorophyll a (BChla) concentration varied widely across lakes, and was not related to AAP bacterial abundance, suggesting a large intrinsic variability in the cellular pigment content. Absolute and relative AAP bacterial abundance increased with dissolved organic carbon (DOC), whereas cell-specific BChla content was negatively related to chlorophyll a (Chla). As a result, both the contribution of AAP bacteria to total prokaryotic abundance, and the cell-specific BChla pigment content were positively correlated with the DOC:Chla ratio, both peaking in highly colored, low-chlorophyll lakes. Our results suggest that photoheterotrophy might represent a significant ecological advantage in highly colored, low-chlorophyll lakes, where DOC pool is chemically and structurally more complex.

  11. Patterns in Abundance, Cell Size and Pigment Content of Aerobic Anoxygenic Phototrophic Bacteria along Environmental Gradients in Northern Lakes

    Science.gov (United States)

    Fauteux, Lisa; Cottrell, Matthew T.; Kirchman, David L.; Borrego, Carles M.; Garcia-Chaves, Maria Carolina; del Giorgio, Paul A.

    2015-01-01

    There is now evidence that aerobic anoxygenic phototrophic (AAP) bacteria are widespread across aquatic systems, yet the factors that determine their abundance and activity are still not well understood, particularly in freshwaters. Here we describe the patterns in AAP abundance, cell size and pigment content across wide environmental gradients in 43 temperate and boreal lakes of Québec. AAP bacterial abundance varied from 1.51 to 5.49 x 105 cells mL-1, representing ecological advantage in highly colored, low-chlorophyll lakes, where DOC pool is chemically and structurally more complex. PMID:25927833

  12. Asparaginase-associated pancreatitis is not predicted by hypertriglyceridemia or pancreatic enzyme levels in children with acute lymphoblastic leukemia

    DEFF Research Database (Denmark)

    Raja, Raheel Altaf; Schmiegelow, Kjeld; Sørensen, Ditte Nørbo

    2017-01-01

    treatment. The aim of this study was to explore if HTG or early elevations in pancreatic enzymes were associated with the subsequent development of AAP. Method: Children (1.0–17.9 years) diagnosed with ALL, treated with asparaginase for 30 weeks, according to the NOPHO ALL2008 protocol at the University......-specific amylase levels two weeks later (P = 0.005). Conclusions: AAP does not seem to be associated with HTG. Continuous monitoring of pancreas enzymes does not predict AAP....

  13. Use of the Adult Attachment Projective Picture System in Psychodynamic Psychotherapy with a Severely Traumatized Patient

    Directory of Open Access Journals (Sweden)

    Carol eGeorge

    2014-08-01

    Full Text Available The Adult Attachment Projective Picture System (AAP is a valid representational measure of internal representations of attachment based on the analysis of a set of free response picture stimuli designed to systematically activate the attachment system (George & West, 2012. The AAP provides a fruitful diagnostic tool for psychodynamic-oriented clinicians to identify attachment-based deficits and resources for an individual patient in therapy. This paper considers the use of the AAP with a traumatized patient in an inpatient setting and uses a case study to illustrate the components of the AAP that are particularly relevant to a psychodynamic conceptualization. The paper discusses also attachment-based recommendations for intervention.

  14. Cow's milk - infants

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002448.htm Cow's milk - infants To use the sharing features on this ... old, you should not feed your baby cow's milk, according to the American Academy of Pediatrics (AAP). ...

  15. Pediatricians: Kids Need 'Media Use Plan' from Parents

    Science.gov (United States)

    ... in media also can promote unhealthy eating, substance abuse and risky sexual conduct. The AAP recommends that parents prioritize creative, unplugged playtime for infants and toddlers. A child's exposure to media can start as early as ...

  16. Indications of atypical antipsychotics in the elderly.

    Science.gov (United States)

    McKean, Andrew; Monasterio, Erik

    2015-01-01

    Atypical antipsychotics (AAP) have become some of the most commonly prescribed medications in primary and specialist care settings. Off-label prescribing accounts for much of the expanded use of AAPs. This has become common in the elderly. Marketing by pharmaceutical companies appears to have contributed to the off-label use of AAPs, in situations where their safety and efficacy is far from established. Although evidence provides varying degrees of support for their use for behavioural and psychological symptoms of dementia, augmentation of antidepressants in depression, anxiety, insomnia and in the management of psychosis in Parkinson's Disease, there are a number of potential problems with their expanded use in the elderly. These include weight gain, type two diabetes mellitus, sudden cardiac death and increased mortality rates in the elderly with dementia. It is recommended that whenever AAPs are used off-label, a review date is identified, informed consent is obtained and treatment and side-effects are closely monitored.

  17. ZP123 increases gap junctional conductance and prevents reentrant ventricular tachycardia during myocardial ischemia in open chest dogs

    DEFF Research Database (Denmark)

    Xing, Dezhi; Kjølbye, Anne Louise; Nielsen, Morten S

    2003-01-01

    INTRODUCTION: The aim of this study was to determine if the stable antiarrhythmic peptide (AAP) analogue ZP123 increases gap junctional intercellular conductance and prevents reentrant ventricular tachycardia (VT) during coronary artery occlusion. METHODS AND RESULTS: Voltage clamp experiments...

  18. Find a Periodontist

    Science.gov (United States)

    ... List Record CE Credits Continuing Education Opportunities Publications Journal of Periodontology JOP Online How to Subscribe Missing-Issue Claim Form Back-Issue Order Form JOP Editors Submit Manuscript Clinical Advances in Perio CAP Editors AAP Clinical and ...

  19. American Academy of Periodontology

    Science.gov (United States)

    ... List Record CE Credits Continuing Education Opportunities Publications Journal of Periodontology JOP Online How to Subscribe Missing-Issue Claim Form Back-Issue Order Form JOP Editors Submit Manuscript Clinical Advances in Perio CAP Editors AAP Clinical and ...

  20. Pediatricians Say No to Wearable Smartphone Baby Monitors

    Science.gov (United States)

    ... Academy of Pediatrics (AAP) recommends against using these high-tech baby monitors in healthy infants, said Dr. Rachel ... Owlet responded that the company has performed "extensive product safety testing," adding that its Smart Sock is ...

  1. Ecology of aerobic anoxygenic phototrophs in aquatic environments.

    Science.gov (United States)

    Koblížek, Michal

    2015-11-01

    Recognition of the environmental role of photoheterotrophic bacteria has been one of the main themes of aquatic microbiology over the last 15 years. Aside from cyanobacteria and proteorhodopsin-containing bacteria, aerobic anoxygenic phototrophic (AAP) bacteria are the third most numerous group of phototrophic prokaryotes in the ocean. This functional group represents a diverse assembly of species which taxonomically belong to various subgroups of Alpha-, Beta- and Gammaproteobacteria. AAP bacteria are facultative photoheterotrophs which use bacteriochlorophyll-containing reaction centers to harvest light energy. The light-derived energy increases their bacterial growth efficiency, which provides a competitive advantage over heterotrophic species. Thanks to their enzymatic machinery AAP bacteria are active, rapidly growing organisms which contribute significantly to the recycling of organic matter. This chapter summarizes the current knowledge of the ecology of AAP bacteria in aquatic environments, implying their specific role in the microbial loop.

  2. Deployment and Children

    Science.gov (United States)

    ... 18-21yrs. Healthy Living Healthy Living Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Growing Healthy Sleep Safety & ... Word Shop AAP Find a Pediatrician Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Building Resilience Sleep Growing ...

  3. Mental Health Care: Who's Who

    Science.gov (United States)

    ... 18-21yrs. Healthy Living Healthy Living Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Growing Healthy Sleep Safety & ... Word Shop AAP Find a Pediatrician Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Building Resilience Sleep Growing ...

  4. Let the Brushing Games Begin

    Science.gov (United States)

    ... 18-21yrs. Healthy Living Healthy Living Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Growing Healthy Sleep Safety & ... Word Shop AAP Find a Pediatrician Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Sleep Growing Healthy Healthy ...

  5. Ballet and Dance

    Science.gov (United States)

    ... 18-21yrs. Healthy Living Healthy Living Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Growing Healthy Sleep Safety & ... Word Shop AAP Find a Pediatrician Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Sleep Growing Healthy Healthy ...

  6. Toddler Bedtime Trouble: Tips for Parents

    Science.gov (United States)

    ... 18-21yrs. Healthy Living Healthy Living Healthy Living Nutrition Fitness Sports Oral Health Emotional Wellness Growing Healthy Sleep Safety & ... Word Shop AAP Find a Pediatrician Healthy Living Nutrition ... Fitness Sports Oral Health Emotional Wellness Building Resilience Sleep Growing ...

  7. Sleep and Newborns

    Science.gov (United States)

    ... AAP introduced this recommendation in 1992. Use a firm sleep surface. Cover the mattress with a sheet ... Sleep and Your 1- to 2-Year-Old Communication and Your Newborn Medical Care and Your Newborn ...

  8. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... de la Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed ... trials disclosing to kids estate planning find a doctor find health information helpful articles antibiotics colds fevers ...

  9. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... de la Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed ... trials disclosing to kids estate planning find a doctor find health information helpful articles antibiotics colds fevers ...

  10. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... de la Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed ... trials disclosing to kids estate planning find a doctor find health information helpful articles antibiotics colds fevers ...

  11. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... de la Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed ... trials disclosing to kids estate planning find a doctor find health information helpful articles antibiotics colds fevers ...

  12. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... de la Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed ... trials disclosing to kids estate planning find a doctor find health information helpful articles antibiotics colds fevers ...

  13. Approaches to. Establish for Major Food Aller

    Science.gov (United States)

    ... J. Food Treatments to ibdtpe The best example of food prod@s that ... AAP) dct~~~~$ that ~~f~~~~a could be considered 'hypoallergenic” if challenge ...

  14. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  15. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  16. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  17. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  18. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  19. Circumcision

    Science.gov (United States)

    Circumcision is a surgical procedure to remove the foreskin, the skin that covers the tip of the ... AAP), there are medical benefits and risks to circumcision. Possible benefits include a lower risk of urinary ...

  20. Measles, Mumps, Rubella (MMR)

    Science.gov (United States)

    ... at Each Vaccine: MMR (Measles, Mumps and Rubella) Vaccine Children's Hospital of Philadelphia (CHOP): Learn about measles, how ... Disease Control and Prevention AAP Urges Parents to Vaccinate Children to Protect Against Measles (1/23/15) American ...

  1. Baltimore Eesti Selts - 75 / Vilve Ladon ; fotod: Fred Ise

    Index Scriptorium Estoniae

    Ladon, Vilve

    2010-01-01

    Baltimore Eesti Majas tähistati 2. okt. 2010 Baltimore Eesti Seltsi aastapäeva. Eesti suursaatkonna esimene sekretär poliitilistes küsimustes Aap Neljas edastas president Toomas Hendrik Ilvese tervituse

  2. Heart Disease Prevention: Does Oral Health Matter?

    Science.gov (United States)

    ... Forum. 2013;16:e232. Chapple ILC, et al. Diabetes and periodontal diseases: Consensus report of the Joint EFP/AAP Workshop on Periodontitis and Systemic Diseases. Journal of Clinical Periodontology. 2013; ...

  3. Crying Baby: What to Do When Your Newborn Cries

    Science.gov (United States)

    ... Sept. 3, 2015. Welcome to the world of parenting! American Academy of Pediatrics. http://patiented.solutions.aap. ... policy Advertising and sponsorship opportunities Reprint Permissions A single copy of these materials may be reprinted for ...

  4. New Dad: Tips to Help Manage Stress

    Science.gov (United States)

    ... 2008;22:56. Welcome to the world of parenting. American Academy of Pediatrics. http://patiented.solutions.aap. ... policy Advertising and sponsorship opportunities Reprint Permissions A single copy of these materials may be reprinted for ...

  5. Crying Baby? How to Keep Your Cool

    Science.gov (United States)

    ... Sept. 4, 2015. Welcome to the world of parenting! American Academy of Pediatrics. http://patiented.solutions.aap. ... policy Advertising and sponsorship opportunities Reprint Permissions A single copy of these materials may be reprinted for ...

  6. Corrected Age for Preemies

    Science.gov (United States)

    ... Spread the Word Shop AAP Find a Pediatrician Ages & Stages Prenatal Baby Bathing & Skin Care Breastfeeding Crying & ... Listen Español Text Size Email Print Share Corrected Age For Preemies Page Content Article Body If your ...

  7. Ages and Stages: Teen

    Science.gov (United States)

    ... Spread the Word Shop AAP Find a Pediatrician Ages & Stages Prenatal Baby Toddler Preschool Gradeschool Teen Dating & ... Safety School Substance Abuse Young Adult Healthy Children > Ages & Stages > Teen Teen Article Body Adolescence can be ...

  8. SAJP 589.indd

    African Journals Online (AJOL)

    ORs favoured CBT compared with lithium, TCAs, AAPs, AEDs and buspirone. ... Bipolar depression was not focused on in this review. Data extraction ..... depressive disorder: A literature review and a proposal for a novel approach to improve.

  9. Poison Prevention

    Science.gov (United States)

    ... the Word Shop AAP Find a Pediatrician Safety & Prevention Immunizations All Around At Home At Play On ... Listen Español Text Size Email Print Share Poison Prevention Page Content Article Body Post the Poison Help ...

  10. Rapid determination of total phenols in seawater by 4-aminoantipyrine colorimetry

    Digital Repository Service at National Institute of Oceanography (India)

    Kadam, A.N; Bhangale, V.P.

    A rapid and efficient 4-aminoantipyrine (4-AAP) colorimetric method without any cleanup step to determine total phenols in seawater is described. Efficiency of the method for seawater using external addition of phenol concentrations with working...

  11. Rubella: Questions and Answers

    Science.gov (United States)

    ... diseases, regardless of birth date. Who recommends this vaccine? The Centers for Disease Control and Prevention (CDC), the American Academy of Pediatrics (AAP), the American Academy of Family Physicians (AAFP), ...

  12. Haemophilus Influenzae Type B (Hib): Questions and Answers

    Science.gov (United States)

    ... continued) page 3 of 3 Who recommends this vaccine? The Centers for Disease Control and Prevention (CDC), the American Academy of Pediatrics (AAP), and the American Academy of Family Physicians ( ...

  13. Improving Family Communications

    Science.gov (United States)

    ... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Listen Español Text Size Email Print Share Improving Family Communications Page Content Article Body How can I ...

  14. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  15. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  16. Family Arguments

    Science.gov (United States)

    ... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Life Listen Español Text Size Email Print Share Family Arguments Page Content Article Body We seem to ...

  17. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  18. Normal Functioning Family

    Science.gov (United States)

    ... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Español Text Size Email Print Share Normal Functioning Family Page Content Article Body Is there any way ...

  19. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  20. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... Tos Ferina AAP CME ask your doctor brochure family stories faq meet dr. gary freed meet keri ... media video/audio pneumonia tb overview links & resources families advocacy about civil rights kids' rights sample school ...

  1. Myth of the Perfect Family

    Science.gov (United States)

    ... Spread the Word Shop AAP Find a Pediatrician Family Life Medical Home Family Dynamics Adoption & Foster Care ... Español Text Size Email Print Share The "Perfect" Family Page Content Article Body Is there such a ...

  2. Evaluation of Prevalence, Homology and Immunogenicity of Dispersin among Enteroaggregative Escherichia coli Isolates from Iran

    OpenAIRE

    Karam, Mohammad Reza Asadi; Rezaei, Ali Akbar; Siadat, Seyed Davar; Habibi, Mehri; Bouzari, Saeid

    2017-01-01

    Background: Diarrhea, caused by enteroaggregative Escherichia coli (EAEC), is an important infection leading toillness and death. Numerous virulent factors have been described in EAEC. However, their prevalence was highly variable among EAECs of distinct geographic locations. Studies have shown that dispersin (antiaggregation protein, aap) is one of the important and abundant virulent factors in EAEC. In this study, we aimed to determine the presence, conservation, and immunogenicity of aap g...

  3. Marine Corps Systems Command (MCSC) Program Executive Officer Land Systems (PEO LS) 2010 Advanced Planning Briefing to Industry (APBI) (BRIEFING CHARTS)

    Science.gov (United States)

    2010-04-07

    Upgrades MRC BFT – JCR JBC-P 21 Strategic Goal By 2025...LCMR (AAP) TPS (AAP) AFATDS (II-A) BUCS MTS BFSA D-DACT (IVT) C2CE BFT FoS (tbd) BFT BFT II JCR KGV-72 MRC JBC-P (NA-A) CTN (III) JSS (III-AF) MACCS...JC2 COC Model F COC CAPSET I C2 Airborne MRC BFT – JCR

  4. Protective effects of an ethanol extract of Angelica keiskei against acetaminophen-induced hepatotoxicity in HepG2 and HepaRG cells

    Science.gov (United States)

    Choi, Yoon-Hee; Lee, Hyun Sook; Chung, Cha-Kwon

    2017-01-01

    BACKGROUND/OBJECTIVE Although Angelica keiskei (AK) has widely been utilized for the purpose of general health improvement among Asian, its functionality and mechanism of action. The aim of this study was to determine the protective effect of ethanol extract of AK (AK-Ex) on acute hepatotoxicity induced by acetaminophen (AAP) in HepG2 human hepatocellular liver carcinoma cells and HepaRG human hepatic progenitor cells. MATERIALS/METHODS AK-Ex was prepared HepG2 and HepaRG cells were cultured with various concentrations and 30 mM AAP. The protective effects of AK-Ex against AAP-induced hepatotoxicity in HepG2 and HepaRG cells were evaluated using 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide, lactate dehydrogenase (LDH) assay, flow cytometry, and Western blotting. RESULTS AK-Ex, when administered prior to AAP, increased cell growth and decreased leakage of LDH in a dose-dependent manner in HepG2 and HepaRG cells against AAP-induced hepatotoxicity. AK-Ex increased the level of Bcl-2 and decreased the levels of Bax, Bok and Bik decreased the permeability of the mitochondrial membrane in HepG2 cells intoxicated with AAP. AK-Ex decreased the cleavage of poly (ADP-ribose) polymerase (PARP) and the activation of caspase-9, -7, and -3. CONCLUSIONS These results demonstrate that AK-Ex downregulates apoptosis via intrinsic and extrinsic pathways against AAP-induced hepatotoxicity. We suggest that AK could be a useful preventive agent against AAP-induced apoptosis in hepatocytes. PMID:28386382

  5. The combination effects of acetaminophen and N-acetylcysteine on cytokines production and NF-κB activation of lipopolysaccharide-challenged piglet mononuclear phagocytes in vitro and in vivo.

    Science.gov (United States)

    Qiu, Yinsheng; Zhang, Jiawei; Liu, Yu; Ma, Hongwei; Cao, Fangyuan; Xu, Jun; Hou, Yongqing; Xu, Lingyun

    2013-04-15

    Lipopolysaccharide (LPS) is a known activator of mononuclear phagocytes. LPS activates the pro-inflammatory gene expression and induces the release of mediators/cytokines by TLR4-NF-κB signaling pathway. The purpose of this study was to investigate the effects of acetaminophen (AAP) and N-acetylcysteine (NAC), individually as well as in combination on LPS-induced cytokines production and NF-κB activation in piglets. AAP (0.125-1.0mM) and NAC (0.0625-1.0mM) down-regulate the expression of cytokines and inhibit NF-κB p65 protein transfer from the cytoplasm to the nucleus in vitro. NAC enhances the inhibition action of AAP on cytokines expression in vitro. IL-6 in piglet plasma of the AAP group (mixed feed concentration of 600 mg/kg) was significantly reduced (Ppiglet plasma of the NAC group (mixed feeding concentration of 1200 mg/kg) were significantly lower at 3h after LPS stimulation (Ppiglet plasma of AAP (mixed feed concentration of 600 mg/kg) plus NAC (mixed feeding concentration of 1200 mg/kg) group were significantly lower (P<0.05) at 3h after LPS activation. The level of IL-10 in the group with AAP plus NAC was significantly lower (P<0.05) at 24h after LPS stimulation, while the rest of the inflammatory cytokines were returned to the original levels. The NF-κB p65 concentration ratio had significantly reduced (P<0.05) when AAP and NAC were used in combination. In summary, NAC could enhance the anti-inflammatory effects of AAP both in vitro and in vivo.

  6. Atypical Antipsychotics and the Risk of Hyperlipidemia: A Sequence Symmetry Analysis.

    Science.gov (United States)

    Takeuchi, Yoshinori; Kajiyama, Kazuhiro; Ishiguro, Chieko; Uyama, Yoshiaki

    2015-07-01

    Although hyperlipidemia is a well known adverse event of atypical antipsychotic (AAP) medication, there are few studies that have quantitatively compared the risks of various AAPs. Our aim was to comparatively evaluate the risk of hyperlipidemia associated with the use of AAPs approved in Japan through a consecutive epidemiological study. We conducted a sequence symmetry analysis (SSA) using health insurance claims data to analyze the following nine AAPs approved for use in Japan: risperidone, paliperidone, perospirone hydrochloride hydrate, blonanserin, clozapine, olanzapine, quetiapine fumarate, aripiprazole, and zotepine. Exposed cases were identified from drug dispensing records as those who had been administered both AAPs and antihyperlipidemic drugs. The adjusted sequence ratio (ASR) and 95 % confidence interval (CI) for each individual AAP and for all AAPs were calculated while controlling for time trends in dispensing patterns. Olanzapine was significantly associated with increased hyperlipidemia occurrence (ASR 1.56; 95 % CI 1.25-1.95). The ASRs obtained for risperidone (1.01; 95 % CI 0.80-1.27), perospirone hydrochloride hydrate (0.93; 95 % CI 0.63-1.39), blonanserin (0.83; 95 % CI 0.52-1.33), quetiapine fumarate (0.93; 95 % CI 0.73-1.18), and aripiprazole (1.02; 95 % CI 0.82-1.26) were approximately 1.0. Unstable estimates (wide CIs) were obtained for paliperidone and zotepine due to the small sample sizes. Among the AAPs used in Japan, only olanzapine was found to have an elevated risk of hyperlipidemia. In contrast, risperidone, perospirone hydrochloride hydrate, blonanserin, quetiapine fumarate, and aripiprazole had relatively low risks.

  7. Group Technology Assessment: U.S. Army Materiel Command.

    Science.gov (United States)

    1985-01-01

    63120 Army Ammunition Plants: Cdr, Crane AAA, Attn: SMCCN-CO, Crane, IN 47522 Cdr, Hawthorne AAP, Attn: SMCHW-CO, Hawthorne , NV 89415 Cdr, Iowa AAP...5 INDIVIDUALS INTERVIEWED DURING ON-SITE VISITS Name/Title Organization/Location Mr. Nathaniel Scott AMCCOM-ARDC Industrial Engineer Dover, New Jersey...Rock Island, Illinois 61299 Commander U.S. Army Armament Munitions & Chemical Command Attn: AMSMC-CG (D) 0 Dover, New Jersey 07801 Mr. Nathaniel Scott

  8. NCBI nr-aa BLAST: CBRC-MEUG-01-1882 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1882 gb|AAP88735.1| MCM2 minichromosome maintenance deficient 2, mitot...in (S. cerevisiae) [synthetic construct] gb|AAX29736.1| MCM2 minichromosome maintenance deficient 2 [synthet...ic construct] gb|AAX29737.1| MCM2 minichromosome maintenance deficient 2 [synthetic construct] AAP88735.1 0.0 95% ...

  9. Abundance and genetic diversity of aerobic anoxygenic phototrophic bacteria of coastal regions of the pacific ocean.

    Science.gov (United States)

    Ritchie, Anna E; Johnson, Zackary I

    2012-04-01

    Aerobic anoxygenic phototrophic (AAP) bacteria are photoheterotrophic microbes that are found in a broad range of aquatic environments. Although potentially significant to the microbial ecology and biogeochemistry of marine ecosystems, their abundance and genetic diversity and the environmental variables that regulate these properties are poorly understood. Using samples along nearshore/offshore transects from five disparate islands in the Pacific Ocean (Oahu, Molokai, Futuna, Aniwa, and Lord Howe) and off California, we show that AAP bacteria, as quantified by the pufM gene biomarker, are most abundant near shore and in areas with high chlorophyll or Synechococcus abundance. These AAP bacterial populations are genetically diverse, with most members belonging to the alpha- or gammaproteobacterial groups and with subclades that are associated with specific environmental variables. The genetic diversity of AAP bacteria is structured along the nearshore/offshore transects in relation to environmental variables, and uncultured pufM gene libraries suggest that nearshore communities are distinct from those offshore. AAP bacterial communities are also genetically distinct between islands, such that the stations that are most distantly separated are the most genetically distinct. Together, these results demonstrate that environmental variables regulate both the abundance and diversity of AAP bacteria but that endemism may also be a contributing factor in structuring these communities.

  10. Determination of 2-Aminoacetophenone in wine by high-performance thin-layer chromatography-fluorescence detection.

    Science.gov (United States)

    Horlacher, Nora; Schwack, Wolfgang

    2016-02-05

    2-Aminoacetophenone (AAP) is closely correlated with the appearance of the sensory phenomenon of UTA ("untypical aging off-flavor") in wine. AAP analyses are generally performed by gas chromatography and mass selective detection (GC/MS), when AAP is extracted from wines by liquid-liquid, solid-liquid or solid phase microextraction. Here we present a rapid, selective and sensitive method for the determination of AAP in wine by high-performance thin-layer chromatography with fluorescence detection (HPTLC-FLD). As internal standard, 2-amino-4-methoxyacetophenone was used. Liquid-liquid extraction with t-butyl methyl ether was followed by a basic cleanup of the extracts, which were applied onto HPTLC amino plates developed with methylene chloride/toluene (7+3, v/v) as mobile phase. Dipping the dried plate into hexane-paraffin solution enhanced fluorescence that was scanned at 366/>400nm. Limits of detection and quantitation were determined to be 0.1 and 0.3μgL(-1) wine, respectively, while only AAP concentrations >0.5μgL(-1) result in UTA. Recoveries were near 100% for model, white, rosé and red wines. Thus, the HPTLC-FLD method enables the analysis of AAP in wines clearly below the odor thresholds and represents a rapid and convenient screening alternative to existing GC/MS methods. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Altered xylem-phloem transfer of amino acids affects metabolism and leads to increased seed yield and oil content in Arabidopsis.

    Science.gov (United States)

    Zhang, Lizhi; Tan, Qiumin; Lee, Raymond; Trethewy, Alexander; Lee, Yong-Hwa; Tegeder, Mechthild

    2010-11-01

    Seed development and nitrogen (N) storage depend on delivery of amino acids to seed sinks. For efficient translocation to seeds, amino acids are loaded into the phloem in source leaves and along the long distance transport pathway through xylem-phloem transfer. We demonstrate that Arabidopsis thaliana AMINO ACID PERMEASE2 (AAP2) localizes to the phloem throughout the plant. AAP2 T-DNA insertion lines showed changes in source-sink translocation of amino acids and a decrease in the amount of seed total N and storage proteins, supporting AAP2 function in phloem loading and amino acid distribution to the embryo. Interestingly, in aap2 seeds, total carbon (C) levels were unchanged, while fatty acid levels were elevated. Moreover, branch and silique numbers per plant and seed yield were strongly increased. This suggests changes in N and C delivery to sinks and subsequent modulations of sink development and seed metabolism. This is supported by tracer experiments, expression studies of genes of N/C transport and metabolism in source and sink, and by phenotypic and metabolite analyses of aap2 plants. Thus, AAP2 is key for xylem to phloem transfer and sink N and C supply; moreover, modifications of N allocation can positively affect C assimilation and source-sink transport and benefit sink development and oil yield.

  12. Altered Xylem-Phloem Transfer of Amino Acids Affects Metabolism and Leads to Increased Seed Yield and Oil Content in Arabidopsis[W

    Science.gov (United States)

    Zhang, Lizhi; Tan, Qiumin; Lee, Raymond; Trethewy, Alexander; Lee, Yong-Hwa; Tegeder, Mechthild

    2010-01-01

    Seed development and nitrogen (N) storage depend on delivery of amino acids to seed sinks. For efficient translocation to seeds, amino acids are loaded into the phloem in source leaves and along the long distance transport pathway through xylem-phloem transfer. We demonstrate that Arabidopsis thaliana AMINO ACID PERMEASE2 (AAP2) localizes to the phloem throughout the plant. AAP2 T-DNA insertion lines showed changes in source-sink translocation of amino acids and a decrease in the amount of seed total N and storage proteins, supporting AAP2 function in phloem loading and amino acid distribution to the embryo. Interestingly, in aap2 seeds, total carbon (C) levels were unchanged, while fatty acid levels were elevated. Moreover, branch and silique numbers per plant and seed yield were strongly increased. This suggests changes in N and C delivery to sinks and subsequent modulations of sink development and seed metabolism. This is supported by tracer experiments, expression studies of genes of N/C transport and metabolism in source and sink, and by phenotypic and metabolite analyses of aap2 plants. Thus, AAP2 is key for xylem to phloem transfer and sink N and C supply; moreover, modifications of N allocation can positively affect C assimilation and source-sink transport and benefit sink development and oil yield. PMID:21075769

  13. Acute ethanol and taurine intake affect absolute alpha power in frontal cortex before and after exercise.

    Science.gov (United States)

    Paulucio, Dailson; da Costa, Bruno M; Santos, Caleb G; Velasques, Bruna; Ribeiro, Pedro; Gongora, Mariana; Cagy, Mauricio; Alvarenga, Renato L; Pompeu, Fernando A M S

    2017-09-14

    Taurine and alcohol has been popularly ingested through energy drinks. Reports from both compounds shows they are active on nervous system but little is known about the acute effect of these substances on the frontal cortex in an exercise approach. The aim of this study was to determine the effects of 0,6mldL(-1) of ethanol (ET), 6g of taurine (TA), and taurine with ethanol (TA+ET) intake on absolute alpha power (AAP) in the frontal region, before and after exercise. Nine participants were recruited, five women (22±3years) and four men (26±5years), for a counterbalanced experimental design. For each treatment, the tests were performed considering three moments: "baseline", "peak" and "post-exercise". In the placebo treatment (PL), the frontal areas showed AAP decrease at the post-exercise. However, in the TA, AAP decreased at peak and increased at post-exercise. In the ET treatment, AAP increased at the peak moment for the left frontal electrodes. In the TA+ET treatment, an AAP increase was observed at peak, and it continued after exercise ended. These substances were able to produce electrocortical activity changes in the frontal regions after a short duration and low intensity exercise. Left and right regions showed different AAP dynamics during peak and post-exercise moments when treatments were compared. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Immunoproteomics of tree of heaven (Ailanthus atltissima) pollen allergens.

    Science.gov (United States)

    Mousavi, Fateme; Majd, Ahmad; Shahali, Youcef; Ghahremaninejad, Farrokh; Shokouhi Shoormasti, Raheleh; Pourpak, Zahra

    2017-02-10

    Ailanthus altissima pollen (AAP) is considered as an emerging cause of respiratory allergy in United States, Italy and Iran. However, the allergenic composition of AAP is still unknown and has yet to be characterized. The present study aimed to identify AAP allergens using a proteomics-based approach. For this purpose, optimized AAP protein extracts were analyzed using 1D- and 2D- gel electrophoresis and confronted to twenty sera from individuals with respiratory allergy during the AAP season. Candidate allergens were detected using the serum from an allergic patient with clinical history of AAP pollinosis. IgE-binding spots were identified using MALDI-TOF/TOF mass spectrometry and database searching. According to our results, AAP extracts were rich in proteins (up to 16.25mg/ml) with a molecular-weight distribution ranging from 10 to 175kDa. Two-D electrophoresis of AAP extracts revealed 125 protein spots from which 13 were IgE reactive. These IgE-binding proteins were identified as enolase, calreticulin, probable pectate lyase 6, conserved hypothetical protein and ras-related protein RHN1-like. By our knowledge, this study is the first report identifying AAP allergens. These findings will open up further avenues for the diagnosis and immunotherapy of the AAP allergy as well as for the cloning and molecular characterization of relevant allergens. Ailanthus altissima colonizes new areas every year in Iran and is spreading aggressively worldwide. According to USDA, the tree of heaven is now present as an invasive plant in 30 states in US (www.invasivespeciesinfo.gov/plants/treeheaven.shtml) and come to dominate large areas in many regions. Up to now, several cases of allergy to A. altissima pollen have been reported in United States, Italy and Iran [1-4]. However, there is still no information on the sensitizing allergens and the molecular origin of these clinical symptoms, which constitutes a serious threat to patients suffering from respiratory allergies in these

  15. Korean Medication Algorithm Project for Bipolar Disorder: third revision

    Directory of Open Access Journals (Sweden)

    Woo YS

    2015-02-01

    Full Text Available Young Sup Woo,1 Jung Goo Lee,2,3 Jong-Hyun Jeong,1 Moon-Doo Kim,4 Inki Sohn,5 Se-Hoon Shim,6 Duk-In Jon,7 Jeong Seok Seo,8 Young-Chul Shin,9 Kyung Joon Min,10 Bo-Hyun Yoon,11 Won-Myong Bahk1 1Department of Psychiatry, College of Medicine, The Catholic University of Korea, Seoul, South Korea; 2Department of Psychiatry, Inje University Haeundae Paik Hospital, Busan, South Korea;3Paik Institute for Clinical Research, Inje Univeristy, Busan, South Korea; 4Department of Psychiatry, Jeju National University Hospital, Jeju, South Korea; 5Department of Psychiatry, Keyo Hospital, Keyo Medical Foundation, Uiwang, South Korea; 6Department of Psychiatry, Soonchunhyang University Cheonan Hospital, Soonchunhyang University, Cheonan, South Korea; 7Department of Psychiatry, Sacred Heart Hospital, Hallym University, Anyang, South Korea; 8Department of Psychiatry, School of Medicine, Konkuk University, Chungju, South Korea; 9Department of Psychiatry, Kangbuk Samsung Hospital, School of Medicine, Sungkyunkwan University, Seoul, South Korea; 10Department of Psychiatry, College of Medicine, Chung-Ang University, Seoul, South Korea; 11Department of Psychiatry, Naju National Hospital, Naju, South Korea Objective: To constitute the third revision of the guidelines for the treatment of bipolar disorder issued by the Korean Medication Algorithm Project for Bipolar Disorder (KMAP-BP 2014. Methods: A 56-item questionnaire was used to obtain the consensus of experts regarding pharmacological treatment strategies for the various phases of bipolar disorder and for special populations. The review committee included 110 Korean psychiatrists and 38 experts for child and adolescent psychiatry. Of the committee members, 64 general psychiatrists and 23 child and adolescent psychiatrists responded to the survey. Results: The treatment of choice (TOC for euphoric, mixed, and psychotic mania was the combination of a mood stabilizer (MS and an atypical antipsychotic (AAP; the TOC for

  16. Improving the quality of care for children with wheeze: The use of electronic asthma action plans and electronic pre-school wheeze action plans.

    Science.gov (United States)

    O'Leary, Fenton; Pegiazoglou, Ioannis; Marshall, Tracey; Thosar, Deepali; Deck, Mitchell; Peat, Jennifer; Ging, Joanna; Selvadurai, Hiran

    2016-09-01

    To measure the long-term improvement in the documented provision of an asthma action plan (AAP) to children with asthma and wheeze discharged from the Emergency Department following the introduction of the electronic AAP (eAAP) and to determine the need for an electronic pre-school wheeze action plan in our population. A retrospective case note review, from July 2014 to June 2015, of all patients over 12 months old discharged from the Emergency Department or Emergency Medical Unit, with a discharge diagnosis of either asthma or wheeze. The primary outcome was the documentation of an AAP, either recorded electronically as an eAAP or a report of an AAP as part of the patient medical record. Two thousand three hundred and forty-two patients were included in the study, 926 with asthma and 1416 with wheeze. The median age was 3.3 years (interquartile range (IQR) 3.5, range 1-15.9 years). The median age of the children with asthma was 5.3 years (IQR 4.6) and of the children with wheeze was 2.5 years (IQR 2.0).Overall, 1683 (71.9%) children had a documented AAP, with a significant difference between those with a discharge diagnosis of asthma (85.9%) compared with wheeze (62.9%), P children with a discharge diagnosis of asthma. Children with a discharge diagnosis of wheeze are significantly less likely to receive an action plan. © 2016 The Authors. Journal of Paediatrics and Child Health published by John Wiley & Sons Australia, Ltd on behalf of Paediatrics and Child Health Division (The Royal Australasian College of Physicians).

  17. Diversity of cultivated and metabolically active aerobic anoxygenic phototrophic bacteria along an oligotrophic gradient in the Mediterranean Sea

    Science.gov (United States)

    Jeanthon, C.; Boeuf, D.; Dahan, O.; Le Gall, F.; Garczarek, L.; Bendif, E. M.; Lehours, A.-C.

    2011-07-01

    Aerobic anoxygenic phototrophic (AAP) bacteria play significant roles in the bacterioplankton productivity and biogeochemical cycles of the surface ocean. In this study, we applied both cultivation and mRNA-based molecular methods to explore the diversity of AAP bacteria along an oligotrophic gradient in the Mediterranean Sea in early summer 2008. Colony-forming units obtained on three different agar media were screened for the production of bacteriochlorophyll-a (BChl-a), the light-harvesting pigment of AAP bacteria. BChl-a-containing colonies represented a low part of the cultivable fraction. In total, 54 AAP strains were isolated and the phylogenetic analyses based on their 16S rRNA and pufM genes showed that they were all affiliated to the Alphaproteobacteria. The most frequently isolated strains belonged to Citromicrobium bathyomarinum, and Erythrobacter and Roseovarius species. Most other isolates were related to species not reported to produce BChl-a and/or may represent novel taxa. Direct extraction of RNA from seawater samples enabled the analysis of the expression of pufM, the gene coding for the M subunit of the reaction centre complex of aerobic anoxygenic photosynthesis. Clone libraries of pufM gene transcripts revealed that most phylotypes were highly similar to sequences previously recovered from the Mediterranean Sea and a large majority (~94 %) was affiliated to the Gammaproteobacteria. The most abundantly detected phylotypes occurred in the western and eastern Mediterranean basins. However, some were exclusively detected in the eastern basin, reflecting the highest diversity of pufM transcripts observed in this ultra-oligotrophic region. To our knowledge, this is the first study to document extensively the diversity of AAP isolates and to unveil the active AAP community in an oligotrophic marine environment. By pointing out the discrepancies between culture-based and molecular methods, this study highlights the existing gaps in the understanding

  18. Association between Ghrelin gene (GHRL polymorphisms and clinical response to atypical antipsychotic drugs in Han Chinese schizophrenia patients

    Directory of Open Access Journals (Sweden)

    Yang Yongfeng

    2012-02-01

    Full Text Available Abstract Background Ghrelin (GHRL is a pivotal peptide regulator of food intake, energy balance, and body mass. Weight gain (WG is a common side effect of the atypical antipsychotics (AAPs used to treat schizophrenia (SZ. Ghrelin polymorphisms have been associated with pathogenic variations in plasma lipid concentrations, blood pressure, plasma glucose, and body mass index (BMI. However, it is unclear whether GHRL polymorphisms are associated with WG due to AAPs. Furthermore, there is no evidence of an association between GHRL polymorphisms and SZ or the therapeutic response to AAPs. We explored these potential associations by genotyping GHRL alleles in SZ patients and controls. We also examined the relation between these SNPs and changes in metabolic indices during AAP treatment in SZ subgroups distinguished by high or low therapeutic response. Methods Four SNPs (Leu72Met, -501A/C, -604 G/A, and -1062 G > C were genotyped in 634 schizophrenia patients and 606 control subjects. Results There were no significant differences in allele frequencies, genotype distributions, or the distributions of two SNP haplotypes between SZ patients and healthy controls (P > 0.05. There was also no significant difference in symptom reduction between genotypes after 8 weeks of AAP treatment as measured by positive and negative symptom scale scores (PANSS. However, the -604 G/A polymorphism was associated with a greater BMI increase in response to AAP administration in both APP responders and non-responders as distinguished by PANSS score reduction (P P Conclusions These four GHRL gene SNPs were not associated with SZ in this Chinese Han population. The -604 G/A polymorphism was associated with significant BW and BMI increases during AAP treatment. Patients exhibiting higher WG showed greater improvements in positive and negative symptoms than patients exhibiting lower weight gain or weight loss.

  19. Advanced Avionics and Processor Systems for a Flexible Space Exploration Architecture

    Science.gov (United States)

    Keys, Andrew S.; Adams, James H.; Smith, Leigh M.; Johnson, Michael A.; Cressler, John D.

    2010-01-01

    The Advanced Avionics and Processor Systems (AAPS) project, formerly known as the Radiation Hardened Electronics for Space Environments (RHESE) project, endeavors to develop advanced avionic and processor technologies anticipated to be used by NASA s currently evolving space exploration architectures. The AAPS project is a part of the Exploration Technology Development Program, which funds an entire suite of technologies that are aimed at enabling NASA s ability to explore beyond low earth orbit. NASA s Marshall Space Flight Center (MSFC) manages the AAPS project. AAPS uses a broad-scoped approach to developing avionic and processor systems. Investment areas include advanced electronic designs and technologies capable of providing environmental hardness, reconfigurable computing techniques, software tools for radiation effects assessment, and radiation environment modeling tools. Near-term emphasis within the multiple AAPS tasks focuses on developing prototype components using semiconductor processes and materials (such as Silicon-Germanium (SiGe)) to enhance a device s tolerance to radiation events and low temperature environments. As the SiGe technology will culminate in a delivered prototype this fiscal year, the project emphasis shifts its focus to developing low-power, high efficiency total processor hardening techniques. In addition to processor development, the project endeavors to demonstrate techniques applicable to reconfigurable computing and partially reconfigurable Field Programmable Gate Arrays (FPGAs). This capability enables avionic architectures the ability to develop FPGA-based, radiation tolerant processor boards that can serve in multiple physical locations throughout the spacecraft and perform multiple functions during the course of the mission. The individual tasks that comprise AAPS are diverse, yet united in the common endeavor to develop electronics capable of operating within the harsh environment of space. Specifically, the AAPS tasks for

  20. Diversity of the aerobic anoxygenic phototrophy genepufM in Arctic and Antarctic coastal seawaters

    Institute of Scientific and Technical Information of China (English)

    ZENG Yinxin; DONG Peiyan; QIAO Zongyun; ZHENG Tianling

    2016-01-01

    Aerobic anoxygenic phototrophic (AAP) bacteria serve important functions in marine carbon and energy cycling because of their capability to utilize dissolved organic substrates and harvest light energy. AAP bacteria are widely distributed in marine environments, and their diversity has been examined in marine habitats. However, information about AAP bacteria at high latitudes remains insufficient to date. Therefore, this study determined the summer AAP bacterial diversity in Arctic Kongsfjorden and in the Antarctic coastal seawater of King George Island on the basis ofpufM, a gene that encodes a pigment-binding protein subunit of the reaction center complex. FourpufM clone libraries were constructed, and 674 positive clones were obtained from four investigated stations (two in Kongsfjorden and two in the Antarctic Maxwell Bay). Arctic clones were clustered within theAlphaproteobacteria, whereas Antarctic clones were classified into theAlphaproteobacteria and Betaproteobacteria classes.Rhodobacteraceae-likepufM genes dominated in all samples. In addition, sequences closely related topufM encoded on a plasmid inSulfitobacter guttiformis were predominant in both Arctic and Antarctic samples. This result indicates the transpolar or even global distribution ofpufM genes in marine environments. Meanwhile, differences between the Arctic and Antarctic sequences may prove polar endemism. These results indicate the important role ofRhodobacteraceae as AAP bacteria in bipolar coastal waters.

  1. Ssh4, Rcr2 and Rcr1 affect plasma membrane transporter activity in Saccharomyces cerevisiae.

    Science.gov (United States)

    Kota, Jhansi; Melin-Larsson, Monika; Ljungdahl, Per O; Forsberg, Hanna

    2007-04-01

    Nutrient uptake in the yeast Saccharomyces cerevisiae is a highly regulated process. Cells adjust levels of nutrient transporters within the plasma membrane at multiple stages of the secretory and endosomal pathways. In the absence of the ER-membrane-localized chaperone Shr3, amino acid permeases (AAP) inefficiently fold and are largely retained in the ER. Consequently, shr3 null mutants exhibit greatly reduced rates of amino acid uptake due to lower levels of AAPs in their plasma membranes. To further our understanding of mechanisms affecting AAP localization, we identified SSH4 and RCR2 as high-copy suppressors of shr3 null mutations. The overexpression of SSH4, RCR2, or the RCR2 homolog RCR1 increases steady-state AAP levels, whereas the genetic inactivation of these genes reduces steady-state AAP levels. Additionally, the overexpression of any of these suppressor genes exerts a positive effect on phosphate and uracil uptake systems. Ssh4 and Rcr2 primarily localize to structures associated with the vacuole; however, Rcr2 also localizes to endosome-like vesicles. Our findings are consistent with a model in which Ssh4, Rcr2, and presumably Rcr1, function within the endosome-vacuole trafficking pathway, where they affect events that determine whether plasma membrane proteins are degraded or routed to the plasma membrane.

  2. Novel Spectrophotometric Method for Determination of Macro-paracetamol via Reaction with Bromine

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    The reaction between Br2 and paracetamol(p-AAP) leads to the formation of a coloured product, which can be used for spectrophotometric determination of the p-AAP content in its pure form and in different pharmaceutical preparations with p-AAP. The stoichiometric composition of the reaction was found to be n(p-AAP)∶n(bromine)=1∶3. The effects of pH and time on the spectra of p-AAP-bromine redox reaction product were studied. The interference of different additives on the measured spectra of the obtained product was also studied. The results obtained by the present method were compared with those obtained by the standard method. The F- and t- test values were calculated for both of the applied procedures and they met a confidence level of 99%. The proposed procedure actually needs no separation of these drugs from their sources before analysis and was unaffected by interference of other phenolic compounds. The proposed method is simpler and faster than the repoeted ones.

  3. Photoheterotrophic microbes in the Arctic Ocean in summer and winter.

    Science.gov (United States)

    Cottrell, Matthew T; Kirchman, David L

    2009-08-01

    Photoheterotrophic microbes, which are capable of utilizing dissolved organic materials and harvesting light energy, include coccoid cyanobacteria (Synechococcus and Prochlorococcus), aerobic anoxygenic phototrophic (AAP) bacteria, and proteorhodopsin (PR)-containing bacteria. Our knowledge of photoheterotrophic microbes is largely incomplete, especially for high-latitude waters such as the Arctic Ocean, where photoheterotrophs may have special ecological relationships and distinct biogeochemical impacts due to extremes in day length and seasonal ice cover. These microbes were examined by epifluorescence microscopy, flow cytometry, and quantitative PCR (QPCR) assays for PR and a gene diagnostic of AAP bacteria (pufM). The abundance of AAP bacteria and PR-containing bacteria decreased from summer to winter, in parallel with a threefold decrease in the total prokaryotic community. In contrast, the abundance of Synechococcus organisms did not decrease in winter, suggesting that their growth was supported by organic substrates. Results from QPCR assays revealed no substantial shifts in the community structure of AAP bacteria and PR-containing bacteria. However, Arctic PR genes were different from those found at lower latitudes, and surprisingly, they were not similar to those in Antarctic coastal waters. Photoheterotrophic microbes appear to compete successfully with strict heterotrophs during winter darkness below the ice, but AAP bacteria and PR-containing bacteria do not behave as superior competitors during the summer.

  4. Phylogenetically Diverse Aerobic Anoxygenic Phototrophic Bacteria Isolated from Epilithic Biofilms in Tama River, Japan

    Science.gov (United States)

    Hirose, Setsuko; Matsuura, Katsumi; Haruta, Shin

    2016-01-01

    The diversity of aerobic anoxygenic phototrophic (AAP) bacteria in freshwater environments, particularly in rivers, has not been examined in as much detail as in ocean environments. In the present study, we investigated the phylogenetic and physiological diversities of AAP bacteria in biofilms that developed on submerged stones in a freshwater river using culture methods. The biofilms collected were homogenized and inoculated on solid media and incubated aerobically in the dark. Sixty-eight red-, pink-, yellow-, orange-, or brown-colored colonies were isolated, and, of these, 28 isolates contained the photosynthetic pigment, bacteriochlorophyll (BChl) a. Phylogenetic analyses based on 16S rRNA gene sequences showed that the isolates were classified into 14 groups in 8 operational taxonomic units (OTUs) and distributed in the orders Rhodospirillales, Rhodobacterales, and Sphingomonadales of Alphaproteobacteria and in Betaproteobacteria. Physiological analyses confirmed that none of the representative isolates from any of the groups grew under anaerobic phototrophic conditions. Seven isolates in 4 OTUs showed a 16S rRNA gene sequence identity of 98.0% or less with any established species, suggesting the presence of previously undescribed species of AAP bacteria. Six isolates in 2 other OTUs had the closest relatives, which have not been reported to be AAP bacteria. Physiological comparisons among the isolates revealed differences in preferences for nutrient concentrations, BChl contents, and light-harvesting proteins. These results suggest that diverse and previously unknown AAP bacteria inhabit river biofilms. PMID:27453124

  5. Blonanserin Augmentation of Atypical Antipsychotics in Patients with Schizophrenia-Who Benefits from Blonanserin Augmentation?: An Open-Label, Prospective, Multicenter Study.

    Science.gov (United States)

    Woo, Young Sup; Park, Joo Eon; Kim, Do-Hoon; Sohn, Inki; Hwang, Tae-Yeon; Park, Young-Min; Jon, Duk-In; Jeong, Jong-Hyun; Bahk, Won-Myong

    2016-07-01

    The purpose of this study was to investigate the efficacy and tolerability of atypical antipsychotics (AAPs) with augmentation by blonanserin in schizophrenic patients. aA total of 100 patients with schizophrenia who were partially or completely unresponsive to treatment with an AAP were recruited in this 12-week, open-label, non-comparative, multicenter study. Blonanserin was added to their existing AAP regimen, which was maintained during the study period. Efficacy was primarily evaluated using the Positive and Negative Syndrome Scale (PANSS) at baseline and at weeks 2, 4, 8, and 12. Predictors for PANSS response (≥20% reduction) were investigated. The PANSS total score was significantly decreased at 12 weeks of blonanserin augmentation (-21.0±18.1, F=105.849, pblonanserin occurred in 17 patients (17.0%); 4 of these patients dropped out due to adverse events. The patients who benefited the most from blonanserin were those with severe symptoms despite a treatment with a higher dose of AAP. Blonanserin augmentation could be an effective strategy for patients with schizophrenia who were partially or completely unresponsive to treatment with an AAP.

  6. Atypical antipsychotics in the treatment of early-onset schizophrenia

    Directory of Open Access Journals (Sweden)

    Hrdlicka M

    2015-04-01

    Full Text Available Michal Hrdlicka, Iva Dudova Department of Child Psychiatry, Charles University Second Faculty of Medicine and University Hospital Motol, Prague, Czech Republic Abstract: Atypical antipsychotics (AAPs have been successfully used in early-onset schizophrenia (EOS. This review summarizes the randomized, double-blind, controlled studies of AAPs in EOS, including clozapine, risperidone, olanzapine, aripiprazole, paliperidone, quetiapine, and ziprasidone. No significant differences in efficacy between AAPs were found, with the exception of clozapine and ziprasidone. Clozapine demonstrated superior efficacy in treatment-resistant patients with EOS, whereas ziprasidone failed to demonstrate efficacy in the treatment of EOS. Our review also focuses on the onset of action and weight gain associated with AAPs. The data on onset of action of AAPs in pediatric psychiatry are scanty and inconsistent. Olanzapine appears to cause the most significant weight gain in patients with EOS, while ziprasidone and aripiprazole seem to cause the least. Keywords: early-onset schizophrenia, atypical antipsychotics, efficacy, onset of action, weight gain

  7. Comparative release studies on suppositories using the basket, paddle, dialysis tubing and flow-through cell methods I. Acetaminophen in a lipophilic base suppository.

    Science.gov (United States)

    Hori, Seiichi; Kawada, Tsubasa; Kogure, Sanae; Yabu, Shinako; Mori, Kenji; Akimoto, Masayuki

    2017-02-01

    The release characteristics of lipophilic suppositories containing acetaminophen (AAP) were examined using four types of dissolution methods: the basket, paddle, dialysis tubing (DT) and flow-through cell (FTC) methods. The suitability of each apparatus for quality control in AAP compounded suppositories was evaluated using statistical procedures. More than 80% of the drug was released over 60 min in all the release methods studied, with the exception of the basket method. Reproducible and faster release was achieved using the paddle method at 100 and 200 rpm, whereas poor release occurred with the basket method. The mean dissolution time (MDT), maximum dissolved quantity of AAP at the end of the sampling time (Q) and dissolution efficiency (DE) were calculated by model-independent methods. The FTC method with a single chamber used in this study was also appreciable for AAP suppositories (Q of 100%, MDT of 71-91 min and DE of 75-80%). The DT apparatus is considered similar to the FTC apparatus from a quality control perspective for judging the release properties of lipophilic base suppositories containing AAP. However, even the single chamber FTC used in this study has potential as an in vitro drug release test for suppositories. The comparative dissolution method is expected to become one of the valuable tools for selecting an adequate dissolution test.

  8. Nurses' Knowledge and Adherence To Sudden Infant Death Syndrome Prevention Guidelines.

    Science.gov (United States)

    Bartlow, Kendra L; Cartwright, Sara B; Shefferly, Erin K

    2016-01-01

    The American Academy of Pediatrics (AAP) defines standard guidelines for infant positioning and sleep environment to reduce the rate of sudden infant death syndrome (SIDS), but recent data on nurses' knowledge and adherence to these guidelines in hospital settings are limited. An observational, quantitative, and descriptive study was conducted on well-baby postpartum nurseries at two urban Washington, DC, hospitals. Sixty-six direct observations of infant position and crib environment were conducted, and a 17-question survey was administered to determine nurses' knowledge and practice regarding AAP SIDS prevention guidelines. Of observed sleeping conditions, 69.7% failed the guidelines for infant positioning, crib environment, or both, despite nurses' reporting knowledge of the AAP guidelines. Further research is needed to determine if the study's findings are consistent with hospitals elsewhere, and to better understand the disconnect between nurses' knowledge and behavior regarding SIDS prevention guidelines.

  9. Lawrence Berkeley Laboratory Affirmative Action Program. Revised

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    The Lawrence Berkeley Laboratory`s Affirmative Action Program (AAP) serves as a working document that describes current policies, practices, and results in the area of affirmative action. It represents the Laboratory`s framework for an affirmative approach to increasing the representation of people of color and women in segments of our work force where they have been underrepresented and taking action to increase the employment of persons with disabilities and special disabled and Vietnam era veterans. The AAP describes the hierarchy of responsibility for Laboratory affirmative action, the mechanisms that exist for full Laboratory participation in the AAP, the policies and procedures governing recruitment at all levels, the Laboratory`s plan for monitoring, reporting, and evaluating affirmative action progress, and a description of special affirmative action programs and plans the Laboratory has used and will use in its efforts to increase the representation and retention of groups historically underrepresented in our work force.

  10. Updated recommendations on the use of meningococcal vaccines.

    Science.gov (United States)

    2014-08-01

    Since the last policy statement from the American Academy of Pediatrics (AAP) concerning meningococcal vaccine was published in 2011, 2 meningococcal conjugate vaccines have been licensed for use in infants (Hib-MenCY-TT and MenACWY-CRM). The Centers for Disease Control and Prevention (CDC) has published new recommendations, "Prevention and Control of Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices," which have been endorsed by the AAP. However, the CDC recommendations were published before licensure of MenACWY-CRM for infant use. This policy statement updates the AAP recommendations for use of meningococcal vaccines in children and adolescents. A more comprehensive review of background and technical information can be found in the CDC publication. Copyright © 2014 by the American Academy of Pediatrics.

  11. Ambient air pollution epidemiology systematic review and meta-analysis: A review of reporting and methods practice.

    Science.gov (United States)

    Sheehan, Mary C; Lam, Juleen; Navas-Acien, Ana; Chang, Howard H

    2016-01-01

    Systematic review and meta-analysis (SRMA) are increasingly employed in environmental health (EH) epidemiology and, provided methods and reporting are sound, contribute to translating science evidence to policy. Ambient air pollution (AAP) is both among the leading environmental causes of mortality and morbidity worldwide, and of growing policy relevance due to health co-benefits associated with greenhouse gas emissions reductions. We reviewed the published AAP SRMA literature (2009 to mid-2015), and evaluated the consistency of methods, reporting and evidence evaluation using a 22-point questionnaire developed from available best-practice consensus guidelines and emerging recommendations for EH. Our goal was to contribute to enhancing the utility of AAP SRMAs to EH policy. We identified 43 studies that used both SR and MA techniques to examine associations between the AAPs PM2.5, PM10, NO2, SO2, CO and O3, and various health outcomes. On average AAP SRMAs partially or thoroughly addressed 16 of 22 questions (range 10-21), and thoroughly addressed 13 of 22 (range 5-19). We found evidence of an improving trend over the period. However, we observed some weaknesses, particularly infrequent formal reviews of underlying study quality and risk-of-bias that correlated with lower frequency of thorough evaluation for key study quality parameters. Several other areas for enhanced reporting are highlighted. The AAP SRMA literature, in particular more recent studies, indicate broad concordance with current and emerging best practice guidance. Development of an EH-specific SRMA consensus statement including a risk-of-bias evaluation tool, would be a contribution to enhanced reliability and robustness as well as policy utility. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Structural, thermal, morphological and biological studies of proton-transfer complexes formed from 4-aminoantipyrine with quinol and picric acid.

    Science.gov (United States)

    Adam, Abdel Majid A

    2013-03-01

    4-Aminoantipyrine (4AAP) is widely used in the pharmaceutical industry, biochemical experiments and environmental monitoring. However, residual amounts of 4AAP in the environment may pose a threat to human health. To provide basic data that can be used to extract or eliminate 4AAP from the environment, the proton-transfer complexes of 4AAP with quinol (QL) and picric acid (PA) were synthesized and spectroscopically investigated. The interactions afforded two new proton-transfer salts named 1,5-dimethyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-aminium-4-hydroxyphenolate and 1,5-dimethyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-aminium-2,4,6-trinitrophenolate for QL and PA, respectively, via a 1:1 stoichiometry. Elemental analysis (CHN), electronic absorption, spectrophotometric titration, IR, Raman, (1)H NMR and X-ray diffraction were used to characterize the new products. The thermal stability of the synthesized CT complexes was investigated using thermogravimetric (TG) analyses, and the morphology and particle size of these complexes were obtained from scanning electron microscopy (SEM). It was found that PA and 4AAP immediately formed a yellow precipitate with a remarkable sponge-like morphology and good thermal stability up to 180°C. Finally, the biological activities of the newly synthesized CT complexes were tested for their antibacterial and antifungal activities. The results indicated that the [(4AAP)(QL)] complex exhibited strong antimicrobial activities against various bacterial and fungal strains compared with standard drugs.

  13. Improved Anticancer Photothermal Therapy Using the Bystander Effect Enhanced by Antiarrhythmic Peptide Conjugated Dopamine-Modified Reduced Graphene Oxide Nanocomposite.

    Science.gov (United States)

    Yu, Jiantao; Lin, Yu-Hsin; Yang, Lingyan; Huang, Chih-Ching; Chen, Liliang; Wang, Wen-Cheng; Chen, Guan-Wen; Yan, Junyan; Sawettanun, Saranta; Lin, Chia-Hua

    2017-01-01

    Despite tremendous efforts toward developing novel near-infrared (NIR)-absorbing nanomaterials, improvement in therapeutic efficiency remains a formidable challenge in photothermal cancer therapy. This study aims to synthesize a specific peptide conjugated polydopamine-modified reduced graphene oxide (pDA/rGO) nanocomposite that promotes the bystander effect to facilitate cancer treatment using NIR-activated photothermal therapy. To prepare a nanoplatform capable of promoting the bystander effect in cancer cells, we immobilized antiarrhythmic peptide 10 (AAP10) on the surface of dopamine-modified rGO (AAP10-pDA/rGO). Our AAP10-pDA/rGO could promote the bystander effect by increasing the expression of connexin 43 protein in MCF-7 breast-cancer cells. Because of its tremendous ability to absorb NIR absorption, AAP10-pDA/rGO offers a high photothermal effect under NIR irradiation. This leads to a massive death of MCF-7 cells via the bystander effect. Using tumor-bearing mice as the model, it is found that NIR radiation effectively ablates breast tumor in the presence of AAP10-pDA/rGO and inhibits tumor growth by ≈100%. Therefore, this research integrates the bystander and photothermal effects into a single nanoplatform in order to facilitate an efficient photothermal therapy. Furthermore, our AAP10-pDA/rGO, which exhibits both hyperthermia and the bystander effect, can prevent breast-cancer recurrence and, therefore, has great potential for future clinical and research applications. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Pro-oxidant status and matrix metalloproteinases in apical lesions and gingival crevicular fluid as potential biomarkers for asymptomatic apical periodontitis and endodontic treatment response

    Directory of Open Access Journals (Sweden)

    Dezerega Andrea

    2012-03-01

    Full Text Available Abstract Background Oxidative stress and matrix metalloproteinases -9 and -2 are involved in periodontal breakdown, whereas gingival crevicular fluid has been reported to reflect apical status. The aim of this study was to characterize oxidant balance and activity levels of MMP -2 and -9 in apical lesions and healthy periodontal ligament; and second, to determine whether potential changes in oxidant balance were reflected in gingival crevicular fluid from asymptomatic apical periodontitis (AAP-affected teeth at baseline and after endodontic treatment. Methods Patients with clinical diagnosis of AAP and healthy volunteers having indication of tooth extraction were recruited. Apical lesions and healthy periodontal ligaments, respectively, were homogenized or processed to obtain histological tissue sections. Matrix metalloproteinase -9 and -2 levels and/or activity were analyzed by Immunowestern blot, zymography and consecutive densitometric analysis, and their tissue localization was confirmed by immunohistochemistry. A second group of patients with AAP and indication of endodontic treatment was recruited. Gingival crevicular fluid was extracted from AAP-affected teeth at baseline, after endodontic treatment and healthy contralateral teeth. Total oxidant and antioxidant status were determined in homogenized tissue and GCF samples. Statistical analysis was performed using STATA v10 software with unpaired t test, Mann-Whitney test and Spearman's correlation. Results Activity of MMP-2 and MMP-9 along with oxidant status were higher in apical lesions (p Conclusions Apical lesions display an oxidant imbalance along with increased activity of matrix metalloproteinase-2 and -9 and might contribute to AAP progression. Oxidant imbalance can also be reflected in GCF from AAP-affected teeth and was restored to normal levels after conservative endodontic treatment. These mediators might be useful as potential biomarkers for chair-side complementary diagnostic

  15. Effects of antiarrhythmic peptide 10 on acute ventricular arrhythmia

    Institute of Scientific and Technical Information of China (English)

    Bing Sun; Jin-Fa Jiang; Cui-Mei Zhao; Chao-Hui Hu

    2015-01-01

    Objective:To observe the effects antiarrhythmic peptide 10 (AAP10) aon acute ventricular arrhythmia and the phosphorylation state of ischemic myocardium connexin.Methods:Acute total ischemia and partial ischemia models were established by ceasing perfusion and ligating the left anterior descending coronary artery in SD rats. The effects of AAP10 (1 mg/L) on the incidence rate of ischemia-induced ventricular arrhythmia were observed. The ischemic myocardium was sampled to detect total-Cx43 and NP-Cx43 by immunofluorescent staining and western blotting. the total-Cx43 expression was detected through image analysis system by semi-quantitative analysis.Results: AAP10 could significantly decrease the incidence of ischemia-induced ventricular tachycardia and ventricular fibrillation. During ischemic stage, total ischemia (TI) and AAP10 total ischemia (ATI) groups were compared with partial ischemia (PI) and AAP10 partial ischemia (API) groups. The rates of incidence for arrhythmia in the ATI and API groups (10% and 0%) were lower than those in the TI and PI groups (60% and 45%). The difference between the two groups was statistically significant (P=0.019, P=0.020). The semi-quantitative analysis results of the ischemic myocardium showed that the total-Cx43 protein expression distribution areas for TI, ATI, PI and API groups were significantly decreased compared with the control group. On the other hand, the NP-Cx43 distribution areas of TI, ATI, PI and API groups were significantly increased compared with the control group (P>0.05). AAP10 could increase the total-Cx43 expression in the ischemic area and decrease the NP-Cx43 expression. Western blot results were consistent with the results of immunofluorescence staining.Conclusions:AAP10 can significantly decrease the rate of incidence of acute ischemia-induced ventricular tachycardia and ventricular fibrillation. Acute ischemic ventricular arrhythmias may have a relationship with the decreased phosphorylation of Cx43

  16. Potential for Using Acetic Acid Plus Pear Ester Combination Lures to Monitor Codling Moth in an SIT Program

    Directory of Open Access Journals (Sweden)

    Gary J. R. Judd

    2016-11-01

    Full Text Available Studies were conducted in commercial apple orchards in British Columbia, Canada, to determine whether lures combining ethyl-(E,Z-2,4-decadienoate, pear ester (PE, with either acetic acid (AA or sex pheromone, (E,E-8,10-dodecadien-1-ol (codlemone, might improve monitoring of codling moth, Cydia pomonella (L., in an area-wide programme integrating sterile insect technology (SIT and mating disruption (MD. Catches of sterile and wild codling moths were compared in apple orchards receiving weekly delivery of sterile moths (1:1 sex ratio using white delta traps baited with either AA or PE alone, and in combination. Sterile and wild codling moths responded similarly to these kairomone lures. For each moth sex and type (sterile and wild, AA-PE lures were significantly more attractive than AA or PE alone. Bisexual catches with AA-PE lures were compared with those of commercial bisexual lures containing 3 mg of codlemone plus 3 mg of PE (Pherocon CM-DA Combo lure, Trécé Inc., Adair, OK, USA, and to catches of males with standard codlemone-loaded septa used in SIT (1 mg and MD (10 mg programmes, respectively. CM-DA lures caught the greatest number of sterile and wild male moths in orchards managed with SIT alone, or combined with MD, whereas AA-PE lures caught 2–3× more females than CM-DA lures under both management systems. Sterile to wild (S:W ratios for male versus female moths in catches with AA-PE lures were equivalent, whereas in the same orchards, male S:W ratios were significantly greater than female S:W ratios when measured with CM-DA lures. Male S:W ratios measured with CM-DA lures were similar to those with codlemone lures. CM-DA and codlemone lures appear to overestimate S:W ratios as measured by AA-PE lures, probably by attracting relatively more sterile males from long range. Using AA-PE lures to monitor codling moths in an SIT programme removes fewer functional sterile males and reduces the need for trap maintenance compared with using

  17. 代谢综合征孕妇血清丙氨酸氨基肽酶、亮氨酸氨基肽酶表达和临床意义%Clinical significance and expression of alanine amino peptidase and leucine amino peptidase in the serum of pregnant women with metabolic syndrome

    Institute of Scientific and Technical Information of China (English)

    蔡仲仁

    2011-01-01

    目的:探讨代谢综合征孕妇血清丙氨酸氨基肽酶(AAP)、亮氨酸氨基肽酶(LAP)水平的表达,分析其临床意义.方法:选取我院2009年1月~2010年12月收治的42例代谢综合征孕妇作为研究组,入院后检测血清AAP、LAP的表达.另外选择同期我院的40例正常孕妇作为对照组,入院后检测血清AAP、LAP的表达.所有孕妇均为妊娠晚期.结果:研究组血清AAP[(64.21±9.46)U/L]、LAP[(53.53±7.67)U/L]均高于对照组血清AAP[(44.64±8.36)U/L]、LAP[(36.75±7.86)U/L],两组比较,差异有统计学意义(P<0.05).结论:代谢综合征孕妇血清AAP、LAP明显增高,可能是机体对代谢综合征的一种保护措施.%Objective: To discuss the expression of aianine ammo peptidase (APP) and leucine amino peptidase (LAP) in the serum of pregnant women with metabolic syndrome, and analyze the clinical significance. Methods: 42 pregnant women with metabolic syndrome were collected from January 2009 to December 2010 in our hospital, after admission the serum AAP, LAP expression were detected. Another 40 patients with normal pregnant women were chose as control group, as the same time after admission the serum AAP, LAP expression were delected. All pregnant women were late trimester of pregnancy. Results: After the detection, the semm AAP [(64.21 ±9.46)U/L], LAP [(53.53-7.67)LVL] in the research group were higher than those in the control group serum AAP [(44.64 ±8.36)U/Lj, LAP[(36.75±7.86)U/L], there were significant differences in the two groups (P<0.05). Conclusion: Serum AAP, LAP of pregnant women wiih metabolic syndrome is significantly higher, which may be a protection measure for the body of the metabolic syndrome.

  18. Precipitation estimation in mountainous terrain using multivariate geostatistics. Part II: isohyetal maps

    Science.gov (United States)

    Hevesi, Joseph A.; Flint, Alan L.; Istok, Jonathan D.

    1992-01-01

    Values of average annual precipitation (AAP) may be important for hydrologic characterization of a potential high-level nuclear-waste repository site at Yucca Mountain, Nevada. Reliable measurements of AAP are sparse in the vicinity of Yucca Mountain, and estimates of AAP were needed for an isohyetal mapping over a 2600-square-mile watershed containing Yucca Mountain. Estimates were obtained with a multivariate geostatistical model developed using AAP and elevation data from a network of 42 precipitation stations in southern Nevada and southeastern California. An additional 1531 elevations were obtained to improve estimation accuracy. Isohyets representing estimates obtained using univariate geostatistics (kriging) defined a smooth and continuous surface. Isohyets representing estimates obtained using multivariate geostatistics (cokriging) defined an irregular surface that more accurately represented expected local orographic influences on AAP. Cokriging results included a maximum estimate within the study area of 335 mm at an elevation of 7400 ft, an average estimate of 157 mm for the study area, and an average estimate of 172 mm at eight locations in the vicinity of the potential repository site. Kriging estimates tended to be lower in comparison because the increased AAP expected for remote mountainous topography was not adequately represented by the available sample. Regression results between cokriging estimates and elevation were similar to regression results between measured AAP and elevation. The position of the cokriging 250-mm isohyet relative to the boundaries of pinyon pine and juniper woodlands provided indirect evidence of improved estimation accuracy because the cokriging result agreed well with investigations by others concerning the relationship between elevation, vegetation, and climate in the Great Basin. Calculated estimation variances were also mapped and compared to evaluate improvements in estimation accuracy. Cokriging estimation variances

  19. Reference: 411 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available id permease (AAP) subfamily genes are preferentially expressed in the vascular tissue, suggesting roles in l...ter LYSINE HISTIDINE TRANSPORTER1 (LHT1), an AAP homolog, is expressed in both th...en sources because of the severe inhibition of amino acid uptake from the medium, and uptake of amino acids ...into mesophyll protoplasts is inhibited. Interestingly, lht1 mutants, which show ...growth defects on fertilized soil, can be rescued when LHT1 is reexpressed in green tissue. These findings are

  20. Dicty_cDB: Contig-U07086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available al-Ocean-Sampling_GS-31-01-01-1... 44 5.5 1 ( DY272854 ) IC0AAA32BC06RM1 CitNFL Citrus clementina cDNA 5',...... 44 5.5 1 ( DY271159 ) KN0AAP9YA15FM1 Fruit-TF Citrus clementina cDNA 5'... 44 5.5 1 ( DY259793 ) KN0AAP10Y...D11FM1 Fruit-TF Citrus clementina cDNA 5... 44 5.5 1 ( CV710938 ) UCRPT01_0015C02

  1. Efficiency and patient experience with propofol vsconventional sedation: A prospective study

    Institute of Scientific and Technical Information of China (English)

    2016-01-01

    AIM To determine whether anaesthesiologistadministeredsedation with propofol (AAP) or endoscopist-administered conscious sedation (EAC) withfentanyl/midazolam shortens colonoscopy duration/totalroom time.METHODS: This is a prospective, non-randomized,comparative study that enrolled patients greater than18 years of age undergoing colonoscopy in a singleCanadian academic outpatient endoscopy unit over athree-month consecutive period. Colonoscopies in thisunit are performed both with AAP and EAC. Patientdemographics, procedure-related data and adverseevents were documented. Additionally, the level ofprocedure difficulty, and whether a staff endoscopist,trainee with assistance, or independent trainee, performedthe procedure were documented. A validatedmodified 4-question, 5-point Likert scale telephonesurvey was used to assess patient satisfaction withcolonoscopy. The telephone patient satisfaction surveywas conducted 24-72 h following the procedure.RESULTS: Two hundred and thirty patients were enrolled during the study period with 126 patients inthe AAP group and 104 patients in the EAC group.Mean procedure time was 18.3 ± 10.1 min in theAAP group and 14.7 ± 7.1 min in the EAC group (P =0.002). Mean total room time was 36.8 ± 13.7 with AAPand 30.1 ± 11 min with EAC (p 〈 0.001). Multivariateanalysis revealed the use of AAP (P = 0.002), residentparticipation (p 〈 0.001), diagnostic interventions (p= 0.033), therapeutic interventions (p 〈 0.001), lowerbody mass index (p = 0.008) and American Society ofAnaesthesiologist class (p = 0.016), to be predictorsof longer total room time. Patient age and genderwere not significant predictors. After excluding cases inwhich trainees were involved, there was no significantdifference in procedure time between the two groups (p= 0.941), however total room time was still prolongedin the AAP group (p = 0.019). The amount of painexperienced was lower with AAP (p = 0.02

  2. Comparison of Regional Vulnerability Factors for Department of Defense (DOD) Installations

    Science.gov (United States)

    2006-09-01

    Army AMC I 198 Fort Chaffee Arkansas Army NGB USARC A 199 Camp Shelby Mississippi Army NGB T 200 Camp Dodge Iowa Army NGB T 201 Hawthorne Army Depot...AAP Texas Army AMC I 228 Fort Nathaniel Greene Rhode Island Army USARC T 229 Red River Army Depot Texas Army AMC I 229 Camp Navajo Arizona Army NGB...Detroit Arsenal Michigan Army AMC I 286 Dugway Proving Ground Utah Army ATEC I 213 Hawthorne Army Depot Nevada Army AMC I 204 Holston AAP Tennessee

  3. Potential for Using Acetic Acid Plus Pear Ester Combination Lures to Monitor Codling Moth in an SIT Program.

    Science.gov (United States)

    Judd, Gary J R

    2016-11-25

    Studies were conducted in commercial apple orchards in British Columbia, Canada, to determine whether lures combining ethyl-(E,Z)-2,4-decadienoate, pear ester (PE), with either acetic acid (AA) or sex pheromone, (E,E)-8,10-dodecadien-1-ol (codlemone), might improve monitoring of codling moth, Cydia pomonella (L.), in an area-wide programme integrating sterile insect technology (SIT) and mating disruption (MD). Catches of sterile and wild codling moths were compared in apple orchards receiving weekly delivery of sterile moths (1:1 sex ratio) using white delta traps baited with either AA or PE alone, and in combination. Sterile and wild codling moths responded similarly to these kairomone lures. For each moth sex and type (sterile and wild), AA-PE lures were significantly more attractive than AA or PE alone. Bisexual catches with AA-PE lures were compared with those of commercial bisexual lures containing 3 mg of codlemone plus 3 mg of PE (Pherocon CM-DA Combo lure, Trécé Inc., Adair, OK, USA), and to catches of males with standard codlemone-loaded septa used in SIT (1 mg) and MD (10 mg) programmes, respectively. CM-DA lures caught the greatest number of sterile and wild male moths in orchards managed with SIT alone, or combined with MD, whereas AA-PE lures caught 2-3× more females than CM-DA lures under both management systems. Sterile to wild (S:W) ratios for male versus female moths in catches with AA-PE lures were equivalent, whereas in the same orchards, male S:W ratios were significantly greater than female S:W ratios when measured with CM-DA lures. Male S:W ratios measured with CM-DA lures were similar to those with codlemone lures. CM-DA and codlemone lures appear to overestimate S:W ratios as measured by AA-PE lures, probably by attracting relatively more sterile males from long range. Using AA-PE lures to monitor codling moths in an SIT programme removes fewer functional sterile males and reduces the need for trap maintenance compared with using

  4. NCBI nr-aa BLAST: CBRC-DNOV-01-1344 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1344 ref|YP_223898.1| putative tape measure protein [Lactobacillus pha...ge phiJL-1] gb|AAP74525.1| putative tape measure protein [Lactobacillus plantarum bacteriophage phiJL-1] YP_223898.1 0.015 22% ...

  5. Gene : CBRC-DNOV-01-1344 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1344 Novel UN B UNKNOWN THI74_YEAST 0.098 24% ref|YP_223898.1| putative tape measure... protein [Lactobacillus phage phiJL-1] gb|AAP74525.1| putative tape measure protein [Lactobaci

  6. application of ascorbic acid 2-phosphate as a new voltammetric ...

    African Journals Online (AJOL)

    a

    acid 2-phosphate (AAP) as a new voltammetric substrate has been ... further applied to determine the ALP content in healthy human serum and the results were in ... substrates to produce phenol or p-aminophenol, which is electroactive and can be ... bovine serum, human serum and untreated human blood with the linear ...

  7. Student Satisfaction and Graduate Part-Time Students

    Science.gov (United States)

    Moore, Monica Moody

    2011-01-01

    The Advanced Academic Programs (AAP) of the Zanvyl Krieger School of Arts and Sciences at Johns Hopkins University (JHU) enrolls approximately 2,700 part-time graduate students across three physical locations. It is a complex organization whose target audience is a sophisticated consumer of higher education. With the support of Eduventures, AAP…

  8. Association of Academic Physiatrists

    Science.gov (United States)

    ... that enhance and improve research and education in academic physiatry. Search AAP Search » Gerard E. Francisco, MD , received the Sidney Licht Lectureship Award at the 10th International Society of Physical and Rehabilitation Medicine World Congress. Michael Boninger, MD , new Vice President ...

  9. Osteoclastogenesis is influenced by modulation of gap junctional communication with antiarrhythmic peptides.

    Science.gov (United States)

    Kylmäoja, Elina; Kokkonen, Hanna; Kauppinen, Kyösti; Hussar, Piret; Sato, Tetsuji; Haugan, Ketil; Larsen, Bjarne Due; Tuukkanen, Juha

    2013-03-01

    Osteoclasts are formed by the fusion of mononuclear precursor cells of the monocyte-macrophage lineage. Among several putative mechanisms, gap-junctional intercellular communication (GJC) has been proposed to have a role in osteoclast fusion and bone resorption. We examined the role of GJC in osteoclastogenesis and in vitro bone resorption with mouse bone marrow hematopoietic stem cells and RAW 264.7 cells. Blocking of gap junctions with 18-α-glycyrrhetinic acid (18GA) led to inhibition of osteoclastogenesis and in vitro bone resorption. Similarly, the GJC inhibitor GAP27 inhibited osteoclast formation. GJC modulation with the antiarrhythmic peptides (AAPs) led to increased amounts of multinuclear RAW 264.7 osteoclasts as well as increased number of nuclei per multinuclear cell. In the culture of bone marrow hematopoietic stem cells in the presence of bone marrow stromal cells AAP reduced the number of osteoclasts, and coculture of MC3T3-E1 preosteoblasts with RAW 264.7 macrophages prevented the action of AAPs to promote osteoclastogenesis. The present data indicate that AAPs modulate the fusion of the pure culture of cells of the monocyte-macrophage lineage. However, the fusion is influenced by GJC in cells of the osteoblast lineage.

  10. NCBI nr-aa BLAST: CBRC-CINT-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0121 ref|NP_999827.1| polycystic kidney disease protein 2 [Strongyloce...ntrotus purpuratus] gb|AAP35006.1| polycystic kidney disease protein 2 [Strongylocentrotus purpuratus] NP_999827.1 0.26 22% ...

  11. Large accumulations of maize streak virus in the filter chamber and midgut cells of the leafhopper vector Cicadulina mbila.

    Science.gov (United States)

    Ammar, El-Desouky; Gargani, Daniel; Lett, Jean M; Peterschmitt, Michel

    2009-01-01

    Maize streak virus (MSV, Mastrevirus, Geminiviridae) is persistently transmitted by Cicadulina mbila, apparently without propagation in its leafhopper vector. MSV was shown earlier by quantitative PCR to accumulate in the alimentary canal of C. mbila. We examined the alimentary canals of C. mbila leafhoppers that acquired MSV from diseased plants for various acquisition access periods (AAP) by immunofluorescence confocal laser scanning microscopy (iCLSM) and by immunogold labelling transmission electron microscopy (iTEM). Following a 7-day AAP and a 7-day inoculation period (IP) on healthy seedlings, MSV was detected by iCLSM mainly in the filter chamber and anterior midgut. Using iTEM, large accumulations of MSV particles, usually enclosed in membranous vesicles, were detected only in cells of the midgut, inside and outside the filter chamber, following 14- or 30-day AAPs, and also following 7-day AAP and 7-day IP on healthy plants. No virus was detected in the control non-vector species C. chinaï. Coated pits or vesicles, typical of clathrin-mediated endocytosis, were not observed. We discuss an alternative endocytosis pathway and suggest that the MSV accumulations are stored in endosomes in the midgut epithelial cells.

  12. Pediatricians Offer Heads-Up for Preventing Soccer Injuries

    Science.gov (United States)

    ... 2017 SATURDAY, Jan. 14, 2017 (HealthDay News) -- As children's soccer has become more popular in the United States, ... running, twisting, shooting and landing, the AAP explained. Children who are injured while playing soccer most often sustain sprains and strains. Bruises are ...

  13. An Archeological Overview and Management Plan for the Hays Army Ammunition Plant, Allegheny County, Pennsylvania.

    Science.gov (United States)

    1984-05-07

    Society of Professional Archeologists in field, collections, and archival research; administration; museology ; teaching; and historical archeology...evidence of broad regional cultural interactions throughout the prehistoric Paloo-Indian, Archaic, and Woodland tra- ditions. As discussed in 2.1.1...available in draft for consultation by Hays AAP facility personnel (Stephanie Rodeffer, personal co=nuication 1983). In addition, the Carnegie Museum has

  14. NCBI nr-aa BLAST: CBRC-OSAT-07-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OSAT-07-0033 ref|YP_025744.1| NADH dehydrogenase subunit 4 [Ornithoctonus huwe...na] gb|AAP51154.2| NADH dehydrogenase subunit 4 [Ornithoctonus huwena] YP_025744.1 3.2 25% ...

  15. NCBI nr-aa BLAST: CBRC-TTRU-01-0100 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0100 ref|YP_025744.1| NADH dehydrogenase subunit 4 [Ornithoctonus huwe...na] gb|AAP51154.2| NADH dehydrogenase subunit 4 [Ornithoctonus huwena] YP_025744.1 0.012 25% ...

  16. WEST AFRICAN JOURNAL OF MEDICINE

    African Journals Online (AJOL)

    Prevention of Dental Caries: Knowledge, Practice and Opinion of. Paediatricians in Lagos ... health education programme for paediatricians, referral of related cases to .... following were the inclusion criteria: specialisation in .... (AAP) in 2003 released a policy calling .... centers in Kubeng Kerian, Malaysia: A preliminary ...

  17. Vitamin D in Health and Disease in Adolescents: When to Screen, Whom to Treat, and How to Treat.

    Science.gov (United States)

    Golden, Neville H; Carey, Dennis E

    2016-01-01

    The existing guidelines on screening and treatment are confusing because different guidelines target different populations. The IOM and AAP guidelines target generally healthy populations, whereas the Endocrine Society and other subspecialty guidelines target individuals with specific medical conditions associated with increased bone fragility. These distinctions have not always been well articulated. For healthy adolescents, the AAP does not recommend universal screening or screening of obese or dark-skinned individuals. Increased dietary intake of vitamin D is recommended, and vitamin D supplementation can be considered if the RDA cannot be met. For adolescents with chronic medical illnesses associated with increased fracture risk, screening for vitamin D deficiency should be performed by obtaining a serum 25-OHD level. Those found to be deficient (25-OHD level vitamin D2 or vitamin D3 higher than the daily requirement (as discussed in the section on vitamin D and chronic disease), followed by a maintenance dose. A repeat 25-OHD level should be obtained after the therapeutic course is completed. Some experts advocate for achievement of 25-OHD levels greater than 30 ng/mL in conditions associated with increased bone fragility, and several pediatric subspecialty organizations have made recommendations specific to the diseases they treat. In such instances, the recommendations of the pediatric subspecialty organizations should take precedence over the AAP recommendations for adolescents with chronic illnesses associated with increased bone fragility because the AAP recommendations were primarily targeted at a healthy population.

  18. Influence of the surface structure on the filtration performance of UV-modified PES membranes

    DEFF Research Database (Denmark)

    Kæselev, Bozena Alicja; Kingshott, P.; Jonsson, Gunnar Eigil

    2002-01-01

    Poly (ether sulfone) (PES) 50 kDa membranes were surface modified by irradiation with UV light (254 nm) in the presence of N-vinyl-2-pyrrolidine (NVP), 2-acrylamidoglycolic acid monohydrate (AAG) and 2-acrylamido-2-methyl-1-propanesulfonic acid (AAP). The surfaces of the modified membranes were c...

  19. 75 FR 47819 - Workshop on Optimizing Clinical Trial Design for the Development of Pediatric Cardiovascular Devices

    Science.gov (United States)

    2010-08-09

    ... support from the American Academy of Pediatrics (AAP), the American College of Cardiology (ACC), and the... developing devices for the pediatric cardiology market. The information gathered in this and future workshops will help to develop future guidance on optimal designs for pediatric cardiology device trials....

  20. Using Acetaminophen's Toxicity Mechanism to Enhance Cisplatin Efficacy in Hepatocarcinoma and Hepatoblastoma Cell Lines

    Directory of Open Access Journals (Sweden)

    Alexander J. Neuwelt

    2009-10-01

    Conclusions: Our results suggest that a chemotherapeutic regimen containing both AAP and CDDP with delayed NAC rescue has the potential to enhance chemotherapeutic efficacy while decreasing adverse effects. This would be a promising approach particularly for hepatoblastomas regardless of cellular CYP2E1 protein level but could also be beneficial in other malignancies.

  1. Rundum artist-run space and its elusive form / Hanna Laura Kaljo, Mari-Leen Kiipli, Kulla Laas ... [jt.

    Index Scriptorium Estoniae

    2015-01-01

    Rundum on 2013. a septembris Tallinnas loodud liikuv loominguline platvorm, mille eesmärgiks on suhestuda erinevate kohtadega, reageerida tühikutele Eesti loomemaastikus ning uurida sealjuures ka omaalgatuslike praktikate võimalikkust kohalikus kontekstis. Vestlusringis Rundumi algatajad Mari-Leen Kiipli, Kulla Laas, Aap Tepper, Mari Volens, Kristina Õllek

  2. An evidence-based, point-of-care tool to guide completion of asthma action plans in practice.

    Science.gov (United States)

    Kouri, Andrew; Boulet, Louis-Philippe; Kaplan, Alan; Gupta, Samir

    2017-05-01

    Asthma action plans (AAPs) reduce healthcare utilisation, improve quality of life and are recommended across guidelines. However, fewer than 25% of patients receive an AAP, partly due to prescribers' inability to complete "yellow zone" instructions (how to intensify therapy for acute loss of control). We sought to review best evidence to develop a practical, evidence-based tool to facilitate yellow zone guidance in adults.We reviewed recent asthma guidelines and adult studies addressing acute loss of asthma control (January 2010 to March 2016). We developed evidence-based rules for yellow zone therapy and operational guidelines to maximise adherence and minimise errors.We reviewed three guidelines and 11 manuscripts (2486 abstracts screened). Recommendations were comparable but some areas lacked guidance. For 15/43 asthma regimens, the commonly recommended four- to five-fold yellow zone inhaled corticosteroid dose increase was problematic due to regulatory dose limits. We identified evidence-based alternatives for 8/15 regimens. Operational guidance included increasing to a maximum of four inhalations while maintaining baseline inhaler frequency and device in the yellow zone.We developed a practical implementation tool to facilitate AAP delivery at the point of care, addressing existing gaps and uncertainties. Our tool should be implemented as part of a multifaceted approach to augment AAP usage. Copyright ©ERS 2017.

  3. Grr1p is required for transcriptional induction of amino acid permease genes and proper transcriptional regulation of genes in carbon metabolism of Saccharomyces cerevisiae

    DEFF Research Database (Denmark)

    Eckert-Boulet, Nadine; Regenberg, Birgitte; Nielsen, Jens

    2005-01-01

    and a grr1 Delta strain and adding citrulline in the exponential phase. Whole-genome transcription analyses were performed on samples from each cultivation, both immediately before and 30 min after citrulline addition. Transcriptional induction of the AAP genes AGP1, BAP2, BAP3, DIP5, GNP1 and TAT1 is fully...

  4. NCBI nr-aa BLAST: CBRC-DNOV-01-2484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2484 ref|YP_006355.1| ATP synthase F0 subunit 6 [Siphonodentalium loba...tum] gb|AAP91676.1| ATP synthase F0 subunit 6 [Siphonodentalium lobatum] YP_006355.1 5e-04 29% ...

  5. Korsten : tellimata tellised = Chimney : an outside job / Andres Aule

    Index Scriptorium Estoniae

    Aule, Andres

    2012-01-01

    Aap Kaur Suvi kavandatud Tallinna linnainstallatsioonide festivali "LIFT11" installatsioonist "Korsten", mis pidi seisnema Tauno Kangro skulptuuri "Lõbus korstnapühkija" ümber ajutise telliskorstna ehitamises. Lift11 jättis selle installatsiooni ära, kuid ootamatult sai "Korsten" kodanikualgatusena 8. IX 2011 teoks

  6. [Acute accidental poisoning in children: aspects of their epidemiology, aetiology, and outcome at the Charles de Gaulle Paediatric Hospital in Ouagadougou (Burkina Faso)].

    Science.gov (United States)

    Kouéta, Fla; Dao, Lassina; Yé, Diarra; Fayama, Zéinabou; Sawadogo, Alphonse

    2009-01-01

    Accidents are a daily concern in the paediatric ward because of their frequency, diversity and severity. Acute accidental poisoning (AAP) accounts for an important portion of these. To help improvement management of AAP, we conducted a retrospective study covering a period of 2 years from January 2005 to December 2006 at Charles de Gaulle Paediatric University Hospital in Ouagadougou. Of 9390 admissions during the study period, 123 children, or 1.3%, were admitted for poisoning. A cumulative average of 11 were admitted monthly, with a peak of 16 patients in April 2005 and 2006, together. AAP was most common among children aged 1 to 4 years. Their mean age was 3 years and ranged from 6 days to 12 years. Boys outnumbered girls, with a sex ratio of 1.2. Mothers of more than half (61%) of the children poisoned worked in the home. Household products accounted for 44.7% of AAPs, followed by drug (22.7%) and food (22%) poisoning. Kerosene and other petroleum products topped the list of household products, with 54.5%. Tranquilizers (46.4%) and dairy products (37%) dominated the drug and food poisoning categories. Immediate outcome was fatal in 3% of cases, and three quarters of these deaths occurred during drug poisoning of children aged 1 to 4 years. The mean hospital stay was 2 days, and ranged from 0 to 9 days. Health officials, the media, and community outreach must all help to increase awareness about the dangers of poisoning and of preventive measures.

  7. Effect of matrix on the metal poisoning of REY catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Yang, S.J.; Chen, Y.W. [National Central Univ., Chungli (Taiwan, Province of China). Dept. of Chemical Engineering; Li, C. [Chinese Petroleum Corp., Chiayi (Taiwan, Province of China). Refining and Manufacturing Research Inst.

    1995-04-01

    The effect of matrix on the resistance of vanadium and nickel poisoning of the REY zeolite has been investigated by X-ray diffraction, nitrogen adsorption, and n-hexane cracking reaction. Alumina (Al{sub 2}O{sub 3}), magnesia-alumina (MgO-Al{sub 2}O{sub 3}), alumina-aluminum phosphate (AAP), and magnesia-alumina-aluminum phosphate (MgAAP) were used as matrices of REY. The presence of matrix can increase the resistance of REY to steam deactivation. AAP has a better hydrothermal stability than the other matrics. MgO-Al{sub 2}O{sub 3} matrix demonstrates the highest ability to capture vanadium due to the basicity of magnesia. There is an interaction between vanadium and nickel. This interaction inhibits the destruction of REY structure caused by vanadium. AAP has a strong interaction with nickel. The stronger the nickel-matrix interaction, the less poison effect of nickel. In addition, the strong interaction leads to the decrease in nickel`s ability to retard the destruction of REY structure by vanadium.

  8. Simultaneous Detection of Phenols and Anilines in Oilfield Waste Water

    Institute of Scientific and Technical Information of China (English)

    Yuan Cunguang; Feng Chengwu

    1996-01-01

    @@ Phenols and aromatic anilines are monitored in many countries , because both of them pollute environment seriously. The methods of 4-AAP(4-Aminoantipyrine)photometric detection of volatile phenols and naphthalene -ethyl-diamine-azo photometric detection of anilines are recommended by the National Environmental Protection Bureau, China (NEPBC).

  9. For Kids Playing Pokemon Go, Catch These Safety Tips

    Science.gov (United States)

    ... an "augmented reality" game. That means it's a game that is partly virtual and partly based in reality. Players need to go out into the real world. "You can't just play this game from your living room," AAP spokeswoman Dr. Elizabeth ...

  10. NCBI nr-aa BLAST: CBRC-TSYR-01-1170 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1170 ref|NP_898745.1| putative cadmium resistance protein (CadA) [Rhod...ococcus erythropolis] gb|AAP74015.1| putative cadmium resistance protein (CadA) [Rhodococcus erythropolis] NP_898745.1 0.14 29% ...

  11. NCBI nr-aa BLAST: CBRC-TGUT-05-0042 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-05-0042 gb|AAP36559.1| Homo sapiens potassium voltage-gated channel, delay...ed-rectifier, subfamily S, member 3 [synthetic construct] gb|AAX28989.1| potassium voltage-gated channel delay

  12. NCBI nr-aa BLAST: CBRC-OGAR-01-0901 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0901 gb|AAP36559.1| Homo sapiens potassium voltage-gated channel, delay...ed-rectifier, subfamily S, member 3 [synthetic construct] gb|AAX28989.1| potassium voltage-gated channel delay

  13. NCBI nr-aa BLAST: CBRC-ETEL-01-0884 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0884 gb|AAP36559.1| Homo sapiens potassium voltage-gated channel, delay...ed-rectifier, subfamily S, member 3 [synthetic construct] gb|AAX28989.1| potassium voltage-gated channel delay

  14. NCBI nr-aa BLAST: CBRC-MLUC-01-0761 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0761 gb|AAP36559.1| Homo sapiens potassium voltage-gated channel, delay...ed-rectifier, subfamily S, member 3 [synthetic construct] gb|AAX28989.1| potassium voltage-gated channel delay

  15. NCBI nr-aa BLAST: CBRC-EEUR-01-1046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1046 gb|AAP36559.1| Homo sapiens potassium voltage-gated channel, delay...ed-rectifier, subfamily S, member 3 [synthetic construct] gb|AAX28989.1| potassium voltage-gated channel delay

  16. Studying the role of vision in cycling : critique on restricting research to fixation behaviour.

    NARCIS (Netherlands)

    Schepers, J.P. Brinker, B.P.L.M. den Waard, D. de Twisk, D.A.M. Schwab, D.A.M. & Smeets, J.B.J.

    2013-01-01

    In a recent study published in Accident Analysis & Prevention, Vansteenkiste et al. (2013, http://dx.doi.org/10.1016/j.aap.2012.11.025) – as one of the first in this field – investigated the visual control of bicycle steering. They undertook the interesting task of testing cyclists’ eye fixation beh

  17. Recent evidence and potential mechanisms underlying weight gain and insulin resistance due to atypical antipsychotics

    Directory of Open Access Journals (Sweden)

    Ana Maria Volpato

    2013-09-01

    Full Text Available Objective: Atypical antipsychotics (AAPs promote obesity and insulin resistance. In this regard, the main objective of this study was to present potential mechanisms and evidence concerning side effects of atypical antipsychotics in humans and rodents. Method: A systematic review of the literature was performed using the MEDLINE database. We checked the references of selected articles, review articles, and books on the subject. Results: This review provides consistent results concerning the side effects of olanzapine (OL and clozapine (CLZ, whereas we found conflicting results related to other AAPs. Most studies involving humans describe the effects on body weight, adiposity, lipid profile, and blood glucose levels. However, it seems difficult to identify an animal model replicating the wide range of changes observed in humans. Animal lineage, route of administration, dose, and duration of treatment should be carefully chosen for the replication of the findings in humans. Conclusions: Patients undergoing treatment with AAPs are at higher risk of developing adverse metabolic changes. This increased risk must be taken into account when making decisions about treatment. The influence of AAPs on multiple systems is certainly the cause of such effects. Specifically, muscarinic and histaminergic pathways seem to play important roles.

  18. Gene : CBRC-CJAC-01-0975 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0975 UN A Melanocortins receptors MSHR_CALJA 0.0 100% sp|Q864H7|MSHR_C...R) gb|AAP30994.1| melanocortin-1 receptor [Callithrix jacchus] 0.0 100% MPMQGAQRKLLGSLNSTPTATSNPGLAANHTGAPCL

  19. Gene : CBRC-CJAC-01-1020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1020 UN A Orphan receptors GPR34_PANTR 0.0 93% gb|AAP04277.1| G-protei...n-coupled receptor GPR34 [Callithrix jacchus] 0.0 100% MRSHTITMMTTTSVSSWPYSSHRMCFETNHSDQSPQNFSGRPDVTTCPMDENL

  20. NCBI nr-aa BLAST: CBRC-CJAC-01-0975 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0975 sp|Q864H7|MSHR_CALJA Melanocyte-stimulating hormone receptor (MSH...-R) (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) gb|AAP30994.1| melanocortin-1 receptor [Callithrix jacchus] Q864H7 0.0 100% ...

  1. Building Resilience in Children

    Science.gov (United States)

    ... D., MS Ed, FAAP, a pediatrician specializing in adolescent medicine at The Children’s Hospital of Philadelphia (CHOP), has joined forces with the American Academy of Pediatrics (AAP) to author A Parent’s Guide to Building Resilience in Children and Teens: Giving Your Child Roots ...

  2. NCBI nr-aa BLAST: CBRC-LAFR-01-0231 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0231 ref|NP_852970.1| hypothetical protein MGA_0954 [Mycoplasma galliseptic...um R] gb|AAP56538.1| conserved hypothetical protein [Mycoplasma gallisepticum R] NP_852970.1 0.033 23% ...

  3. NCBI nr-aa BLAST: CBRC-DDIS-02-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-02-0111 ref|NP_853044.1| hypothetical protein MGA_1103 [Mycoplasma galliseptic...um R] gb|AAP56612.1| conserved hypothetical protein [Mycoplasma gallisepticum R] NP_853044.1 0.003 24% ...

  4. NCBI nr-aa BLAST: CBRC-DNOV-01-0511 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0511 ref|NP_852884.1| hypothetical protein MGA_0805 [Mycoplasma galliseptic...um R] gb|AAP56452.1| conserved hypothetical protein [Mycoplasma gallisepticum R] NP_852884.1 0.73 23% ...

  5. NCBI nr-aa BLAST: CBRC-DDIS-02-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-02-0086 ref|NP_853044.1| hypothetical protein MGA_1103 [Mycoplasma galliseptic...um R] gb|AAP56612.1| conserved hypothetical protein [Mycoplasma gallisepticum R] NP_853044.1 0.003 24% ...

  6. NCBI nr-aa BLAST: CBRC-ATHA-05-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-05-0017 ref|NP_852878.1| hypothetical protein MGA_0797 [Mycoplasma galliseptic...um R] gb|AAP56446.1| unique hypothetical protein [Mycoplasma gallisepticum R] NP_852878.1 0.43 26% ...

  7. NCBI nr-aa BLAST: CBRC-BTAU-01-1813 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1813 ref|NP_852880.1| hypothetical protein MGA_0800 [Mycoplasma galliseptic...um R] gb|AAP56448.1| unique hypothetical protein [Mycoplasma gallisepticum R] NP_852880.1 0.39 21% ...

  8. NCBI nr-aa BLAST: CBRC-DNOV-01-0787 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0787 ref|NP_853432.1| hypothetical protein MGA_0477 [Mycoplasma galliseptic...um R] gb|AAP57000.1| unique hypothetical protein [Mycoplasma gallisepticum R] NP_853432.1 0.047 27% ...

  9. NCBI nr-aa BLAST: CBRC-MDOM-05-0629 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-05-0629 ref|YP_025950.1| NADH dehydrogenase subunit 2 [Strigops habroptil...us] gb|AAP47794.1| NADH dehydrogenase subunit 2 [Strigops habroptilus] YP_025950.1 0.28 24% ...

  10. NCBI nr-aa BLAST: CBRC-ATHA-02-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-02-0010 ref|NP_179704.2| unknown protein [Arabidopsis thaliana] gb|AAM981...39.1| unknown protein [Arabidopsis thaliana] gb|AAP37861.1| At2g21080 [Arabidopsis thaliana] NP_179704.2 0.0 100% ...

  11. Korsten : tellimata tellised = Chimney : an outside job / Andres Aule

    Index Scriptorium Estoniae

    Aule, Andres

    2012-01-01

    Aap Kaur Suvi kavandatud Tallinna linnainstallatsioonide festivali "LIFT11" installatsioonist "Korsten", mis pidi seisnema Tauno Kangro skulptuuri "Lõbus korstnapühkija" ümber ajutise telliskorstna ehitamises. Lift11 jättis selle installatsiooni ära, kuid ootamatult sai "Korsten" kodanikualgatusena 8. IX 2011 teoks

  12. Surveying Turkish High School and University Students' Attitudes and Approaches to Physics Problem Solving

    Science.gov (United States)

    Balta, Nuri; Mason, Andrew J.; Singh, Chandralekha

    2016-01-01

    Students' attitudes and approaches to physics problem solving can impact how well they learn physics and how successful they are in solving physics problems. Prior research in the U.S. using a validated Attitude and Approaches to Problem Solving (AAPS) survey suggests that there are major differences between students in introductory physics and…

  13. Children's Compliance with American Academy of Pediatrics' Well-Child Care Visit Guidelines and the Early Detection of Autism

    Science.gov (United States)

    Daniels, Amy M.; Mandell, David S.

    2013-01-01

    This study estimated compliance with American Academy of Pediatrics (AAP) guidelines for well-child care and the association between compliance and age at diagnosis in a national sample of Medicaid-enrolled children with autism (N = 1,475). Mixed effects linear regression was used to assess the relationship between compliance and age at diagnosis.…

  14. Dickkopf-related protein 3 is a potential Abeta-associated protein in Alzheimer's Disease

    NARCIS (Netherlands)

    Bruggink, K.A.; Kuiperij, H.B.; Gloerich, J.; Otte-Holler, I.; Rozemuller, A.J.; Claassen, J.A.H.R.; Kusters, B.; Verbeek, M.M.

    2015-01-01

    Amyloid-beta (Abeta) is the most prominent protein in Alzheimer's disease (AD) senile plaques. In addition, Abeta interacts with a variety of Abeta-associated proteins (AAPs), some of which can form complexes with Abeta and influence its clearance, aggregation or toxicity. Identification of novel AA

  15. NCBI nr-aa BLAST: CBRC-XTRO-01-0066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0066 ref|NP_942999.1| putative entry exclusion protein [Ralstonia eutr...opha H16] gb|AAP86113.1| putative entry exclusion protein [Ralstonia eutropha] NP_942999.1 3e-05 27% ...

  16. Drosophila melanogaster females restore their attractiveness after mating by removing male anti-aphrodisiac pheromones

    NARCIS (Netherlands)

    Laturney, Meghan; Billeter, Jean-Christophe

    2016-01-01

    Males from many species ensure paternity by preventing their mates from copulating with other males. One mate-guarding strategy involves marking females with anti-aphrodisiac pheromones (AAPs), which reduces the females' attractiveness and dissuades other males from courting. Since females benefit

  17. NCBI nr-aa BLAST: CBRC-MDOM-04-0142 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0142 ref|YP_073290.1| NADH dehydrogenase subunit 5 [Pachypsylla venust...a] gb|AAP14655.1| NADH dehydrogenase subunit 5 [Pachypsylla venusta] YP_073290.1 0.039 25% ...

  18. 77 FR 62512 - Radio Broadcasting Services; AM or FM Proposals To Change the Community of License.

    Science.gov (United States)

    2012-10-15

    ... COMMISSION Radio Broadcasting Services; AM or FM Proposals To Change the Community of License. AGENCY... BROADCASTING ASSOCIATION, Station KLXM, Facility ID 184961, BMPED-20120823AAP, From WEATHERFORD, OK, To ARAPAHO, OK; COMMUNITY RADIO PROJECT, Station KZET, Facility ID 173810, BPED-20120914AEF, From CORTEZ, CO,...

  19. Prevalence of Virulence-Related Determinants in Clinical Isolates of Staphylococcus epidermidis

    Science.gov (United States)

    Najar Peerayeh, Shahin; Jazayeri Moghadas, Ali; Behmanesh, Mehrdad

    2016-01-01

    Background Staphylococcus epidermidis, a member of the human flora, is recognized as an opportunistic pathogen and cause of nosocomial infections. Staphylococcus epidermidis surface components are able to establish bacteria on the host surface, and cause infection. Objectives The frequency of icaA, IS256, aap, fbe and bhp in clinical isolates of S. epidermidis were investigated in this study. Materials and Methods Fifty-nine S. epidermidis isolates were collected from blood (50), wound (1), urine (4) and tracheal (4) samples (Tehran, Iran). Staphylococcus epidermidis isolates were identified with conventional bacteriological tests. Virulence-associated genes were detected by specific polymerase chain reactions (PCRs). Results Of the 59 S. epidermidis, fbe was found in 89.8%, while aap and bhp were observed in 64.4% and 15.3% of the samples, respectively. Coexistence of aap and fbe was found in 32 isolates, while coexistence of bhp and fbe was observed in five isolates. Two isolates were negative for the investigated genes. Conclusions Prevalence of fbe and aap was significantly different from similar studies, yet frequency of bhp was in accordance with other studies. Prevalence of icaA and IS256 was not significantly different from some studies while a significant difference was observed when results were compared with some other studies. PMID:27800129

  20. Eesti paviljon "Koda" = Estonian pavilion "Koda"

    Index Scriptorium Estoniae

    2015-01-01

    Eesti paviljon "Koda" Hollandi maailmanäitusel "Floriade". Arhitektuurivõistlus 2011. Arhitektid Joel Kopli, Koit Ojaliiv (Kuu Arhitektid), konstruktorid Alar Hammer, Marek Suursalu (Projekt 363). Lauad Kristel Jakobson (Haka Disain), toolid Aap Piho (Maast Furniture), valgustid Margus Triibmann (Keha3)

  1. AcEST: BP921278 [AcEST

    Lifescience Database Archive (English)

    Full Text Available uitin-protein ligase Arkadia OS=Pon... 31 1.7 sp|Q925Q8|DACH2_MOUSE Dachshund homolog 2 OS=Mus musculus GN=D...HAFHSQISSHATSHPVAPPPPTHLAST 716 Query: 221 EAP 229 AP Sbjct: 717 AAP 719 >sp|Q925Q8|DACH2_MOUSE Dachshund

  2. NCBI nr-aa BLAST: CBRC-DYAK-04-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-04-0025 ref|NP_834435.1| Spore germination protein IA [Bacillus cereus AT...CC 14579] gb|AAP11636.1| Spore germination protein IA [Bacillus cereus ATCC 14579] NP_834435.1 0.044 23% ...

  3. Atlantic City and the Boardwalk: 1932--1976.

    Science.gov (United States)

    Seldin, Donald W

    2008-04-01

    Memories of the meetings in Atlantic City of the two major academic medical societies, the AAP and the ASCI, are enveloped by a vague and unsettling nostalgia. Dominating the scene was the Boardwalk--a site of unexpected encounters, often with long-forgotten colleagues, evoking a feeling of shared intellectual excitement and rich personal ties.

  4. Overweight and Obesity (For Parents)

    Science.gov (United States)

    ... The AAP recommends that no TVs, computers, or video games be in children's bedrooms and that screens be turned off during mealtimes. Exercise and Physical Activity Many kids don't get enough physical activity. Although physical education (PE) in schools can help kids get up ...

  5. Animal-assisted dyadic therapy: A therapy model promoting development of the reflective function in the parent-child bond.

    Science.gov (United States)

    Shani, Liat

    2017-01-01

    Animal-assisted psychotherapy (AAP) inherently incorporates standpoints, interventions, and ways of action promoting the development of the reflective function and mentalization, and thus has special value for parent-child psychotherapy. Two central tools in AAP contribute to this process. The first is the ethical stance of the therapist, who sees the animals as full partners in the therapy situation, respecting them as subjects with needs, desires, and thoughts of their own. The second tool combines nonverbal communication with animals together with the relating, in the here and now, to the understanding and decoding of body language of everyone in the setting. Nonverbal communication in AAP enables access to implicit communication patterns occurring between parent and child. This article provides a survey of theoretical development and research constituting a basis for the development of therapeutic approaches for the improvement of parent-children dynamics, followed by a description of a dyadic therapy model of a mentalization-based treatment originating from a psychoanalytic-relational orientation. Clinical examples are provided to illustrate AAP processes in parent-child psychotherapy (consent was received for examples that were not aggregated).

  6. Enhancing School Asthma Action Plans: Qualitative Results from Southeast Minnesota Beacon Stakeholder Groups

    Science.gov (United States)

    Egginton, Jason S.; Textor, Lauren; Knoebel, Erin; McWilliams, Deborah; Aleman, Marty; Yawn, Barbara

    2013-01-01

    Background: This study explores ways southeast Minnesota schools currently address asthma problems, identifies areas for improvement, and assesses the potential value of asthma action plans (AAPs) in schools. Methods: Focus groups were used to query stakeholder groups on asthma care in schools. Groups were held separately for elementary school…

  7. Phosphorus forms and bioavailability of lake sediments in the middle and lower reaches of Yangtze River

    Institute of Scientific and Technical Information of China (English)

    ZHU; Guangwei; QIN; Boqiang; ZHANG; Lu

    2006-01-01

    Forms of phosphorus in sediments from 25 lakes in the middle and lower reaches of Yangtze River were analyzed by the sequential extraction procedure. Contents and spatial distrubution of algal available phosphorus (AAP) in sediments of Lake Taihu, the third largest freshwater lake of China, were also studied. Relationships between phosphorus forms in sediment and macrophytes coverage in sample sites, as well as phosphorus forms in sediments and chlorophyal contents in lake water were discussed. Exchangeable form of phosphorus (Ex-P) in surface sediments was significantly positive correlative to total phosphorus (TP), dissolved total phosphorus (DTP) and soluble reactive phosphorus (SRP) contents in the lake water. Bioavailable phosphorus (Bio-P) contents in sediments from macrophytes dominant sites were significantly lower than that in no macrophyte sites. In Lake Taihu, Ex-P content in top 3 cm sediment was highest.However, content of ferric fraction phosphorus (Fe-P) was highest in 4-10 cm. Bioavalilble phosphorus (Bio-P) contents in surface sediments positively correlated to Chlorophyll a contents in water of Lake Taihu with significant difference. Therefore, contents of Bio-P and AAP could be acted as the indicators of risks of internal release of phosphorus in the shallow lakes. It was estimated that there were 268.6 ton AAP in top 1 cm sediments in Lake Taihu. Sediment suspension caused by strong wind-induced wave disturbance could carry plenty of AAP into water in large shallow lakes like Lake Taihu.

  8. 扑热息痛肝损伤机制研究进展%Advances on mechanisms of acetaminophen-induced hepatic injury

    Institute of Scientific and Technical Information of China (English)

    顾兴丽; 孙继红; 季晖

    2009-01-01

    Acetaminophen(AAP) -induced hepatic injury is one of the common causes of drug-induced hepatic injury. Up to date, the mechanisms of AAP-induced hepatic injury are still incompletely understood. Recent advances suggest that reactive metabolite formation, glutathione depletion, alkylation of proteins, especially mitochondrial proteins and peroxynitrite formation are critical initiating events for the toxicity. This review will focus on more recent advances in mitochon- drial dysfunction after AAP overdose. Additional, oxi-dative stress and inflammatory mediators are also important for the overall outcome.%扑热息痛(AAP)肝损伤是药物性肝损伤的常见原因之一.但迄今为止,其肝损伤机制仍不完全清楚.最新研究进展指出活性代谢产物的形成、谷胱甘肽的耗竭、线粒体蛋白的烷化和过氧化亚硝酸盐的形成是主要原因.本文主要描述了AAP过量所致的线粒体功能异常的研究进展,另外也综述了氧化应激和炎症介质在扑热息痛肝损伤机制中的作用.

  9. A Novel Approach to Critical Congenital Heart Disease (CCHD Screening at Moderate Altitude

    Directory of Open Access Journals (Sweden)

    Erin Lueth

    2016-07-01

    Full Text Available The American Academy of Pediatrics (AAP has endorsed Critical Congenital Heart Disease (CCHD screening using pulse oximetry nationwide, but, however, acknowledges that altitude may impact failure rates and alternative algorithms may be required at high altitudes. We therefore evaluated a modified screening protocol at an altitude of 6200 feet with the hypothesis that modifications could decrease failure rates. We evaluated 2001 well, newborn infants ≥35 weeks gestation using a modified protocol, which included a lower saturation cutoff for the first screen (85% instead of the AAP recommended 90% and an oxygen hood intervention between the first two screens. Using our modified screening algorithm, we found a 0.3% failure rate, which was similar to the 0.2% sea-level rate and statistically different from the 1.1% rate identified in a recent study at similar altitude. Had the AAP protocol been used, the failure rate would have increased to 0.8%, which is similar to prior reports near this altitude. Echocardiograms were performed on failing newborns with no CCHD identified. A Birth Defects Registry Database review demonstrated one newborn with CCHD was missed after meeting AAP passing criteria. Overall, this study demonstrates that an alternative algorithm can be implemented at moderate altitude with decreased failure rate and comparable false negative rate.

  10. Dickkopf-related protein 3 is a potential Abeta-associated protein in Alzheimer's Disease

    NARCIS (Netherlands)

    Bruggink, K.A.; Kuiperij, H.B.; Gloerich, J.; Otte-Holler, I.; Rozemuller, A.J.; Claassen, J.A.H.R.; Kusters, B.; Verbeek, M.M.

    2015-01-01

    Amyloid-beta (Abeta) is the most prominent protein in Alzheimer's disease (AD) senile plaques. In addition, Abeta interacts with a variety of Abeta-associated proteins (AAPs), some of which can form complexes with Abeta and influence its clearance, aggregation or toxicity. Identification of novel

  11. The Association of American Publishers' Electronic Manuscript Project: a status report.

    OpenAIRE

    Mehringer, A

    1986-01-01

    In July 1983, the Association of American Publishers (AAP) initiated the Electronic Manuscript Project, with the goal of an industry-wide standard and guidelines for electronic manuscript preparation. The project, viewed as a significant effort throughout the publishing and information communities, consists of six tasks designed to improve productivity and efficiency in publishing and to facilitate bibliographic processing.

  12. Enhancing Small-Business Opportunities in the DoD

    Science.gov (United States)

    2008-01-01

    60 CAGE Code...and Sandy Petitjean for their help with document formatting and tables. xix Abbreviations AAP Acquisition Advisory Panel CAGE Commercial and...Except Poultry ) Slaughtering 356.4 0.7 0.3 23.2 Medicinal and Botanical Manufacturing 252.0 0.2 0.7 55.4 Scheduled Freight Air Transportation 195.1

  13. NCBI nr-aa BLAST: CBRC-VPAC-01-0270 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0270 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  14. NCBI nr-aa BLAST: CBRC-OANA-01-2222 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2222 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  15. NCBI nr-aa BLAST: CBRC-STRI-01-0288 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-0288 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  16. NCBI nr-aa BLAST: CBRC-PTRO-08-0108 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-08-0108 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  17. NCBI nr-aa BLAST: CBRC-BTAU-01-3029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-3029 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  18. NCBI nr-aa BLAST: CBRC-OPRI-01-1483 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1483 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  19. NCBI nr-aa BLAST: CBRC-OLAT-17-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-17-0007 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  20. NCBI nr-aa BLAST: CBRC-TGUT-04-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-04-0021 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  1. NCBI nr-aa BLAST: CBRC-TTRU-01-0517 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0517 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  2. NCBI nr-aa BLAST: CBRC-MDOM-08-0183 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0183 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  3. NCBI nr-aa BLAST: CBRC-PABE-08-0088 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-08-0088 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  4. NCBI nr-aa BLAST: CBRC-PCAP-01-1173 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1173 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  5. NCBI nr-aa BLAST: CBRC-RMAC-03-0095 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-03-0095 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  6. NCBI nr-aa BLAST: CBRC-CJAC-01-1487 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1487 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  7. NCBI nr-aa BLAST: CBRC-HSAP-07-0119 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0119 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  8. NCBI nr-aa BLAST: CBRC-PHAM-01-0302 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0302 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  9. NCBI nr-aa BLAST: CBRC-GGOR-01-0882 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0882 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  10. NCBI nr-aa BLAST: CBRC-GACU-03-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-03-0030 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  11. NCBI nr-aa BLAST: CBRC-MMUS-12-0042 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-12-0042 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  12. NCBI nr-aa BLAST: CBRC-RNOR-06-0143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-06-0143 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  13. NCBI nr-aa BLAST: CBRC-FCAT-01-1123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1123 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  14. NCBI nr-aa BLAST: CBRC-PVAM-01-0362 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0362 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  15. NCBI nr-aa BLAST: CBRC-OCUN-01-0717 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0717 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  16. NCBI nr-aa BLAST: CBRC-MEUG-01-2450 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2450 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  17. NCBI nr-aa BLAST: CBRC-TSYR-01-0401 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0401 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  18. NCBI nr-aa BLAST: CBRC-XTRO-01-3195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3195 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  19. NCBI nr-aa BLAST: CBRC-PHAM-01-0310 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0310 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  20. NCBI nr-aa BLAST: CBRC-OGAR-01-0792 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0792 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  1. NCBI nr-aa BLAST: CBRC-MLUC-01-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0140 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  2. NCBI nr-aa BLAST: CBRC-CFAM-16-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-16-0043 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  3. NCBI nr-aa BLAST: CBRC-GGAL-02-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-02-0009 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  4. NCBI nr-aa BLAST: CBRC-FRUB-02-0696 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0696 gb|AAP36781.1| Homo sapiens vasoactive intestinal peptide recepto...r 2 [synthetic construct] gb|AAX43622.1| vasoactive intestinal peptide receptor 2 [synthetic construct] gb|AAX43623.1| vasoactive

  5. Enhancing pediatric workforce diversity and providing culturally effective pediatric care: implications for practice, education, and policy making.

    Science.gov (United States)

    2013-10-01

    This policy statement serves to combine and update 2 previously independent but overlapping statements from the American Academy of Pediatrics (AAP) on culturally effective health care (CEHC) and workforce diversity. The AAP has long recognized that with the ever-increasing diversity of the pediatric population in the United States, the health of all children depends on the ability of all pediatricians to practice culturally effective care. CEHC can be defined as the delivery of care within the context of appropriate physician knowledge, understanding, and appreciation of all cultural distinctions, leading to optimal health outcomes. The AAP believes that CEHC is a critical social value and that the knowledge and skills necessary for providing CEHC can be taught and acquired through focused curricula across the spectrum of lifelong learning. This statement also addresses workforce diversity, health disparities, and affirmative action. The discussion of diversity is broadened to include not only race, ethnicity, and language but also cultural attributes such as gender, religious beliefs, sexual orientation, and disability, which may affect the quality of health care. The AAP believes that efforts must be supported through health policy and advocacy initiatives to promote the delivery of CEHC and to overcome educational, organizational, and other barriers to improving workforce diversity.

  6. Blonanserin Augmentation of Atypical Antipsychotics in Patients with Schizophrenia-Who Benefits from Blonanserin Augmentation?: An Open-Label, Prospective, Multicenter Study

    National Research Council Canada - National Science Library

    Woo, Young Sup; Park, Joo Eon; Kim, Do-Hoon; Sohn, Inki; Hwang, Tae-Yeon; Park, Young-Min; Jon, Duk-In; Jeong, Jong-Hyun; Bahk, Won-Myong

    2016-01-01

    ...) with augmentation by blonanserin in schizophrenic patients. aA total of 100 patients with schizophrenia who were partially or completely unresponsive to treatment with an AAP were recruited in this 12-week, open-label, non-comparative, multicenter study...

  7. NCBI nr-aa BLAST: CBRC-MDOM-03-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-03-0052 sp|Q86UP3|ZFHX4_HUMAN RecName: Full=Zinc finger homeobox protein ...4; AltName: Full=Zinc finger homeodomain protein 4; Short=ZFH-4 gb|AAP20225.1| zinc finger homeodomain 4 protein [Homo sapiens] Q86UP3 0.0 91% ...

  8. Enhancing School Asthma Action Plans: Qualitative Results from Southeast Minnesota Beacon Stakeholder Groups

    Science.gov (United States)

    Egginton, Jason S.; Textor, Lauren; Knoebel, Erin; McWilliams, Deborah; Aleman, Marty; Yawn, Barbara

    2013-01-01

    Background: This study explores ways southeast Minnesota schools currently address asthma problems, identifies areas for improvement, and assesses the potential value of asthma action plans (AAPs) in schools. Methods: Focus groups were used to query stakeholder groups on asthma care in schools. Groups were held separately for elementary school…

  9. NCBI nr-aa BLAST: CBRC-XTRO-01-3773 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3773 ref|YP_003772.1| myristylated membrane protein [Ambystoma tigrinu...m virus] gb|AAP33178.1| myristylated membrane protein [Ambystoma tigrinum stebbensi virus] YP_003772.1 0.13 56% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-3553 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3553 ref|YP_003772.1| myristylated membrane protein [Ambystoma tigrinu...m virus] gb|AAP33178.1| myristylated membrane protein [Ambystoma tigrinum stebbensi virus] YP_003772.1 2.4 53% ...

  11. NCBI nr-aa BLAST: CBRC-XTRO-01-2527 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2527 ref|YP_003772.1| myristylated membrane protein [Ambystoma tigrinu...m virus] gb|AAP33178.1| myristylated membrane protein [Ambystoma tigrinum stebbensi virus] YP_003772.1 0.035 56% ...

  12. NCBI nr-aa BLAST: CBRC-XTRO-01-0562 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0562 ref|YP_003772.1| myristylated membrane protein [Ambystoma tigrinu...m virus] gb|AAP33178.1| myristylated membrane protein [Ambystoma tigrinum stebbensi virus] YP_003772.1 0.045 56% ...

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-0480 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0480 ref|YP_003772.1| myristylated membrane protein [Ambystoma tigrinu...m virus] gb|AAP33178.1| myristylated membrane protein [Ambystoma tigrinum stebbensi virus] YP_003772.1 0.045 56% ...

  14. NCBI nr-aa BLAST: CBRC-XTRO-01-0714 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0714 ref|YP_003772.1| myristylated membrane protein [Ambystoma tigrinu...m virus] gb|AAP33178.1| myristylated membrane protein [Ambystoma tigrinum stebbensi virus] YP_003772.1 0.035 56% ...

  15. Drosophila melanogaster females restore their attractiveness after mating by removing male anti-aphrodisiac pheromones

    NARCIS (Netherlands)

    Laturney, Meghan; Billeter, Jean-Christophe

    2016-01-01

    Males from many species ensure paternity by preventing their mates from copulating with other males. One mate-guarding strategy involves marking females with anti-aphrodisiac pheromones (AAPs), which reduces the females' attractiveness and dissuades other males from courting. Since females benefit f

  16. Drosophila melanogaster females restore their attractiveness after mating by removing male anti-aphrodisiac pheromones.

    Science.gov (United States)

    Laturney, Meghan; Billeter, Jean-Christophe

    2016-08-03

    Males from many species ensure paternity by preventing their mates from copulating with other males. One mate-guarding strategy involves marking females with anti-aphrodisiac pheromones (AAPs), which reduces the females' attractiveness and dissuades other males from courting. Since females benefit from polyandry, sexual conflict theory predicts that females should develop mechanisms to counteract AAPs to achieve additional copulations, but no such mechanisms have been documented. Here we show that during copulation Drosophila melanogaster males transfer two AAPs: cis-Vaccenyl Acetate (cVA) to the females' reproductive tract, and 7-Tricosene (7-T) to the females' cuticle. A few hours after copulation, females actively eject cVA from their reproductive tract, which results in increased attractiveness and re-mating. Although 7-T remains on those females, we show that it is the combination of the two chemicals that reduces attractiveness. To our knowledge, female AAP ejection provides the first example of a female mechanism that counter-acts chemical mate-guarding.

  17. Concurrent Validity of the Battelle Developmental Inventory for Speech and Language Disordered Children.

    Science.gov (United States)

    Mott, Stacey E.

    1987-01-01

    Investigated the concurrent validity of the Battelle Developmental Inventory (BDI) with speech and language disordered preschool children. Used the Peabody Picture Vocabulary Test-Revised (PPVT-R), Preschool Language Scale-Revised (PLS-R), and Arizona Articulation Proficiency Scale-Revised (AAPS-R). Significant correlations were found for…

  18. Rundum artist-run space and its elusive form / Hanna Laura Kaljo, Mari-Leen Kiipli, Kulla Laas ... [jt.

    Index Scriptorium Estoniae

    2015-01-01

    Rundum on 2013. a septembris Tallinnas loodud liikuv loominguline platvorm, mille eesmärgiks on suhestuda erinevate kohtadega, reageerida tühikutele Eesti loomemaastikus ning uurida sealjuures ka omaalgatuslike praktikate võimalikkust kohalikus kontekstis. Vestlusringis Rundumi algatajad Mari-Leen Kiipli, Kulla Laas, Aap Tepper, Mari Volens, Kristina Õllek

  19. Early childhood adversity, toxic stress, and the role of the pediatrician: translating developmental science into lifelong health.

    Science.gov (United States)

    Garner, Andrew S; Shonkoff, Jack P

    2012-01-01

    Advances in a wide range of biological, behavioral, and social sciences are expanding our understanding of how early environmental influences (the ecology) and genetic predispositions (the biologic program) affect learning capacities, adaptive behaviors, lifelong physical and mental health, and adult productivity. A supporting technical report from the American Academy of Pediatrics (AAP) presents an integrated ecobiodevelopmental framework to assist in translating these dramatic advances in developmental science into improved health across the life span. Pediatricians are now armed with new information about the adverse effects of toxic stress on brain development, as well as a deeper understanding of the early life origins of many adult diseases. As trusted authorities in child health and development, pediatric providers must now complement the early identification of developmental concerns with a greater focus on those interventions and community investments that reduce external threats to healthy brain growth. To this end, AAP endorses a developing leadership role for the entire pediatric community-one that mobilizes the scientific expertise of both basic and clinical researchers, the family-centered care of the pediatric medical home, and the public influence of AAP and its state chapters-to catalyze fundamental change in early childhood policy and services. AAP is committed to leveraging science to inform the development of innovative strategies to reduce the precipitants of toxic stress in young children and to mitigate their negative effects on the course of development and health across the life span.

  20. Infection and inflammatory mechanisms

    NARCIS (Netherlands)

    Van Dyke, Thomas E.; van Winkelhoff, Arie Jan

    2013-01-01

    This introductory article examines the potential mechanisms that may play a role in the associations between periodontitis and the systemic conditions being considered in the EFP/AAP Workshop in Segovia, Spain. Three basic mechanisms have been postulated to play a role in these interactions; metasta

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1085 ref|NP_829355.1| hypothetical protein CCA00489 [Chlamydophila cav...iae GPIC] gb|AAP05233.1| conserved hypothetical protein [Chlamydophila caviae GPIC] NP_829355.1 0.26 23% ...

  2. NCBI nr-aa BLAST: CBRC-MMUR-01-1465 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1465 ref|NP_829134.1| hypothetical protein CCA00261 [Chlamydophila cav...iae GPIC] gb|AAP05012.1| conserved hypothetical protein [Chlamydophila caviae GPIC] NP_829134.1 1.7 35% ...

  3. NCBI nr-aa BLAST: CBRC-RMAC-03-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-03-0003 ref|NP_829413.1| ribonuclease BN family protein [Chlamydophila ca...viae GPIC] gb|AAP05291.1| ribonuclease BN family protein [Chlamydophila caviae GPIC] NP_829413.1 0.006 23% ...

  4. TEMPLATE POLYMERIZATION OF N-VINYLIMIDAZOLE ALONG POLY(METHACRYLIC ACID) IN WATER .2. KINETICS OF THE TEMPLATE POLYMERIZATION

    NARCIS (Netherlands)

    VANDEGRAMPEL, HT; TAN, YY; CHALLA, G

    1991-01-01

    The template polymerization of N-vinylimidazole (VIm) along poly(methacrylic acid) (PMAA) in water at 50-degrees-C with 2,2'-azobis(2-amidinopropane).2HCl (AAP) as initiator was studied by using variable initiator and monomer concentrations at constant [PMAA]/[VIm]0. From the order in [VIm] it was c

  5. Eesti paviljon "Koda" = Estonian pavilion "Koda"

    Index Scriptorium Estoniae

    2015-01-01

    Eesti paviljon "Koda" Hollandi maailmanäitusel "Floriade". Arhitektuurivõistlus 2011. Arhitektid Joel Kopli, Koit Ojaliiv (Kuu Arhitektid), konstruktorid Alar Hammer, Marek Suursalu (Projekt 363). Lauad Kristel Jakobson (Haka Disain), toolid Aap Piho (Maast Furniture), valgustid Margus Triibmann (Keha3)

  6. NCBI nr-aa BLAST: CBRC-HSAP-19-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  7. NCBI nr-aa BLAST: CBRC-DRER-05-0079 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  8. NCBI nr-aa BLAST: CBRC-MMUS-10-0067 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  9. NCBI nr-aa BLAST: CBRC-RNOR-07-0201 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  10. NCBI nr-aa BLAST: CBRC-TTRU-01-0910 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available : Full=Metastin receptor; AltName: Full=G-protein coupled receptor 54; AltName: Full=Hypogonadotropin-1; Sho...rt=hOT7T175 emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  11. NCBI nr-aa BLAST: CBRC-MMUR-01-0983 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available : Full=Metastin receptor; AltName: Full=G-protein coupled receptor 54; AltName: Full=Hypogonadotropin-1; Sho...rt=hOT7T175 emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  12. NCBI nr-aa BLAST: CBRC-MLUC-01-0822 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available : Full=Metastin receptor; AltName: Full=G-protein coupled receptor 54; AltName: Full=Hypogonadotropin-1; Sho...rt=hOT7T175 emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  13. NCBI nr-aa BLAST: CBRC-PVAM-01-0946 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available receptor [Homo sapiens] gb|AAP82929.1| hypogonadotropin-1 [Homo sapiens] gb|EAW69583.1| KISS1 receptor [Homo sapiens] gb|AAI40826.1| KISS1 receptor [Homo sapiens] AAK83235.1 0.0 84% ...

  14. NCBI nr-aa BLAST: CBRC-CFAM-20-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  15. Gene : CBRC-RMAC-19-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogonadotropin-1) (hOT7T175) emb|CAC4...0817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogonadotropin

  16. NCBI nr-aa BLAST: CBRC-TTRU-01-0910 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available receptor [Homo sapiens] gb|AAP82929.1| hypogonadotropin-1 [Homo sapiens] gb|EAW69583.1| KISS1 receptor [Homo sapiens] gb|AAI40826.1| KISS1 receptor [Homo sapiens] AAK83235.1 0.0 87% ...

  17. Gene : CBRC-HSAP-19-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ceptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogonadotropin-1) (hOT7T175) emb|CAC40817.1| ...G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogonadotropin-1 [Homo

  18. NCBI nr-aa BLAST: CBRC-OPRI-01-0091 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available : Full=Metastin receptor; AltName: Full=G-protein coupled receptor 54; AltName: Full=Hypogonadotropin-1; Sho...rt=hOT7T175 emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  19. NCBI nr-aa BLAST: CBRC-OGAR-01-0646 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  20. NCBI nr-aa BLAST: CBRC-PABE-20-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  1. NCBI nr-aa BLAST: CBRC-OANA-01-0680 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  2. NCBI nr-aa BLAST: CBRC-PTRO-20-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  3. NCBI nr-aa BLAST: CBRC-BTAU-01-1994 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  4. NCBI nr-aa BLAST: CBRC-RMAC-19-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  5. NCBI nr-aa BLAST: CBRC-OANA-01-1928 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0253 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Q969F8|KISSR_HUMAN KiSS-1 receptor (KiSS-1R) (Kisspeptins receptor) (Metastin receptor) (G-protein coupled receptor 54) (Hypogona...dotropin-1) (hOT7T175) emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  7. Gene : CBRC-MMUR-01-0983 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available pled receptor 54; AltName: Full=Hypogonadotropin-1; Short=hOT7T175 emb|CAC40817.1...| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogonadotropin-1 [Homo sapiens] gb|AAI41813.1|

  8. NCBI nr-aa BLAST: CBRC-MLUC-01-0822 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available receptor [Homo sapiens] gb|AAP82929.1| hypogonadotropin-1 [Homo sapiens] gb|EAW69583.1| KISS1 receptor [Homo sapiens] gb|AAI40826.1| KISS1 receptor [Homo sapiens] AAK83235.1 0.0 88% ...

  9. NCBI nr-aa BLAST: CBRC-PVAM-01-0946 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available : Full=Metastin receptor; AltName: Full=G-protein coupled receptor 54; AltName: Full=Hypogonadotropin-1; Sho...rt=hOT7T175 emb|CAC40817.1| G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogona

  10. Gene : CBRC-MLUC-01-0822 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ed receptor 54; AltName: Full=Hypogonadotropin-1; Short=hOT7T175 emb|CAC40817.1| ...G protein-coupled receptor [Homo sapiens] gb|AAP82930.1| hypogonadotropin-1 [Homo sapiens] gb|AAI41813.1| KI

  11. Stripping Voltammetric Determination of Analgesics in Their Pharmaceuticals Using Nano-Riboflavin-Modified Glassy Carbon Electrode

    Directory of Open Access Journals (Sweden)

    Gopalakrishnan Gopu

    2011-01-01

    Full Text Available Cyclic voltammetric behaviors of three analgesics, acetaminophen (AAP, acetylsalicylic acid (ASA, and dipyrone (DP, were studied using nano-riboflavin-modified glassy carbon electrode. One well-defined oxidation peak each for AAP and ASA and three oxidation peaks for DP were observed. The influence of pH, scan rate, and concentration reveals irreversible diffusion controlled reaction. The SEM analysis confirmed good accumulation of the drugs on the electrode surface. Calibration was made under the maximum peak current conditions. The concentration range studied for the determination of drugs was 0.02 to 0.4 μg mL−1 for AAP and ASA and 0.025 to 0.4 μg mL−1 for DP. The lower limit of detection observed for AAP, ASA, and DP was 0.016, 0.007 μg mL−1, and 0.013 μg mL−1, respectively. The suitability of the method for the determination of these analgesics in pharmaceutical preparations and urine samples was also ascertained.

  12. NCBI nr-aa BLAST: CBRC-ETEL-01-0133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0133 ref|NP_874194.1| putative enterobacterial common antigen polymerase [Haemophilus... ducreyi 35000HP] gb|AAP96583.1| putative polysaccharide biosynthesis protein [Haemophilus ducreyi 35000HP] NP_874194.1 1.9 29% ...

  13. NCBI nr-aa BLAST: CBRC-LAFR-01-1699 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1699 ref|NP_874008.1| putative sodium/alanine symporter [Haemophilus d...ucreyi 35000HP] gb|AAP96397.1| putative sodium/alanine symporter [Haemophilus ducreyi 35000HP] NP_874008.1 2.0 23% ...

  14. NCBI nr-aa BLAST: CBRC-XTRO-01-2525 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2525 ref|NP_873727.1| rod shape-determining protein MreD [Haemophilus ...ducreyi 35000HP] gb|AAP96116.1| rod shape-determining protein MreD [Haemophilus ducreyi 35000HP] NP_873727.1 0.35 24% ...

  15. NCBI nr-aa BLAST: CBRC-ACAR-01-0210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0210 ref|NP_873236.1| branched-chain amino acid carrier protein [Haemophilus... ducreyi 35000HP] gb|AAP95625.1| branched-chain amino acid carrier protein [Haemophilus ducreyi 35000HP] NP_873236.1 1.2 22% ...

  16. Assessing Attachment Representations in Adolescents: Discriminant Validation of the Adult Attachment Projective Picture System.

    Science.gov (United States)

    Gander, Manuela; George, Carol; Pokorny, Dan; Buchheim, Anna

    2017-04-01

    The contribution of attachment to human development and clinical risk is well established for children and adults, yet there is relatively limited knowledge about attachment in adolescence due to the poor availability of construct valid measures. The Adult Attachment Projective Picture System (AAP) is a reliable and valid instrument to assess adult attachment status. This study examines for the first time the discriminant validity of the AAP in adolescents. In our sample of 79 teenagers between 15 and 18 years, 42 % were classified as secure, 34 % as insecure-dismissing, 13 % as insecure-preoccupied and 11 % as unresolved. The results demonstrated discriminant validity for using the AAP in that age group, with no associations between attachment classifications and verbal intelligence, social desirability, story length or sociodemographic variables. These results poise the AAP to be used in clinical intervention and large-scale research investigating normative and atypical developmental correlates and sequelae of attachment, including psychopathology in adolescence.

  17. Southeast Asia Report. No. 1316

    Science.gov (United States)

    1983-07-25

    imcompetent or irresponsible." -AAP. CSO: 4200/661 23 PAPUA NEW GUINEA PENALITIES BOOSTED ON CRIME, TRIBAL FIGHTS Melbourne THE AGE in...Rogelio Langelas. The identifies of the five students were not available. Wounded were CHDF members Narciso Ocayu and Proceso Ocayu. The five

  18. Screen Time May Not Be So Bad for Teens After All

    Science.gov (United States)

    ... screen time appear unlikely to have significant negative effect." However, several child health experts said they weren't ready to ... AAP encourages parents to sit down with their children and calculate how many ... key health behaviors -- like sleep and school and social activities -- and ...

  19. Membrane-bound proteases of the gerbil subfornical organ and choroid plexus: an enzyme histochemical study.

    Science.gov (United States)

    Mitro, A; De Bault, L E

    1994-03-01

    Using enzyme-histochemical methods, the membrane-bound peptidases, gamma-glutamyl transpeptidase (gamma-GTP), microsomal alanyl aminopeptidase (mAAP), glutamyl aminopeptidase (EAP), and dipeptidyl peptidase IV (DPP IV), were studied in microvessels of the gerbil subfornical organ (SFO), choroid plexus adjacent to the SFO, and the ependyma of brain ventricle walls in the vicinity of the SFO. Vessels and microvessels of gerbil SFO and choroid plexus were positive for gamma-GTP, mAAP, and EAP, but negative for DPP IV. Blood-brain barrier (BBB) microvessels in the surrounding brain tissue also showed positive reactions for gamma-GTP, mAAP, and EAP but a negative reaction for DPP IV. Both epithelial cells of the choroid plexus and ependymal cells of the ventricle walls were negative for all four studied enzymes. It is suggested that blood-borne peptide hormones which can be substrates for these membrane-bound proteases can be modulated by gamma-GTP, mAAP, and EAP, but not by DPP IV, when they come in contact with the plasma membrane of the endothelial cells of the vessels in gerbil SFO, choroid plexus, and surrounding brain tissue.

  20. NCBI nr-aa BLAST: CBRC-PMAR-01-0463 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0463 ref|NP_833085.1| Collagen-like triple helix repeat protein [Bacil...lus cereus ATCC 14579] gb|AAP10286.1| Collagen-like triple helix repeat protein [Bacillus cereus ATCC 14579] NP_833085.1 5e-32 37% ...

  1. Diversity of cultivated and metabolically active aerobic anoxygenic phototrophic bacteria along an oligotrophic gradient in the Mediterranean Sea

    Directory of Open Access Journals (Sweden)

    C. Jeanthon

    2011-07-01

    Full Text Available Aerobic anoxygenic phototrophic (AAP bacteria play significant roles in the bacterioplankton productivity and biogeochemical cycles of the surface ocean. In this study, we applied both cultivation and mRNA-based molecular methods to explore the diversity of AAP bacteria along an oligotrophic gradient in the Mediterranean Sea in early summer 2008. Colony-forming units obtained on three different agar media were screened for the production of bacteriochlorophyll-a (BChl-a, the light-harvesting pigment of AAP bacteria. BChl-a-containing colonies represented a low part of the cultivable fraction. In total, 54 AAP strains were isolated and the phylogenetic analyses based on their 16S rRNA and pufM genes showed that they were all affiliated to the Alphaproteobacteria. The most frequently isolated strains belonged to Citromicrobium bathyomarinum, and Erythrobacter and Roseovarius species. Most other isolates were related to species not reported to produce BChl-a and/or may represent novel taxa. Direct extraction of RNA from seawater samples enabled the analysis of the expression of pufM, the gene coding for the M subunit of the reaction centre complex of aerobic anoxygenic photosynthesis. Clone libraries of pufM gene transcripts revealed that most phylotypes were highly similar to sequences previously recovered from the Mediterranean Sea and a large majority (~94 % was affiliated to the Gammaproteobacteria. The most abundantly detected phylotypes occurred in the western and eastern Mediterranean basins. However, some were exclusively detected in the eastern basin, reflecting the highest diversity of pufM transcripts observed in this ultra-oligotrophic region. To our knowledge, this is the first study to document extensively the diversity of AAP isolates and to unveil the active AAP community in an oligotrophic marine environment. By pointing out the discrepancies

  2. Smartphone-based vs paper-based asthma action plans for adolescents.

    Science.gov (United States)

    Perry, Tamara T; Marshall, Alexandra; Berlinski, Ariel; Rettiganti, Mallikarjuna; Brown, Rita H; Randle, Shemeka M; Luo, Chunqiao; Bian, Jiang

    2017-03-01

    Adolescents with asthma are at risk of poor outcomes and are traditionally difficult to reach. To examine adolescents' use of and asthma outcomes associated with smartphone- vs paper-based asthma action plans (AAPs). We conducted a 6-month randomized clinical trial with adolescents (12-17 years old) with persistent asthma. Participants used their respective smartphone or paper AAPs for medication instructions and peak flow or asthma symptoms logging. AAP use was measured electronically for smartphone users and via mail-in diaries for the paper group. Changes in Asthma Control Test (ACT) and self-efficacy scores were examined. Thirty-four adolescents participated in this study (median age, 15.4 years). Participants were mostly African American (62%) with state-issued insurance (71%). Adolescents in the smartphone group accessed the AAP a median of 12.17 times per week or 4.36 days per week but only recorded medications or symptoms and peak flow data in the electronic diary a median of 10 days per month during the 6-month period. Participants in the paper group recorded data a median of 23.5 days per month on their paper diaries. Overall, there were no changes in ACT and self-efficacy scores between groups. Adolescents with uncontrolled asthma (baseline ACT score ≤19) had an improvement in ACT for the smartphone group (before, 11; after, 20) ([P = .04) compared with no change in the paper group (before, 17; after, 17) (P = .64). Adolescent satisfaction with the application was high, with 100% stating they would recommend the smartphone AAP to a friend. Adolescents were frequent and highly satisfied users of the smartphone AAP with a subset of participants with uncontrolled asthma demonstrating possible clinical benefit. Findings suggest a need for larger-scale studies to determine the effectiveness of smartphone-based AAPs among high-risk patients with asthma. clinicaltrials.gov Identifier: NCT02091869. Copyright © 2016 American College of Allergy, Asthma

  3. Role of symbiotic auxotrophy in the Rhizobium-legume symbioses.

    Directory of Open Access Journals (Sweden)

    Jurgen Prell

    Full Text Available Rhizobium leguminosarum bv. viciae mutants unable to transport branched-chain amino acids via the two main amino acid ABC transport complexes AapJQMP and BraDEFGC produce a nitrogen starvation phenotype when inoculated on pea (Pisum sativum plants [1], [2]. Bacteroids in indeterminate pea nodules have reduced abundance and a lower chromosome number. They reduce transcription of pathways for branched-chain amino acid biosynthesis and become dependent on their provision by the host. This has been called "symbiotic auxotrophy".A region important in solute specificity was identified in AapQ and changing P144D in this region reduced branched-chain amino acid transport to a very low rate. Strains carrying P144D were still fully effective for N(2 fixation on peas demonstrating that a low rate of branched amino acid transport in R. leguminosarum bv. viciae supports wild-type rates of nitrogen fixation. The importance of branched-chain amino acid transport was then examined in other legume-Rhizobium symbioses. An aap bra mutant of R. leguminosarum bv. phaseoli also showed nitrogen starvation symptoms when inoculated on French bean (Phaseolus vulgaris, a plant producing determinate nodules. The phenotype is different from that observed on pea and is accompanied by reduced nodule numbers and nitrogen fixation per nodule. However, an aap bra double mutant of Sinorhizobium meliloti 2011 showed no phenotype on alfalfa (Medicago sativa.Symbiotic auxotrophy occurs in both determinate pea and indeterminate bean nodules demonstrating its importance for bacteroid formation and nodule function in legumes with different developmental programmes. However, only small quantities of branched chain amino acids are needed and symbiotic auxotrophy did not occur in the Sinorhizobium meliloti-alfalfa symbiosis under the conditions measured. The contrasting symbiotic phenotypes of aap bra mutants inoculated on different legumes probably reflects altered timing of amino acid

  4. Novel haloperoxidase from the agaric basidiomycete Agrocybe aegerita oxidizes aryl alcohols and aldehydes.

    Science.gov (United States)

    Ullrich, René; Nüske, Jörg; Scheibner, Katrin; Spantzel, Jörg; Hofrichter, Martin

    2004-08-01

    Agrocybe aegerita, a bark mulch- and wood-colonizing basidiomycete, was found to produce a peroxidase (AaP) that oxidizes aryl alcohols, such as veratryl and benzyl alcohols, into the corresponding aldehydes and then into benzoic acids. The enzyme also catalyzed the oxidation of typical peroxidase substrates, such as 2,6-dimethoxyphenol (DMP) or 2,2'-azinobis-(3-ethylbenzothiazoline-6-sulfonate) (ABTS). A. aegerita peroxidase production depended on the concentration of organic nitrogen in the medium, and highest enzyme levels were detected in the presence of soybean meal. Two fractions of the enzyme, AaP I and AaP II, which had identical molecular masses (46 kDa) and isoelectric points of 4.6 to 5.4 and 4.9 to 5.6, respectively (corresponding to six different isoforms), were identified after several steps of purification, including anion- and cation-exchange chromatography. The optimum pH for the oxidation of aryl alcohols was found to be around 7, and the enzyme required relatively high concentrations of H(2)O(2) (2 mM) for optimum activity. The apparent K(m) values for ABTS, DMP, benzyl alcohol, veratryl alcohol, and H(2)O(2) were 37, 298, 1,001, 2,367 and 1,313 microM, respectively. The N-terminal amino acid sequences of the main AaP II spots blotted after two-dimensional gel electrophoresis were almost identical and exhibited almost no homology to the sequences of other peroxidases from basidiomycetes, but they shared the first three amino acids, as well as two additional amino acids, with the heme chloroperoxidase (CPO) from the ascomycete Caldariomyces fumago. This finding is consistent with the fact that AaP halogenates monochlorodimedone, the specific substrate of CPO. The existence of haloperoxidases in basidiomycetous fungi may be of general significance for the natural formation of chlorinated organic compounds in forest soils.

  5. Effects of the Adult Attachment Projective Picture System on Oxytocin and Cortisol Blood Levels in Mothers

    Science.gov (United States)

    Krause, Sabrina; Pokorny, Dan; Schury, Katharina; Doyen-Waldecker, Cornelia; Hulbert, Anna-Lena; Karabatsiakis, Alexander; Kolassa, Iris-Tatjana; Gündel, Harald; Waller, Christiane; Buchheim, Anna

    2016-01-01

    Oxytocin, a small neuropeptide of nine amino acids, has been characterized as the “hormone of affiliation” and is stimulated, for instance, in mothers when interacting with their offspring. Variations in maternal oxytocin levels were reported to predict differences in the quality of care provided by mothers. In this study, the Adult Attachment Projective Picture System (AAP) as a valid measure to assess attachment representations was used as an activating attachment-related stimulus. We investigated whether the AAP induces a release of oxytocin in mothers with a secure attachment representation and a stress-related cortisol response in mothers with an insecure attachment representation. Therefore, pre-post effects of AAP administration on plasma oxytocin and serum cortisol levels were investigated in n = 44 mothers 3 months after parturition. Oxytocin levels increased from pre to post in the significant majority of 73% participants (p = 0.004) and cortisol decreased in the significant majority of 73% participants (p = 0.004). Interestingly, no association between alterations in oxytocin and cortisol were found; this suggests taking a model of two independent processes into considerations. These results show that the AAP test procedure induces an oxytocin response. Concerning the results within the four AAP representation subgroups, our hypothesis of a particularly strong increase in oxytocin in secure mothers was not confirmed; however, in secure mothers we observed a particularly strong decrease in cortisol. Effect sizes are reported, allowing the replication of results in a larger study with sufficient sample size to draw final conclusions with respect to differences in OT and cortisol alterations depending on attachment representation. When interpreting the results, one should keep in mind that this study investigated lactating mothers. Thus, the generalizability of results is limited and future studies should investigate non-lactating healthy females as

  6. The Effect of Secretory Factors of Adipose-Derived Stem Cells on Human Keratinocytes

    Directory of Open Access Journals (Sweden)

    Soo-Wan Nam

    2012-01-01

    Full Text Available The beneficial effects of adipose-derived stem cell conditioned medium (ADSC-CM on skin regeneration have been reported. Although the mechanism of how ADSC-CM promotes skin regeneration is unclear, ADSC-CM contained various growth factors and it is an excellent raw material for skin treatment. ADSC-CM produced in a hypoxia condition of ADSC—in other words, Advanced Adipose-Derived Stem cell Protein Extract (AAPE—has great merits for skin regeneration. In this study, human primary keratinocytes (HKs, which play fundamental roles in skin tissue, was used to examine how AAPE affects HK. HK proliferation was significantly higher in the experimental group (1.22 μg/mL than in the control group. DNA gene chip demonstrated that AAPE in keratinocytes (p < 0.05 notably affected expression of 290 identified transcripts, which were associated with cell proliferation, cycle and migration. More keratinocyte wound healing and migration was shown in the experimental group (1.22 μg/mL. AAPE treatment significantly stimulated stress fiber formation, which was linked to the RhoA-ROCK pathway. We identified 48 protein spots in 2-D gel analysis and selected proteins were divided into 64% collagen components and 30% non-collagen components as shown by the MALDI-TOF analysis. Antibody array results contained growth factor/cytokine such as HGF, FGF-1, G-CSF, GM-CSF, IL-6, VEGF, and TGF-β3 differing from that shown by 2-D analysis. Conclusion: AAPE activates HK proliferation and migration. These results highlight the potential of the topical application of AAPE in the treatment of skin regeneration.

  7. Chemically induced hepatotoxicity in human stem cell-induced hepatocytes compared with primary hepatocytes and HepG2.

    Science.gov (United States)

    Kang, Seok-Jin; Lee, Hyuk-Mi; Park, Young-Il; Yi, Hee; Lee, Hunjoo; So, ByungJae; Song, Jae-Young; Kang, Hwan-Goo

    2016-10-01

    Stem cell-induced hepatocytes (SC-iHeps) have been suggested as a valuable model for evaluating drug toxicology. Here, human-induced pluripotent stem cells (QIA7) and embryonic stem cells (WA01) were differentiated into hepatocytes, and the hepatotoxic effects of acetaminophen (AAP) and aflatoxin B1 (AFB1) were compared with primary hepatocytes (p-Heps) and HepG2. In a cytotoxicity assay, the IC50 of SC-iHeps was similar to that in p-Heps and HepG2 in the AAP groups but different from that in p-Heps of the AFB1 groups. In a multi-parameter assay, phenotypic changes in mitochondrial membrane potential, calcium influx and oxidative stress were similar between QIA7-iHeps and p-Heps following AAP and AFB1 treatment but relatively low in WA01-iHeps and HepG2. Most hepatic functional markers (hepatocyte-specific genes, albumin/urea secretion, and the CYP450 enzyme activity) were decreased in a dose-dependent manner following AAP and AFB1 treatment in SC-iHeps and p-Heps but not in HepG2. Regarding CYP450 inhibition, the cell viability of SC-iHeps and p-Heps was increased by ketoconazole, a CYP3A4 inhibitor. Collectively, SC-iHeps and p-Heps showed similar cytotoxicity and hepatocyte functional effects for AAP and AFB1 compared with HepG2. Therefore, SC-iHeps have phenotypic characteristics and sensitivity to cytotoxic chemicals that are more similar to p-Heps than to HepG2 cells.

  8. Effects of the Adult Attachment Projective Picture System on oxytocin and cortisol blood levels in mothers

    Directory of Open Access Journals (Sweden)

    Sabrina Krause

    2016-12-01

    Full Text Available Oxytocin, a small neuropeptide of nine amino acids, has been characterized as the hormone of affiliation and is stimulated, for instance, in mothers when interacting with their offspring. Variations in maternal oxytocin levels were reported to predict differences in the quality of care provided by mothers. In this study, the Adult Attachment Projective Picture System (AAP as a valid measure to assess attachment representations was used as an activating attachment-related stimulus. We investigated whether the AAP induces a release of oxytocin in mothers with a secure attachment representation and a stress-related cortisol response in mothers with an insecure attachment representation. Therefore, pre-post effects of AAP administration on plasma oxytocin and serum cortisol levels were investigated in n = 44 mothers 3 months after parturition. Oxytocin levels increased from pre to post by the significant majority of 73% participants (p = .004 and cortisol decreased by the significant majority of 73% participants (p = .004. Interestingly, no association between alterations in oxytocin and cortisol were found; this suggests taking a model of two independent processes into considerations. These results show that the AAP test procedure induces an oxytocin response. Concerning the results within the four AAP representation subgroups, our hypothesis of a particularly strong increase in oxytocin in secure mothers was not confirmed; however, in secure mothers we observed a particularly strong decrease in cortisol, consistent with our hypotheses. Effect sizes are reported, allowing the replication of results in a larger study with sufficient sample size to draw final conclusions with respect to differences in OT and cortisol alterations depending on attachment representation. When interpreting the results, one should keep in mind that this study investigated lactating mothers. Thus, the generalizability of results is limited and future studies should

  9. Clinical diagnosis and treatment of asparaginase associated pancreatitis in adults%成人门冬酶相关胰腺炎的临床诊治

    Institute of Scientific and Technical Information of China (English)

    李梦洁; 何牧卿; 沈益民

    2015-01-01

    目的 探讨成人门冬酶相关胰腺炎(AAP)的临床特点及诊治过程,旨在提高AAP诊治水平.方法 回顾性分析2009年1月至2015年6月间浙江医院血液内科及温州医科大学附属第二医院血液科收治的384例急性淋巴细胞白血病(ALL)患者的临床资料,所有患者均给予含培门冬酶或左旋门冬酰胺酶(L-asp)的多药联合化疗,分析AAP的发生情况、临床表现、诊断、治疗及转归.结果 384例ALL患者中18例发生AAP,发生率为4.7%,其中轻症AAP (MAAP) 13例,重症AAP(SAAP)5例.16例AAP发生在诱导化疗期,2例发生在维持强化期.腹痛为主要临床表现,血淀粉酶及脂肪酶活性均升高.治疗后,MAAP患者的腹痛症状缓解,血淀粉酶及脂肪酶活性明显下降,继续使用培门冬酶或L-asp化疗,未见胰腺炎复发.5例SAAP患者血淀粉酶及脂肪酶反复升高,其中1例因合并重症感染及囊肿破裂出血而病死.结论 成人ALL患者在门冬酶化疗期间出现腹痛症状应考虑AAP可能,加强血淀粉酶及脂肪酶检测,辅以B超和CT检查有助于早期诊治AAP,并改善患者预后.%Objective To investigate the clinical characteristics and the course of diagnosis and therapy of asparaginase associated pancreatitis (AAP) in adults, in order to improve the ability of diagnosis and treatment.Methods Data of 384 cases of acute lymphoblastic leukemia (ALL) who received treatment in Department of Hematology, Zhejiang Hospital, and Department of Hematology, Second Hospital Affiliated to Wenzhou Medical University from January 2009 to June 2015 was retrospectively analyzed.All patients were given multi-drug chemotherapy including PEG-asparaginase or L-asparaginase, the incidence of AAP, clinical manifestations, diagnosis, treatment and prognosis were analyzed.Results Among the 384 cases, 18 patients developed AAP, and the incidence of AAP was 4.7%, including 13 cases of mild AAP (MAAP), 5 cases of severe AAP (SAAP).Sixteen cases of

  10. Classification accuracy analysis of selected land use and land cover products in a portion of West-Central Lower Michigan

    Science.gov (United States)

    Ma, Kin Man

    2007-12-01

    Remote sensing satellites have been utilized to characterize and map land cover and its changes since the 1970s. However, uncertainties exist in almost all land use and land cover maps classified from remotely sensed images. In particular, it has been recognized that the spatial mis-registration of land cover maps can affect the true estimates of land use/land cover (LULC) changes. This dissertation addressed the following questions: what are the spatial patterns, magnitudes, and cover-dependencies of classification uncertainty associated with West-Central Lower Michigan's LULC products and how can the adverse effects of spatial misregistration on accuracy assessment be reduced? Two Michigan LULC products were chosen for comparison: 1998 Muskegon River Watershed (MRW) Michigan Resource Information Systems LULC map and a 2001 Integrated Forest Monitoring and Assessment Prescription Project (IFMAP). The 1m resolution 1998 MRW LULC map was derived from U.S. Geological Survey Digital Orthophoto Quarter Quadrangle (USGS DOQQs) color infrared imagery and was used as the reference map, since it has a thematic accuracy of 95%. The IFMAP LULC map was co-registered to a series of selected 1998 USGS DOQQs. The total combined root mean square error (rmse) distance of the georectified 2001 IFMAP was +/-12.20m. A spatial uncertainty buffer of at least 1.5 times the rmse was set at 20m so that polygon core areas would be unaffected by spatial misregistration noise. A new spatial misregistration buffer protocol (SPATIALM_ BUFFER) was developed to limit the effect of spatial misregistration on classification accuracy assessment. Spatial uncertainty buffer zones of 20m were generated around LULC polygons of both datasets. Eight-hundred seventeen (817) stratified random accuracy assessment points (AAPs) were generated across the 1998 MRW map. Classification accuracy and kappa statistics were generated for both the 817 AAPs and 604 AAPs comparisons. For the 817 AAPs comparison, the

  11. 门冬酰胺酶相关儿童急性胰腺炎诊治研究进展%Progress of diagnosis and treatment of asparaginase associated pancreatitis in children

    Institute of Scientific and Technical Information of China (English)

    石苇

    2016-01-01

    门冬酰胺酶(ASP)是儿童急性淋巴细胞白血病和非霍奇金淋巴瘤联合化疗方案中的关键药物之一.ASP相关急性胰腺炎(AAP)是ASP的主要严重不良反应.现通过复习有关儿童AAP的近年国内外文献和我国《培门冬酶治疗急性淋巴细胞白血病和恶性淋巴瘤的专家共识》,以及对网络收集的历年来我国儿童AAP报道资料进行归纳与统计分析,参照国际AAP诊断标准,提出儿童AAP流行病学、临床表现、早期诊断和有效治疗要点,以及左旋门冬酰胺酶和培门冬酶的AAP临床对比.全文资料数据详尽,分析归纳依据充分,相关经验的临床可操作性强,对临床有效诊治儿童AAP具有较大的参考价值.%Asparaginase(ASP) is an important drug in the treatment of childhood acute lymphoblastic leukemia and non-Hodgkin lymphoma.Asparaginase associated pancreatitis (AAP) is the main treatment-adverse events of asparaginase.After reviewing the recent foreign literatures about AAP and the Chinese expert about polyethylene glycol conjugated asparaginase (PEG-ASP) in the treatment of acute lymphoblastic leukemia and malignant lymphoma with asparaginase,conclude and analysis the data about childhood AAP and show the epidemiology,clinical features,early diagnosis and effective treatment of children with AAP.Make clinical compare of L-asparaginase and PEG-ASP.Based on the full grasp of the relevant data,analyzing,introducing and integrating,this may be helpful to the diagnosis and treatment of childhood AAP.

  12. Surveying college introductory physics students' attitudes and approaches to problem solving

    CERN Document Server

    Mason, Andrew

    2016-01-01

    Students' attitudes and approaches to problem solving in physics can greatly impact their actual problem solving practices and also influence their motivation to learn and ultimately the development of expertise. We developed and validated an attitudes and approaches to problem solving (AAPS) survey and administered it to students in the introductory physics courses in a typical large research university in the US. Here, we discuss the development and validation of the survey and analysis of the student responses to the survey questions in introductory physics courses. The introductory physics students' responses to the survey questions were also compared with those of physics faculty members and physics PhD students. We find that introductory students are in general less expert-like than the physics faculty members and PhD students. Moreover, on some AAPS survey questions, the responses of students and faculty have unexpected trends. Those trends were interpreted via in

  13. Level-2 Milestone 5588: Deliver Strategic Plan and Initial Scalability Assessment by Advanced Architecture and Portability Specialists Team

    Energy Technology Data Exchange (ETDEWEB)

    Draeger, Erik W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2016-09-30

    This report documents the fact that the work in creating a strategic plan and beginning customer engagements has been completed. The description of milestone is: The newly formed advanced architecture and portability specialists (AAPS) team will develop a strategic plan to meet the goals of 1) sharing knowledge and experience with code teams to ensure that ASC codes run well on new architectures, and 2) supplying skilled computational scientists to put the strategy into practice. The plan will be delivered to ASC management in the first quarter. By the fourth quarter, the team will identify their first customers within PEM and IC, perform an initial assessment and scalability and performance bottleneck for next-generation architectures, and embed AAPS team members with customer code teams to assist with initial portability development within standalone kernels or proxy applications.

  14. Asymmetric dimethylarginine in somatically healthy schizophrenia patients treated with atypical antipsychotics

    DEFF Research Database (Denmark)

    Jørgensen, Anders; Knorr, Ulla Benedichte Søsted; Soendergaard, Mia Greisen;

    2015-01-01

    and the L-arginine:ADMA ratio showed no correlations with oxidative stress markers, medication load, or Positive and Negative Syndrome Scale scores. CONCLUSIONS: Schizophrenia and treatment with AAP was not associated with increased levels of plasma ADMA or the L-arginine:ADMA ratio. Furthermore, plasma......BACKGROUND: Schizophrenia is associated with increased cardiovascular morbidity and mortality. Asymmetric dimethylarginine (ADMA), an endogenous inhibitor of the nitric oxide synthase, and the L-arginine:ADMA ratio are markers of endothelial dysfunction that predict mortality and adverse outcome...... in a range of cardiovascular disorders. Increased ADMA levels may also lead to increased oxidative stress. We hypothesized that ADMA and the L-arginine:ADMA ratio are increased in somatically healthy schizophrenia patients treated with atypical antipsychotics (AAP), and that the ADMA and the L-arginine: ADMA...

  15. Surveying Turkish high school and university student attitudes and approaches to physics problem solving

    CERN Document Server

    Balta, Nuri; Singh, Chandralekha

    2016-01-01

    Student attitudes and approaches to problem solving can impact how well they learn physics. Prior research in the US using a validated Attitude and Approaches to Problem Solving (AAPS) survey suggests that there are major differences between students in introductory physics and astronomy courses and physics experts in terms of their attitudes and approaches to physics problem solving. Here we discuss the validation, administration and analysis of data for the Turkish version of the AAPS survey for high school and university students in Turkey. After the validation and administration of the Turkish version of the survey, the analysis of the data was conducted by grouping the data by grade level, school type, and gender. While there are no statistically significant differences between the averages of various groups on the survey, overall, the university students in Turkey were more expert-like than vocational high school students. On an item by item basis, there are statistically differences between the average...

  16. Binding and conformational changes of human serum albumin upon interaction with 4-aminoantipyrine studied by spectroscopic methods and cyclic voltammetry.

    Science.gov (United States)

    Gowda, Jayant I; Nandibewoor, Sharanappa T

    2014-04-24

    The interactions of 4-aminoantipyrine (AAP) with human serum albumin (HSA) have been studied by UV-visible spectroscopy, fluorescence spectroscopy and cyclic voltammetry. The binding of 4-aminoantipyrine quenches the HSA fluorescence, revealing a 1:1 interaction with a binding constant of about 10(5) M(-1). The experimental results showed that AAP effectively quenched the intrinsic fluorescence of HSA via dynamic type of quenching. In addition, according to the synchronous fluorescence spectra of HSA in presence of 4-aminoantipyrine, the tryptophan residue of the proteins are most perturbed by the binding process. The number of binding sites, the binding constant, site probe study, some common metal ions effect and the thermodynamic parameters were calculated.

  17. Life without TV? cultivation theory and psychosocial health characteristics of television-free individuals and their television-viewing counterparts.

    Science.gov (United States)

    Hammermeister, Jon; Brock, Barbara; Winterstein, David; Page, Randy

    2005-01-01

    Much attention has been paid to the amount of time Americans spend watching television. Cultivation theory has been important in exploring behavioral effects of television viewing for many years. However, psychosocial health has received much less scrutiny in relation to television viewing time. This investigation examined the hypotheses that television-free individuals and viewers adhering to the American Academy of Pediatrics (AAP) recommendations (up to 2 hr of viewing per day) would display a more positive psychosocial health profile when compared with more frequent television viewers. Results confirmed the hypothesis for women, but not for men. Our analysis showed that moderate television viewing, as defined by the AAP, provides a similar relation with psychosocial health as being television-free. Results are discussed in a cultivation theory framework.

  18. Structural basis for Zn2+-dependent intercellular adhesion in staphylococcal biofilms.

    Science.gov (United States)

    Conrady, Deborah G; Wilson, Jeffrey J; Herr, Andrew B

    2013-01-15

    Staphylococcal bacteria, including Staphylococcus epidermidis and Staphylococcus aureus, cause chronic biofilm-related infections. The homologous proteins Aap and SasG mediate biofilm formation in S. epidermidis and S. aureus, respectively. The self-association of these proteins in the presence of Zn(2+) leads to the formation of extensive adhesive contacts between cells. This study reports the crystal structure of a Zn(2+) -bound construct from the self-associating region of Aap. Several unusual structural features include elongated β-sheets that are solvent-exposed on both faces and the lack of a canonical hydrophobic core. Zn(2+)-dependent dimers are observed in three distinct crystal forms, formed via pleomorphic coordination of Zn(2+) in trans across the dimer interface. These structures illustrate how a long, flexible surface protein is able to form tight intercellular adhesion sites under adverse environmental conditions.

  19. From porous gold nanocups to porous nanospheres and solid particles - A new synthetic approach

    KAUST Repository

    Ihsan, Ayesha

    2015-05-01

    We report a versatile approach for the synthesis of porous gold nanocups, porous gold nanospheres and solid gold nanoparticles. Gold nanocups are formed by the slow reduction of gold salt (HAuCl4{dot operator}3H2O) using aminoantipyrene (AAP) as a reducing agent. Adding polyvinylpyrrolidone (PVP) to the gold salt followed by reduction with AAP resulted in the formation of porous gold nanospheres. Microwave irradiation of both of these porous gold particles resulted in the formation of slightly smaller but solid gold particles. All these nanoparticles are thoroughly characterized by UV-visible spectroscopy, scanning electron microscopy (SEM), high resolution transmission electron microscopy (HR-TEM) and bright-field tomography. Due to the larger size, porous nature, low density and higher surface area, these nanomaterials may have interesting applications in catalysis, drug delivery, phototherapy and sensing.

  20. Surveying college introductory physics students’ attitudes and approaches to problem solving

    Science.gov (United States)

    Mason, Andrew J.; Singh, Chandralekha

    2016-09-01

    Students’ attitudes and approaches to problem solving in physics can greatly impact their actual problem solving practices and also influence their motivation to learn and ultimately the development of expertise. We developed and validated an attitudes and approaches to problem solving (AAPS) survey and administered it to students in the introductory physics courses in a typical large research university in the US. Here, we discuss the development and validation of the survey and analysis of the student responses to the survey questions in introductory physics courses. The introductory physics students’ responses to the survey questions were also compared with those of physics faculty members and physics PhD students. We find that introductory students are in general less expert-like than the physics faculty members and PhD students. Moreover, on some AAPS survey questions, the responses of students and faculty have unexpected trends. Those trends were interpreted via individual interviews, which helped clarify reasons for those survey responses.

  1. Resolution of alliance ruptures: The special case of animal-assisted psychotherapy.

    Science.gov (United States)

    Zilcha-Mano, Sigal

    2017-01-01

    Many therapists regard alliance ruptures as one of the greatest challenges therapists face in the therapy room. Alliance ruptures has been previously defined as breakdowns in the process of negotiation of treatment tasks and goals and a deterioration in the affective bond between patient and therapist. Alliance ruptures have been found to predict premature termination of treatment and poor treatment outcomes. But ruptures can also present important opportunities for gaining insight and awareness and for facilitating therapeutic change. A process of rupture resolution may lead to beneficial outcomes and serve as a corrective emotional experience. The article describes unique processes of alliance rupture resolution inherent in animal-assisted psychotherapy (AAP). Building on Safran and Muran's model and on clinical examples, the article describes strategies for identifying ruptures in AAP and techniques for repairing them to facilitate a corrective experience in treatment. Implications for clinical practice and future research are discussed.

  2. Anorexia and Attachment: Dysregulated Defense and Pathological Mourning

    Directory of Open Access Journals (Sweden)

    elisa edelvecchio

    2014-10-01

    Full Text Available The role of Defensive exclusion (Deactivation and Segregated Systems in the development of early relationships and related to subsequent manifestations of symptoms of eating disorders was assessed using the Adult Attachment Projective Picture System (AAP. Fifty-one DSM-IV diagnosed women with anorexia participated in the study. Anorexic patients were primarily classified as dismissing or unresolved. Quantitative and qualitative analyses of defensive exclusion were carried out. Results showed potential benefits of using the AAP defense exclusion coding system, in addition to the main attachment classifications, in order to better understand the developmental issues involved in anorexia. Discussion concerned the processes, such as pathological mourning, that may underlie the associations between dismissing and unresolved attachment and anorexia. Implications for developmental research and clinical nosology are discussed.

  3. Esiplaanil heli / Harri Slip

    Index Scriptorium Estoniae

    Slip, Harri

    2015-01-01

    Kõrvaklapid hinnaga alla 200 €: AKG Y50BT, Audio-Technica, Beyerdynamic Custom Street, Bose SoundTrue around-ear II, Creative Aurvana Gold, Denon AH-MM200, Focal Spirit One S, Grado SR 80e, JBL Everest V300, Klipsch Reference On Ear, Panasonic RP-HD10, Philips SHB8850NC, Sennheiser HD 25, SMS Audio On-Ear Wired Sport, Sony MDR-100AAP

  4. NCBI nr-aa BLAST: CBRC-LAFR-01-2958 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2958 ref|NP_667080.1| olfactory receptor 147 [Mus musculus] sp|Q60886|OL147_MOUSE Olfactor...y receptor 147 (Olfactory receptor 7E) (Olfactory receptor 164-1) (Odorant receptor M3) gb|AAL60884.1| olfactor...y receptor MOR164-1 [Mus musculus] gb|AAP71376.2| olfactory receptor Olfr147 [Mus musculus] NP_667080.1 1e-75 63% ...

  5. Dicty_cDB: Contig-U04544-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mpling_GS-35-01-01-1... 44 2.1 1 ( CU575212 ) Theobroma cacao, mRNA sequence (KZ0AAP1YH23). 44 2.1 1 ( AC165...rom cultivar ... 42 8.1 1 ( CU608535 ) Theobroma cacao, mRNA sequence (KZ0AAM4YK09FM1). 42 8.1 1 ( FG666317

  6. Three-point Green functions in the odd sector of QCD

    Directory of Open Access Journals (Sweden)

    Kadavý T.

    2016-01-01

    Full Text Available A review of familiar results of the three-point Green functions of currents in the odd-intrinsic parity sector of QCD is presented. Such Green functions include very well-known examples of VVP, VAS or AAP correlators. We also shortly present some of the new results for VVA and AAA Green functions with a discussion of their high-energy behaviour and its relation to the QCD condensates.

  7. NCBI nr-aa BLAST: CBRC-CBRE-01-0099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available -group)] gb|AAG13395.1|AF283006_1 cold acclimation protein WCOR413-like protein [Oryza sativa (japonica cult...ivar-group)] gb|AAP50941.1| putative cold acclimation protein [Oryza sativa (japonica cultivar-group)] gb|AAR87336.1| cold acclima...ultivar-group)] gb|ABF99064.1| cold acclimation protein COR413-PM1, putative, expressed [Oryza sativa (japon

  8. Role of Symbiotic Auxotrophy in the Rhizobium-Legume Symbioses

    OpenAIRE

    Jurgen Prell; Alexandre Bourdès; Shalini Kumar; Emma Lodwig; Arthur Hosie; Seonag Kinghorn; James White; Philip Poole

    2010-01-01

    Background Rhizobium leguminosarum bv. viciae mutants unable to transport branched-chain amino acids via the two main amino acid ABC transport complexes AapJQMP and BraDEFGC produce a nitrogen starvation phenotype when inoculated on pea (Pisum sativum) plants [1], [2]. Bacteroids in indeterminate pea nodules have reduced abundance and a lower chromosome number. They reduce transcription of pathways for branched-chain amino acid biosynthesis and become dependent on their provision by the host....

  9. EST Table: CN376273 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CN376273 rzhswab0_002215 10/09/28 42 %/131 aa ref|YP_145791.1| polyprotein [Varroa ...destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/09/01 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 L12 ...

  10. EST Table: CK529907 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK529907 rswfa0_000778.y1 10/09/29 58 %/131 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/31 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 swf ...

  11. EST Table: CK523603 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK523603 rswea0_009713.y1 10/09/29 47 %/185 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/31 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h DN237490 swe ...

  12. EST Table: CK510758 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK510758 rswdd0_006586.y1 10/09/29 52 %/216 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/30 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 swd ...

  13. EST Table: DN237490 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 019079(viral genome replication) 10/09/29 44 %/102 aa ref|YP_145791.1| polyprotein [Varroa destructor virus ...1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/09/03 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h DN237490 BmP ...

  14. EST Table: CK528102 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK528102 rswfa0_005915.y1 10/09/29 40 %/123 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/31 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 swf ...

  15. EST Table: CK541979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK541979 rswhb0_006233.y1 10/09/29 48 %/164 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/31 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 swh ...

  16. EST Table: CK489452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK489452 rswab0_007236.y1 10/09/29 42 %/134 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/30 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 swa ...

  17. EST Table: CK528690 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK528690 rswfa0_007768.y1 11/12/09 10/09/29 51 %/217 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/31 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 swf ...

  18. EST Table: CK518734 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK518734 rswea0_001019.y1 10/09/29 39 %/171 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/31 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h DN237490 swe ...

  19. EST Table: CK501708 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK501708 rswcc0_001346.y1 10/09/29 45 %/174 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/30 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h DN237490 swc ...

  20. EST Table: CK544693 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK544693 rswhb0_014928.y1 10/09/29 53 %/193 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/31 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 swh ...

  1. EST Table: CK520549 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK520549 rswea0_004258.y1 10/09/29 45 %/102 aa ref|YP_145791.1| polyprotein [Varroa... destructor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/08/31 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h CK528690 swe ...

  2. EST Table: DN237513 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DN237513 EST00639 10/09/29 45 %/111 aa ref|YP_145791.1| polyprotein [Varroa destruc...tor virus 1] gb|AAP51418.2| polyprotein [Varroa destructor virus 1] 10/09/03 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h DN237490 BmP ...

  3. AcEST: DK949530 [AcEST

    Lifescience Database Archive (English)

    Full Text Available dhesion molecule 1-B OS=Xenop... 32 4.1 sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa ... 32 4.1 sp|Q96685|VCO..... 31 7.0 sp|B1VII7|Y1611_CORU7 UPF0678 fatty acid-binding protein-like pr... 30 9.1 sp|Q65952|VCOM_ADECC Mi

  4. Report of the Military Compensation and Retirement Modernization Commission

    Science.gov (United States)

    2015-01-29

    LIST OF ACRONYMS PAGE XIII LIST OF ACRONYMS ACRONYM DEFINITION AAFES Army Air Force Exchange System AAP American Academy of Pediatrics ...members should receive mandatory health benefits seminars when they register one or more dependents, and when they are nearing retirement from the...Facilities,” JAMA Surgery , 149, no. 9 (September 2014): E5, http://archsurg.jamanetwork.com/article.aspx?articleid=1888411. 207 See, e.g., Army Health System

  5. NCBI nr-aa BLAST: CBRC-FRUB-02-0117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0117 ref|NP_001075589.1| blood-brain barrier large neutral amino acid ...mall subunit 1 (L-type amino acid transporter 1) (4F2 light chain) (4F2 LC) (4F2LC) (LAT1 light chain) gb|AAP47189.1| blood-brain bar...rier large neutral amino acid transporter light chain [Oryctolagus cuniculus] NP_001075589.1 7e-70 61% ...

  6. Biomarkers for pulmonary injury following deployment

    Science.gov (United States)

    2013-10-01

    21 4 Introduction Over 2.5M military personnel have served in SW Asia since 2002 to the present as part of...cellularity, flow cytometry and cytokine levels at SAMMC; a portion was sent to the Institute for Systems Biology for miRNA profiling and to Pacific ...serving in Iraq and Afghanistan. Allergy Asthma Proc. 31: 67-71. doi: 10.2500/aap.2010.31.3383. 11. King MS, Eisenberg R, Newman J, Tolle J, et al

  7. A Reassessment of the SIDS Back to Sleep Campaign

    Directory of Open Access Journals (Sweden)

    Ralph Pelligra

    2005-01-01

    Full Text Available The Back to Sleep Campaign was initiated in 1994 to implement the American Academy of Pediatrics' (AAP recommendation that infants be placed in the nonprone sleeping position to reduce the risk of the Sudden Infant Death Syndrome (SIDS. This paper offers a challenge to the Back to Sleep Campaign (BTSC from two perspectives: (1 the questionable validity of SIDS mortality and risk statistics, and (2 the BTSC as human experimentation rather than as confirmed preventive therapy.

  8. Comparison of growth rates of aerobic anoxygenic phototrophic bacteria and other bacterioplankton groups in coastal Mediterranean waters.

    Science.gov (United States)

    Ferrera, Isabel; Gasol, Josep M; Sebastián, Marta; Hojerová, Eva; Koblízek, Michal

    2011-11-01

    Growth is one of the basic attributes of any living organism. Surprisingly, the growth rates of marine bacterioplankton are only poorly known. Current data suggest that marine bacteria grow relatively slowly, having generation times of several days. However, some bacterial groups, such as the aerobic anoxygenic phototrophic (AAP) bacteria, have been shown to grow much faster. Two manipulation experiments, in which grazing, viruses, and resource competition were reduced, were conducted in the coastal Mediterranean Sea (Blanes Bay Microbial Observatory). The growth rates of AAP bacteria and of several important phylogenetic groups (the Bacteroidetes, the alphaproteobacterial groups Roseobacter and SAR11, and the Gammaproteobacteria group and its subgroups the Alteromonadaceae and the NOR5/OM60 clade) were calculated from changes in cell numbers in the manipulation treatments. In addition, we examined the role that top-down (mortality due to grazers and viruses) and bottom-up (resource availability) factors play in determining the growth rates of these groups. Manipulations resulted in an increase of the growth rates of all groups studied, but its extent differed largely among the individual treatments and among the different groups. Interestingly, higher growth rates were found for the AAP bacteria (up to 3.71 day⁻¹) and for the Alteromonadaceae (up to 5.44 day⁻¹), in spite of the fact that these bacterial groups represented only a very low percentage of the total prokaryotic community. In contrast, the SAR11 clade, which was the most abundant group, was the slower grower in all treatments. Our results show that, in general, the least abundant groups exhibited the highest rates, whereas the most abundant groups were those growing more slowly, indicating that some minor groups, such the AAP bacteria, very likely contribute much more to the recycling of organic matter in the ocean than what their abundances alone would predict.

  9. Application of acid-treated yeast cell wall (AYC) as a pharmaceutical additive. II: effects of curing on the medicine release from AYC-coated tablets.

    Science.gov (United States)

    Yuasa, H; Kaneshige, J; Ozeki, T; Kasai, T; Eguchi, T; Ishiwaki, N

    2000-11-19

    Acid-treated yeast cell wall (AYC) was newly prepared by acidifying brewers' yeast cell wall. Core tablets containing 3% of acetaminophen (AAP) were coated with the AYC aqueous dispersion containing 5% (w/v) of AYC and 0.35% (w/v) of glycerol. The curing of AYC-coated tablets was performed at various curing periods of time and temperatures. The effects of curing on AAP release from AYC-coated tablets, the weight and thickness of the coated layer of AYC and the water sorption into the AYC-coated tablets were studied. The tensile strength and pore size distribution of the AYC cast film were measured. In the case of 60, 80, or 100 degrees C curing, AAP release from AYC-coated tablets showed a sigmoidal release profile with an initial lag time. The duration of the lag time increased with the increasing curing time and temperature, though the release rate after the lag time hardly changed. At 120 degrees C curing, the release rate after the lag time decreased with the increasing curing time and a sustained release was observed. The weight and thickness of the AYC-coated layer and the water sorption rate into AYC-coated tablets decreased with the increasing curing time and temperature. The tensile strength of the AYC cast film increased with increasing the curing temperature, particularly at 120 degrees C curing. It is considered that the water was evaporated from the AYC-coated layer and the adhesion force between AYC particles increased during curing, making the structure of the AYC-coated layer densely firm. The changes in the duration of lag time and the release rate may be due to changes in the structure of the AYC-coated layer caused by curing. These results show that it is feasible to control the lag time and the release rate of AAP from AYC-coated tablets by varying the curing time and temperature.

  10. xCT deficiency aggravates acetaminophen-induced hepatotoxicity under inhibition of the transsulfuration pathway.

    Science.gov (United States)

    Kang, Eun Sil; Lee, Jaeyong; Homma, Takujiro; Kurahashi, Toshihiro; Kobayashi, Sho; Nabeshima, Atsunori; Yamada, Sohsuke; Seo, Han Geuk; Miyata, Satoshi; Sato, Hideyo; Fujii, Junichi

    2017-01-01

    Cystine, an oxidized form of cysteine (Cys), is imported into cells via the protein xCT, which is also associated with the export of glutamate as the counter amino acid. In the current study, we attempted to rationalize roles of xCT in the livers of male mice. While xCT was not expressed in the livers of ordinary mice, it was induced under conditions of glutathione depletion, caused by the administration of acetaminophen (AAP). To differentiate the role between xCT and the transsulfuration pathway on the supply of Cys, we employed an inhibitor of the enzyme cystathionine γ-lyase, propargylglycine (PPG). This inhibitor caused a marked aggravation in AAP-induced hepatic damage and the mortality of the xCT(-/-) mice was increased to a greater extent than that for the xCT(+/+) mice. While a PPG pretreatment had no effect on liver condition or Cys levels, the administration of AAP to the PPG-pretreated mice reduced the levels of Cys as well as glutathione to very low levels in both the xCT(+/+) and xCT(-/-) mice. These findings indicate that the transsulfuration pathway plays a major role in replenishing Cys when glutathione levels are low. Moreover, an ascorbic acid insufficiency, induced by Akr1a ablation, further aggravated the AAP-induced liver damage in the case of the xCT deficiency, indicating that glutathione and ascorbic acid function cooperatively in protecting the liver. In conclusion, while the transsulfuration pathway plays a primary role in supplying Cys to the redox system in the liver, xCT is induced in cases of emergencies, by compensating for Cys supply systems.

  11. Guiding Principles for Team-Based Pediatric Care.

    Science.gov (United States)

    Katkin, Julie P; Kressly, Susan J; Edwards, Anne R; Perrin, James M; Kraft, Colleen A; Richerson, Julia E; Tieder, Joel S; Wall, Liz

    2017-07-24

    The American Academy of Pediatrics (AAP) recognizes that children's unique and ever-changing needs depend on a variety of support systems. Key components of effective support systems address the needs of the child and family in the context of their home and community and are dynamic so that they reflect, monitor, and respond to changes as the needs of the child and family change. The AAP believes that team-based care involving medical providers and community partners (eg, teachers and state agencies) is a crucial and necessary component of providing high-quality care to children and their families. Team-based care builds on the foundation of the medical home by reaching out to a potentially broad array of participants in the life of a child and incorporating them into the care provided. Importantly, the AAP believes that a high-functioning team includes children and their families as essential partners. The overall goal of team-based care is to enhance communication and cooperation among the varied medical, social, and educational partners in a child's life to better meet the global needs of children and their families, helping them to achieve their best potential. In support of the team-based approach, the AAP urges stakeholders to invest in infrastructure, education, and privacy-secured technology to meet the needs of children. This statement includes limited specific examples of potential team members, including health care providers and community partners, that are meant to be illustrative and in no way represent a complete or comprehensive listing of all team members who may be of importance for a specific child and family. Copyright © 2017 by the American Academy of Pediatrics.

  12. Children of Military Service Members Resource Guide

    Science.gov (United States)

    2012-01-01

    www.aap.org developed by military pediatricians and adolescent- medicine specialists, this animated film, hosted by mr. poe, is designed to provide...reported missing in action in vietnam. dove song K.L. Franklin Publisher: Prometheus Books Year: 2007 isbN: 978-1591025344 Pages: 56 this book...adolescent- medicine specialists, this film is designed for older children and adolescents to help them learn coping strategies for dealing with

  13. Current Issues Affecting the Practice of Pediatric Orthopaedic Surgeons: Results of the 2014 Workforce Survey of American Academy of Pediatrics Section on Orthopaedics.

    Science.gov (United States)

    Hosseinzadeh, Pooya; Copley, Lawson; Ruch-Ross, Holly; Schwend, Richard M; Sawyer, Jeffrey R

    2016-09-22

    The opinions of the pediatric orthopaedic workforce are shaped by market forces, regulatory processes, and local experience. The purpose of this report is to summarize the findings of the recent Workforce Survey of the American Academy of Pediatrics (AAP) Section on Orthopaedics (SOOr). This submission has been reviewed and approved by the Board of Directors of the Pediatric Orthopaedic Society of North America (POSNA). In 2014, the AAP generated a survey to assess perceptions of pediatric orthopaedic surgeons about current issues that affect practice. The survey was sent to 856 POSNA and 141 AAP-SOOr members. Responses were topically organized to report current workforce composition, practice patterns, and perceptions about electronic medical records (EMRs). Responses were collected from August to December, 2014, from 496 (50%) survey recipients including 83 of 141 (59%) AAP-SOOr members and 413 of 856 (48%) POSNA members. Analyses were restricted to the 397 respondents who reported that they are currently practicing pediatric orthopaedics. Nearly all of these (390/391, 100%) indicated that they provide direct patient care and work an average of 60 hours per week. Many (105/378, 28%) indicated that they would soon limit their practice or retire. A majority (299/394, 76%) indicated that they face competition in their geographic area, predominantly due to pediatric orthopaedic subspecialists (269/299, 90%). Major business changes had recently occurred or were anticipated by 21% of participants. Respondents reported that use of EMR makes them less efficient (252/397, 63%) and interferes with the patient-physician relationship (172/397, 43%). This workforce survey suggests that pediatric orthopaedic surgeons are concerned with challenges of competition despite concurrent increasing volume and complexity of referrals. External processes such as EMR changes are perceived to negatively impact practice efficiency and satisfaction.

  14. Asparaginase-associated pancreatitis: a study on phenotype and genotype in the NOPHO ALL2008 protocol

    DEFF Research Database (Denmark)

    Wolthers, B. O.; Frandsen, Thomas L.; Abrahamsson, Jonas

    2016-01-01

    therapy, and 7% had recurrent abdominal pain. Germline DNA on 62 cases and 638 controls was genotyped on Omni2.5exome-8-v1.2 BeadChip arrays. Overall, the ULK2 variant rs281366 showed the strongest association with AAP (P = 5.8x10(-7); odds ratio (OR) = 6.7). Cases with the rs281366 variant were younger...

  15. Improving validated depression screen among adolescent population in primary care practice using electronic health records (EHR).

    OpenAIRE

    2015-01-01

    Adolescent depression, has been identified as one of the important risk factors for adolescent safety. The American Academy of Pediatrics (AAP) recommends screening the adolescent population for depression with a validated screening tool at least once a year. Given the time constraints in primary care, many physicians tend to rely more on clinical questioning to screen depression.This has the potential to miss many adolescents who may have mild to moderate depression which may prove detriment...

  16. PcMtr, an aromatic and neutral aliphatic amino acid permease of Penicillium chrysogenum

    OpenAIRE

    Trip, H; EVERS, ME; Driessen, AJM

    2004-01-01

    The gene encoding an aromatic and neutral aliphatic amino acid permease of Penicillium chrysogenum was cloned, functionally expressed and characterized in Saccharomyces cerevisiae M4276. The permease, designated PcMtr, is structurally and functionally homologous to Mtr of Neurospora crassa, and unrelated to the Amino Acid Permease (AAP) family which includes most amino acid permeases in fungi. Database searches of completed fungal genome sequences reveal that Mtr type permeases are not widely...

  17. Detection of the Metabolic Syndrome in Schizophrenia and Implications for Antipsychotic Therapy: Is There a Role for Folate?

    OpenAIRE

    Burghardt, Kyle J; Ellingrod, Vicki L.

    2013-01-01

    In general, presence of the metabolic syndrome is associated with significant cardiovascular mortality and represents a growing public health concern in the United States. Patients with a schizophrenia have a three times greater risk of death compared to the general population, with cardiovascular disease being the most common cause of this mortality. Use of the atypical antipsychotics (AAPs) to treat schizophrenia contributes significantly to this cardiovascular disease risk. While currently...

  18. NCBI nr-aa BLAST: CBRC-PTRO-27-0250 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0250 ref|NP_666507.1| olfactory receptor 1276 [Mus musculus] gb|AAL61363.1| olfactory... receptor MOR245-10 [Mus musculus] gb|AAP71670.1| olfactory receptor Olfr1276 [Mus musculus] emb|CAM27563.1| olfactory... receptor 1276 [Mus musculus] gb|EDL27803.1| olfactory receptor 1276 [Mus musculus] NP_666507.1 1e-116 69% ...

  19. NCBI nr-aa BLAST: CBRC-LAFR-01-4115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-4115 ref|NP_667077.1| olfactory receptor 1008 [Mus musculus] gb|AAL60887.1| olfactory... receptor MOR187-3 [Mus musculus] gb|AAP71460.1| olfactory receptor Olfr1008 [Mus musculus] emb|CAM16171.1| olfactory... receptor 1008 [Mus musculus] gb|EDL27333.1| olfactory receptor 1008 [Mus musculus] NP_667077.1 1e-130 73% ...

  20. NCBI nr-aa BLAST: CBRC-CFAM-18-0207 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-18-0207 ref|NP_667192.1| olfactory receptor 1260 [Mus musculus] gb|AAL60770.1| olfactory... receptor MOR232-2 [Mus musculus] gb|AAP71654.1| olfactory receptor Olfr1260 [Mus musculus] emb|CAM27664.1| olfactory... receptor 1260 [Mus musculus] gb|EDL27466.1| olfactory receptor 1260 [Mus musculus] NP_667192.1 1e-148 84% ...

  1. NCBI nr-aa BLAST: CBRC-CJAC-01-0312 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0312 ref|NP_666646.1| olfactory receptor 993 [Mus musculus] gb|AAL61326.1| olfactory... receptor MOR203-2 [Mus musculus] gb|AAP71451.1| olfactory receptor Olfr993 [Mus musculus] emb|CAM24030.1| olfactory... receptor 993 [Mus musculus] gb|EDL27327.1| olfactory receptor 993 [Mus musculus] NP_666646.1 1e-137 77% ...

  2. NCBI nr-aa BLAST: CBRC-STRI-01-0445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-0445 ref|NP_667194.1| olfactory receptor 1256 [Mus musculus] gb|AAL60768.1| olfactory... receptor MOR231-1 [Mus musculus] gb|AAP71649.1| olfactory receptor Olfr1256 [Mus musculus] emb|CAM19163.1| olfactory... receptor 1256 [Mus musculus] gb|EDL27463.1| olfactory receptor 1256 [Mus musculus] NP_667194.1 1e-118 69% ...

  3. NCBI nr-aa BLAST: CBRC-DNOV-01-0762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0762 ref|NP_667077.1| olfactory receptor 1008 [Mus musculus] gb|AAL60887.1| olfactory... receptor MOR187-3 [Mus musculus] gb|AAP71460.1| olfactory receptor Olfr1008 [Mus musculus] emb|CAM16171.1| olfactory... receptor 1008 [Mus musculus] gb|EDL27333.1| olfactory receptor 1008 [Mus musculus] NP_667077.1 1e-126 67% ...

  4. NCBI nr-aa BLAST: CBRC-LAFR-01-4023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-4023 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-137 75% ...

  5. NCBI nr-aa BLAST: CBRC-RNOR-03-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-03-0025 ref|NP_667161.1| olfactory receptor 341 [Mus musculus] gb|AAL60801.1| olfactory... receptor MOR136-2 [Mus musculus] gb|AAP70875.1| olfactory receptor Olfr341 [Mus musculus] emb|CAM20475.1| olfactory... receptor 341 [Mus musculus] gb|EDL08679.1| olfactory receptor 341 [Mus musculus] NP_667161.1 1e-150 84% ...

  6. NCBI nr-aa BLAST: CBRC-MMUS-02-0123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-02-0123 ref|NP_667077.1| olfactory receptor 1008 [Mus musculus] gb|AAL60887.1| olfactory... receptor MOR187-3 [Mus musculus] gb|AAP71460.1| olfactory receptor Olfr1008 [Mus musculus] emb|CAM16171.1| olfactory... receptor 1008 [Mus musculus] gb|EDL27333.1| olfactory receptor 1008 [Mus musculus] NP_667077.1 1e-154 87% ...

  7. NCBI nr-aa BLAST: CBRC-CJAC-01-0213 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0213 ref|NP_667058.1| olfactory receptor 1090 [Mus musculus] gb|AAL60909.1| olfactory... receptor MOR188-4 [Mus musculus] gb|AAP71517.1| olfactory receptor Olfr1090 [Mus musculus] emb|CAM24652.1| olfactory... receptor 1090 [Mus musculus] gb|EDL27371.1| olfactory receptor 1090 [Mus musculus] NP_667058.1 1e-140 77% ...

  8. NCBI nr-aa BLAST: CBRC-RNOR-03-0217 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-03-0217 ref|NP_667047.1| olfactory receptor 1132 [Mus musculus] gb|AAL60920.1| olfactory... receptor MOR177-1 [Mus musculus] gb|AAP71551.1| olfactory receptor Olfr1132 [Mus musculus] emb|CAM25126.1| olfactory... receptor 1132 [Mus musculus] gb|EDL27401.1| olfactory receptor 1132 [Mus musculus] NP_667047.1 1e-153 88% ...

  9. NCBI nr-aa BLAST: CBRC-MEUG-01-0090 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0090 ref|NP_666644.1| olfactory receptor 994 [Mus musculus] gb|AAL61328.1| olfactory... receptor MOR203-4 [Mus musculus] gb|AAP71452.1| olfactory receptor Olfr994 [Mus musculus] emb|CAM24031.1| olfactory... receptor 994 [Mus musculus] gb|EDL27328.1| olfactory receptor 994 [Mus musculus] NP_666644.1 2e-30 65% ...

  10. NCBI nr-aa BLAST: CBRC-PCAP-01-1410 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1410 ref|NP_667151.1| olfactory receptor 352 [Mus musculus] gb|AAL60811.1| olfactory... receptor MOR136-10 [Mus musculus] gb|AAP70886.1| olfactory receptor Olfr352 [Mus musculus] emb|CAM16518.1| olfactory... receptor 352 [Mus musculus] gb|EDL08690.1| olfactory receptor 352 [Mus musculus] NP_667151.1 1e-134 78% ...

  11. NCBI nr-aa BLAST: CBRC-EEUR-01-1536 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1536 ref|NP_667122.1| olfactory receptor 1377 [Mus musculus] gb|AAL60840.1| olfactory... receptor MOR129-1 [Mus musculus] gb|AAP71759.1| olfactory receptor Olfr1377 [Mus musculus] emb|CAI35307.1| olfactory... receptor 1377 [Mus musculus] gb|EDL33683.1| olfactory receptor 1377 [Mus musculus] NP_667122.1 4e-78 76% ...

  12. NCBI nr-aa BLAST: CBRC-TBEL-01-0332 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-0332 ref|NP_666507.1| olfactory receptor 1276 [Mus musculus] gb|AAL61363.1| olfactory... receptor MOR245-10 [Mus musculus] gb|AAP71670.1| olfactory receptor Olfr1276 [Mus musculus] emb|CAM27563.1| olfactory... receptor 1276 [Mus musculus] gb|EDL27803.1| olfactory receptor 1276 [Mus musculus] NP_666507.1 1e-98 77% ...

  13. NCBI nr-aa BLAST: CBRC-FCAT-01-0108 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0108 ref|NP_667047.1| olfactory receptor 1132 [Mus musculus] gb|AAL60920.1| olfactory... receptor MOR177-1 [Mus musculus] gb|AAP71551.1| olfactory receptor Olfr1132 [Mus musculus] emb|CAM25126.1| olfactory... receptor 1132 [Mus musculus] gb|EDL27401.1| olfactory receptor 1132 [Mus musculus] NP_667047.1 4e-59 77% ...

  14. NCBI nr-aa BLAST: CBRC-DNOV-01-1203 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1203 ref|NP_667192.1| olfactory receptor 1260 [Mus musculus] gb|AAL60770.1| olfactory... receptor MOR232-2 [Mus musculus] gb|AAP71654.1| olfactory receptor Olfr1260 [Mus musculus] emb|CAM27664.1| olfactory... receptor 1260 [Mus musculus] gb|EDL27466.1| olfactory receptor 1260 [Mus musculus] NP_667192.1 1e-130 74% ...

  15. NCBI nr-aa BLAST: CBRC-TBEL-01-0145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-0145 ref|NP_666644.1| olfactory receptor 994 [Mus musculus] gb|AAL61328.1| olfactory... receptor MOR203-4 [Mus musculus] gb|AAP71452.1| olfactory receptor Olfr994 [Mus musculus] emb|CAM24031.1| olfactory... receptor 994 [Mus musculus] gb|EDL27328.1| olfactory receptor 994 [Mus musculus] NP_666644.1 1e-103 77% ...

  16. NCBI nr-aa BLAST: CBRC-EEUR-01-0525 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-0525 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-125 69% ...

  17. NCBI nr-aa BLAST: CBRC-DNOV-01-3176 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3176 ref|NP_667192.1| olfactory receptor 1260 [Mus musculus] gb|AAL60770.1| olfactory... receptor MOR232-2 [Mus musculus] gb|AAP71654.1| olfactory receptor Olfr1260 [Mus musculus] emb|CAM27664.1| olfactory... receptor 1260 [Mus musculus] gb|EDL27466.1| olfactory receptor 1260 [Mus musculus] NP_667192.1 1e-136 76% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0675 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0675 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-136 76% ...

  19. NCBI nr-aa BLAST: CBRC-ETEL-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0259 ref|NP_667077.1| olfactory receptor 1008 [Mus musculus] gb|AAL60887.1| olfactory... receptor MOR187-3 [Mus musculus] gb|AAP71460.1| olfactory receptor Olfr1008 [Mus musculus] emb|CAM16171.1| olfactory... receptor 1008 [Mus musculus] gb|EDL27333.1| olfactory receptor 1008 [Mus musculus] NP_667077.1 2e-67 69% ...

  20. NCBI nr-aa BLAST: CBRC-EEUR-01-0625 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-0625 ref|NP_667047.1| olfactory receptor 1132 [Mus musculus] gb|AAL60920.1| olfactory... receptor MOR177-1 [Mus musculus] gb|AAP71551.1| olfactory receptor Olfr1132 [Mus musculus] emb|CAM25126.1| olfactory... receptor 1132 [Mus musculus] gb|EDL27401.1| olfactory receptor 1132 [Mus musculus] NP_667047.1 1e-135 75% ...

  1. NCBI nr-aa BLAST: CBRC-MMUS-02-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-02-0041 ref|NP_666480.1| olfactory receptor 361 [Mus musculus] gb|AAL61388.1| olfactory... receptor MOR159-3 [Mus musculus] gb|AAP70894.1| olfactory receptor Olfr361 [Mus musculus] emb|CAM20133.1| olfactory... receptor 361 [Mus musculus] gb|EDL08698.1| olfactory receptor 361 [Mus musculus] NP_666480.1 1e-142 84% ...

  2. NCBI nr-aa BLAST: CBRC-BTAU-01-2747 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2747 ref|NP_666646.1| olfactory receptor 993 [Mus musculus] gb|AAL61326.1| olfactory... receptor MOR203-2 [Mus musculus] gb|AAP71451.1| olfactory receptor Olfr993 [Mus musculus] emb|CAM24030.1| olfactory... receptor 993 [Mus musculus] gb|EDL27327.1| olfactory receptor 993 [Mus musculus] NP_666646.1 1e-133 76% ...

  3. NCBI nr-aa BLAST: CBRC-BTAU-01-0079 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0079 ref|NP_667194.1| olfactory receptor 1256 [Mus musculus] gb|AAL60768.1| olfactory... receptor MOR231-1 [Mus musculus] gb|AAP71649.1| olfactory receptor Olfr1256 [Mus musculus] emb|CAM19163.1| olfactory... receptor 1256 [Mus musculus] gb|EDL27463.1| olfactory receptor 1256 [Mus musculus] NP_667194.1 1e-137 75% ...

  4. NCBI nr-aa BLAST: CBRC-RNOR-03-0146 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-03-0146 ref|NP_667058.1| olfactory receptor 1090 [Mus musculus] gb|AAL60909.1| olfactory... receptor MOR188-4 [Mus musculus] gb|AAP71517.1| olfactory receptor Olfr1090 [Mus musculus] emb|CAM24652.1| olfactory... receptor 1090 [Mus musculus] gb|EDL27371.1| olfactory receptor 1090 [Mus musculus] NP_667058.1 1e-145 80% ...

  5. NCBI nr-aa BLAST: CBRC-BTAU-01-0928 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0928 ref|NP_667194.1| olfactory receptor 1256 [Mus musculus] gb|AAL60768.1| olfactory... receptor MOR231-1 [Mus musculus] gb|AAP71649.1| olfactory receptor Olfr1256 [Mus musculus] emb|CAM19163.1| olfactory... receptor 1256 [Mus musculus] gb|EDL27463.1| olfactory receptor 1256 [Mus musculus] NP_667194.1 1e-123 71% ...

  6. NCBI nr-aa BLAST: CBRC-RNOR-10-0083 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-10-0083 ref|NP_667122.1| olfactory receptor 1377 [Mus musculus] gb|AAL60840.1| olfactory... receptor MOR129-1 [Mus musculus] gb|AAP71759.1| olfactory receptor Olfr1377 [Mus musculus] emb|CAI35307.1| olfactory... receptor 1377 [Mus musculus] gb|EDL33683.1| olfactory receptor 1377 [Mus musculus] NP_667122.1 2e-98 73% ...

  7. NCBI nr-aa BLAST: CBRC-MMUS-02-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-02-0023 ref|NP_667161.1| olfactory receptor 341 [Mus musculus] gb|AAL60801.1| olfactory... receptor MOR136-2 [Mus musculus] gb|AAP70875.1| olfactory receptor Olfr341 [Mus musculus] emb|CAM20475.1| olfactory... receptor 341 [Mus musculus] gb|EDL08679.1| olfactory receptor 341 [Mus musculus] NP_667161.1 1e-177 100% ...

  8. NCBI nr-aa BLAST: CBRC-PABE-12-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-12-0068 ref|NP_667189.1| olfactory receptor 1258 [Mus musculus] gb|AAL60773.1| olfactory... receptor MOR232-3 [Mus musculus] gb|AAP71652.1| olfactory receptor Olfr1258 [Mus musculus] emb|CAM27661.1| olfactory... receptor 1258 [Mus musculus] gb|EDL27464.1| olfactory receptor 1258 [Mus musculus] NP_667189.1 1e-139 81% ...

  9. NCBI nr-aa BLAST: CBRC-DNOV-01-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0016 ref|NP_667088.1| olfactory receptor 1395 [Mus musculus] gb|AAL60876.1| olfactory... receptor MOR277-1 [Mus musculus] gb|AAP71777.1| olfactory receptor Olfr1395 [Mus musculus] emb|CAM46261.1| olfactory... receptor 1395 [Mus musculus] gb|EDL33774.1| olfactory receptor 1395 [Mus musculus] NP_667088.1 1e-127 87% ...

  10. NCBI nr-aa BLAST: CBRC-DNOV-01-2646 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2646 ref|NP_667077.1| olfactory receptor 1008 [Mus musculus] gb|AAL60887.1| olfactory... receptor MOR187-3 [Mus musculus] gb|AAP71460.1| olfactory receptor Olfr1008 [Mus musculus] emb|CAM16171.1| olfactory... receptor 1008 [Mus musculus] gb|EDL27333.1| olfactory receptor 1008 [Mus musculus] NP_667077.1 1e-117 73% ...

  11. NCBI nr-aa BLAST: CBRC-LAFR-01-1224 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1224 ref|NP_667151.1| olfactory receptor 352 [Mus musculus] gb|AAL60811.1| olfactory... receptor MOR136-10 [Mus musculus] gb|AAP70886.1| olfactory receptor Olfr352 [Mus musculus] emb|CAM16518.1| olfactory... receptor 352 [Mus musculus] gb|EDL08690.1| olfactory receptor 352 [Mus musculus] NP_667151.1 1e-130 81% ...

  12. NCBI nr-aa BLAST: CBRC-OPRI-01-0959 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0959 ref|NP_666854.1| olfactory receptor 1155 [Mus musculus] gb|AAL61117.1| olfactory... receptor MOR174-10 [Mus musculus] gb|AAP71568.1| olfactory receptor Olfr1155 [Mus musculus] emb|CAM18637.1| olfactory... receptor 1155 [Mus musculus] gb|EDL27414.1| olfactory receptor 1155 [Mus musculus] NP_666854.1 2e-79 56% ...

  13. NCBI nr-aa BLAST: CBRC-EEUR-01-1434 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1434 ref|NP_666507.1| olfactory receptor 1276 [Mus musculus] gb|AAL61363.1| olfactory... receptor MOR245-10 [Mus musculus] gb|AAP71670.1| olfactory receptor Olfr1276 [Mus musculus] emb|CAM27563.1| olfactory... receptor 1276 [Mus musculus] gb|EDL27803.1| olfactory receptor 1276 [Mus musculus] NP_666507.1 4e-49 82% ...

  14. NCBI nr-aa BLAST: CBRC-LAFR-01-1124 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1124 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-136 75% ...

  15. NCBI nr-aa BLAST: CBRC-PHAM-01-0915 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0915 ref|NP_667194.1| olfactory receptor 1256 [Mus musculus] gb|AAL60768.1| olfactory... receptor MOR231-1 [Mus musculus] gb|AAP71649.1| olfactory receptor Olfr1256 [Mus musculus] emb|CAM19163.1| olfactory... receptor 1256 [Mus musculus] gb|EDL27463.1| olfactory receptor 1256 [Mus musculus] NP_667194.1 1e-147 82% ...

  16. NCBI nr-aa BLAST: CBRC-ETEL-01-0986 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0986 ref|NP_667077.1| olfactory receptor 1008 [Mus musculus] gb|AAL60887.1| olfactory... receptor MOR187-3 [Mus musculus] gb|AAP71460.1| olfactory receptor Olfr1008 [Mus musculus] emb|CAM16171.1| olfactory... receptor 1008 [Mus musculus] gb|EDL27333.1| olfactory receptor 1008 [Mus musculus] NP_667077.1 2e-84 65% ...

  17. NCBI nr-aa BLAST: CBRC-EEUR-01-0091 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-0091 ref|NP_667151.1| olfactory receptor 352 [Mus musculus] gb|AAL60811.1| olfactory... receptor MOR136-10 [Mus musculus] gb|AAP70886.1| olfactory receptor Olfr352 [Mus musculus] emb|CAM16518.1| olfactory... receptor 352 [Mus musculus] gb|EDL08690.1| olfactory receptor 352 [Mus musculus] NP_667151.1 2e-70 75% ...

  18. NCBI nr-aa BLAST: CBRC-OCUN-01-0578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0578 ref|NP_667189.1| olfactory receptor 1258 [Mus musculus] gb|AAL60773.1| olfactory... receptor MOR232-3 [Mus musculus] gb|AAP71652.1| olfactory receptor Olfr1258 [Mus musculus] emb|CAM27661.1| olfactory... receptor 1258 [Mus musculus] gb|EDL27464.1| olfactory receptor 1258 [Mus musculus] NP_667189.1 1e-154 90% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1437 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1437 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-123 71% ...

  20. NCBI nr-aa BLAST: CBRC-LAFR-01-4104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-4104 ref|NP_667077.1| olfactory receptor 1008 [Mus musculus] gb|AAL60887.1| olfactory... receptor MOR187-3 [Mus musculus] gb|AAP71460.1| olfactory receptor Olfr1008 [Mus musculus] emb|CAM16171.1| olfactory... receptor 1008 [Mus musculus] gb|EDL27333.1| olfactory receptor 1008 [Mus musculus] NP_667077.1 1e-135 76% ...

  1. NCBI nr-aa BLAST: CBRC-LAFR-01-0651 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0651 ref|NP_666854.1| olfactory receptor 1155 [Mus musculus] gb|AAL61117.1| olfactory... receptor MOR174-10 [Mus musculus] gb|AAP71568.1| olfactory receptor Olfr1155 [Mus musculus] emb|CAM18637.1| olfactory... receptor 1155 [Mus musculus] gb|EDL27414.1| olfactory receptor 1155 [Mus musculus] NP_666854.1 1e-123 72% ...

  2. NCBI nr-aa BLAST: CBRC-LAFR-01-4099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-4099 ref|NP_666854.1| olfactory receptor 1155 [Mus musculus] gb|AAL61117.1| olfactory... receptor MOR174-10 [Mus musculus] gb|AAP71568.1| olfactory receptor Olfr1155 [Mus musculus] emb|CAM18637.1| olfactory... receptor 1155 [Mus musculus] gb|EDL27414.1| olfactory receptor 1155 [Mus musculus] NP_666854.1 1e-112 66% ...

  3. NCBI nr-aa BLAST: CBRC-LAFR-01-3900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3900 ref|NP_667047.1| olfactory receptor 1132 [Mus musculus] gb|AAL60920.1| olfactory... receptor MOR177-1 [Mus musculus] gb|AAP71551.1| olfactory receptor Olfr1132 [Mus musculus] emb|CAM25126.1| olfactory... receptor 1132 [Mus musculus] gb|EDL27401.1| olfactory receptor 1132 [Mus musculus] NP_667047.1 1e-135 78% ...

  4. NCBI nr-aa BLAST: CBRC-GGOR-01-0347 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0347 ref|NP_667189.1| olfactory receptor 1258 [Mus musculus] gb|AAL60773.1| olfactory... receptor MOR232-3 [Mus musculus] gb|AAP71652.1| olfactory receptor Olfr1258 [Mus musculus] emb|CAM27661.1| olfactory... receptor 1258 [Mus musculus] gb|EDL27464.1| olfactory receptor 1258 [Mus musculus] NP_667189.1 2e-69 81% ...

  5. NCBI nr-aa BLAST: CBRC-CPOR-01-1606 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1606 ref|NP_666644.1| olfactory receptor 994 [Mus musculus] gb|AAL61328.1| olfactory... receptor MOR203-4 [Mus musculus] gb|AAP71452.1| olfactory receptor Olfr994 [Mus musculus] emb|CAM24031.1| olfactory... receptor 994 [Mus musculus] gb|EDL27328.1| olfactory receptor 994 [Mus musculus] NP_666644.1 1e-140 79% ...

  6. NCBI nr-aa BLAST: CBRC-STRI-01-0227 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-0227 ref|NP_667189.1| olfactory receptor 1258 [Mus musculus] gb|AAL60773.1| olfactory... receptor MOR232-3 [Mus musculus] gb|AAP71652.1| olfactory receptor Olfr1258 [Mus musculus] emb|CAM27661.1| olfactory... receptor 1258 [Mus musculus] gb|EDL27464.1| olfactory receptor 1258 [Mus musculus] NP_667189.1 1e-146 85% ...

  7. NCBI nr-aa BLAST: CBRC-PCAP-01-1510 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1510 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-117 69% ...

  8. NCBI nr-aa BLAST: CBRC-RNOR-10-0087 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-10-0087 ref|NP_667122.1| olfactory receptor 1377 [Mus musculus] gb|AAL60840.1| olfactory... receptor MOR129-1 [Mus musculus] gb|AAP71759.1| olfactory receptor Olfr1377 [Mus musculus] emb|CAI35307.1| olfactory... receptor 1377 [Mus musculus] gb|EDL33683.1| olfactory receptor 1377 [Mus musculus] NP_667122.1 1e-155 86% ...

  9. NCBI nr-aa BLAST: CBRC-OLAT-18-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-18-0035 ref|NP_667161.1| olfactory receptor 341 [Mus musculus] gb|AAL60801.1| olfactory... receptor MOR136-2 [Mus musculus] gb|AAP70875.1| olfactory receptor Olfr341 [Mus musculus] emb|CAM20475.1| olfactory... receptor 341 [Mus musculus] gb|EDL08679.1| olfactory receptor 341 [Mus musculus] NP_667161.1 4e-04 24% ...

  10. NCBI nr-aa BLAST: CBRC-RNOR-03-0168 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-03-0168 ref|NP_667058.1| olfactory receptor 1090 [Mus musculus] gb|AAL60909.1| olfactory... receptor MOR188-4 [Mus musculus] gb|AAP71517.1| olfactory receptor Olfr1090 [Mus musculus] emb|CAM24652.1| olfactory... receptor 1090 [Mus musculus] gb|EDL27371.1| olfactory receptor 1090 [Mus musculus] NP_667058.1 1e-166 93% ...

  11. NCBI nr-aa BLAST: CBRC-STRI-01-1441 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1441 ref|NP_667189.1| olfactory receptor 1258 [Mus musculus] gb|AAL60773.1| olfactory... receptor MOR232-3 [Mus musculus] gb|AAP71652.1| olfactory receptor Olfr1258 [Mus musculus] emb|CAM27661.1| olfactory... receptor 1258 [Mus musculus] gb|EDL27464.1| olfactory receptor 1258 [Mus musculus] NP_667189.1 1e-110 78% ...

  12. NCBI nr-aa BLAST: CBRC-EEUR-01-1009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1009 ref|NP_667194.1| olfactory receptor 1256 [Mus musculus] gb|AAL60768.1| olfactory... receptor MOR231-1 [Mus musculus] gb|AAP71649.1| olfactory receptor Olfr1256 [Mus musculus] emb|CAM19163.1| olfactory... receptor 1256 [Mus musculus] gb|EDL27463.1| olfactory receptor 1256 [Mus musculus] NP_667194.1 1e-149 83% ...

  13. NCBI nr-aa BLAST: CBRC-RNOR-10-0097 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-10-0097 ref|NP_667088.1| olfactory receptor 1395 [Mus musculus] gb|AAL60876.1| olfactory... receptor MOR277-1 [Mus musculus] gb|AAP71777.1| olfactory receptor Olfr1395 [Mus musculus] emb|CAM46261.1| olfactory... receptor 1395 [Mus musculus] gb|EDL33774.1| olfactory receptor 1395 [Mus musculus] NP_667088.1 1e-102 61% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0312 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0312 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-137 76% ...

  15. NCBI nr-aa BLAST: CBRC-LAFR-01-2874 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2874 ref|NP_667230.1| olfactory receptor 1054 [Mus musculus] gb|AAL60732.1| olfactory... receptor MOR188-2 [Mus musculus] gb|AAP71498.1| olfactory receptor Olfr1054 [Mus musculus] emb|CAM17888.1| olfactory... receptor 1054 [Mus musculus] gb|EDL27363.1| olfactory receptor 1054 [Mus musculus] NP_667230.1 3e-83 60% ...

  16. NCBI nr-aa BLAST: CBRC-PCAP-01-0810 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0810 ref|NP_667230.1| olfactory receptor 1054 [Mus musculus] gb|AAL60732.1| olfactory... receptor MOR188-2 [Mus musculus] gb|AAP71498.1| olfactory receptor Olfr1054 [Mus musculus] emb|CAM17888.1| olfactory... receptor 1054 [Mus musculus] gb|EDL27363.1| olfactory receptor 1054 [Mus musculus] NP_667230.1 1e-101 62% ...

  17. NCBI nr-aa BLAST: CBRC-BTAU-01-0483 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0483 ref|NP_666854.1| olfactory receptor 1155 [Mus musculus] gb|AAL61117.1| olfactory... receptor MOR174-10 [Mus musculus] gb|AAP71568.1| olfactory receptor Olfr1155 [Mus musculus] emb|CAM18637.1| olfactory... receptor 1155 [Mus musculus] gb|EDL27414.1| olfactory receptor 1155 [Mus musculus] NP_666854.1 1e-125 77% ...

  18. NCBI nr-aa BLAST: CBRC-ETEL-01-0939 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0939 ref|NP_667192.1| olfactory receptor 1260 [Mus musculus] gb|AAL60770.1| olfactory... receptor MOR232-2 [Mus musculus] gb|AAP71654.1| olfactory receptor Olfr1260 [Mus musculus] emb|CAM27664.1| olfactory... receptor 1260 [Mus musculus] gb|EDL27466.1| olfactory receptor 1260 [Mus musculus] NP_667192.1 1e-139 76% ...

  19. NCBI nr-aa BLAST: CBRC-BTAU-01-2011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2011 ref|NP_667088.1| olfactory receptor 1395 [Mus musculus] gb|AAL60876.1| olfactory... receptor MOR277-1 [Mus musculus] gb|AAP71777.1| olfactory receptor Olfr1395 [Mus musculus] emb|CAM46261.1| olfactory... receptor 1395 [Mus musculus] gb|EDL33774.1| olfactory receptor 1395 [Mus musculus] NP_667088.1 1e-164 91% ...

  20. NCBI nr-aa BLAST: CBRC-LAFR-01-2611 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2611 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-140 77% ...

  1. NCBI nr-aa BLAST: CBRC-MMUS-02-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-02-0028 ref|NP_667161.1| olfactory receptor 341 [Mus musculus] gb|AAL60801.1| olfactory... receptor MOR136-2 [Mus musculus] gb|AAP70875.1| olfactory receptor Olfr341 [Mus musculus] emb|CAM20475.1| olfactory... receptor 341 [Mus musculus] gb|EDL08679.1| olfactory receptor 341 [Mus musculus] NP_667161.1 1e-148 84% ...

  2. NCBI nr-aa BLAST: CBRC-LAFR-01-4024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-4024 ref|NP_667077.1| olfactory receptor 1008 [Mus musculus] gb|AAL60887.1| olfactory... receptor MOR187-3 [Mus musculus] gb|AAP71460.1| olfactory receptor Olfr1008 [Mus musculus] emb|CAM16171.1| olfactory... receptor 1008 [Mus musculus] gb|EDL27333.1| olfactory receptor 1008 [Mus musculus] NP_667077.1 1e-133 75% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1238 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1238 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-116 72% ...

  4. NCBI nr-aa BLAST: CBRC-MMUR-01-0402 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0402 ref|NP_667088.1| olfactory receptor 1395 [Mus musculus] gb|AAL60876.1| olfactory... receptor MOR277-1 [Mus musculus] gb|AAP71777.1| olfactory receptor Olfr1395 [Mus musculus] emb|CAM46261.1| olfactory... receptor 1395 [Mus musculus] gb|EDL33774.1| olfactory receptor 1395 [Mus musculus] NP_667088.1 5e-32 80% ...

  5. NCBI nr-aa BLAST: CBRC-DNOV-01-0483 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0483 ref|NP_667122.1| olfactory receptor 1377 [Mus musculus] gb|AAL60840.1| olfactory... receptor MOR129-1 [Mus musculus] gb|AAP71759.1| olfactory receptor Olfr1377 [Mus musculus] emb|CAI35307.1| olfactory... receptor 1377 [Mus musculus] gb|EDL33683.1| olfactory receptor 1377 [Mus musculus] NP_667122.1 1e-140 79% ...

  6. NCBI nr-aa BLAST: CBRC-BTAU-01-0513 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0513 ref|NP_666854.1| olfactory receptor 1155 [Mus musculus] gb|AAL61117.1| olfactory... receptor MOR174-10 [Mus musculus] gb|AAP71568.1| olfactory receptor Olfr1155 [Mus musculus] emb|CAM18637.1| olfactory... receptor 1155 [Mus musculus] gb|EDL27414.1| olfactory receptor 1155 [Mus musculus] NP_666854.1 1e-125 77% ...

  7. NCBI nr-aa BLAST: CBRC-CPOR-01-0795 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-0795 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 4e-74 52% ...

  8. NCBI nr-aa BLAST: CBRC-GGOR-01-1194 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-1194 ref|NP_666646.1| olfactory receptor 993 [Mus musculus] gb|AAL61326.1| olfactory... receptor MOR203-2 [Mus musculus] gb|AAP71451.1| olfactory receptor Olfr993 [Mus musculus] emb|CAM24030.1| olfactory... receptor 993 [Mus musculus] gb|EDL27327.1| olfactory receptor 993 [Mus musculus] NP_666646.1 1e-110 67% ...

  9. NCBI nr-aa BLAST: CBRC-MMUS-02-0150 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-02-0150 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-133 74% ...

  10. NCBI nr-aa BLAST: CBRC-CPOR-01-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-0039 ref|NP_667019.1| olfactory receptor 1240 [Mus musculus] gb|AAL60949.1| olfactory... receptor MOR231-8 [Mus musculus] gb|AAP71635.1| olfactory receptor Olfr1240 [Mus musculus] emb|CAM27922.1| olfactory... receptor 1240 [Mus musculus] gb|EDL27460.1| olfactory receptor 1240 [Mus musculus] NP_667019.1 1e-136 76% ...

  11. NCBI nr-aa BLAST: CBRC-LAFR-01-2829 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2829 ref|NP_667194.1| olfactory receptor 1256 [Mus musculus] gb|AAL60768.1| olfactory... receptor MOR231-1 [Mus musculus] gb|AAP71649.1| olfactory receptor Olfr1256 [Mus musculus] emb|CAM19163.1| olfactory... receptor 1256 [Mus musculus] gb|EDL27463.1| olfactory receptor 1256 [Mus musculus] NP_667194.1 1e-137 78% ...

  12. NCBI nr-aa BLAST: CBRC-LAFR-01-3501 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3501 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-117 67% ...

  13. NCBI nr-aa BLAST: CBRC-LAFR-01-3226 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3226 ref|NP_666854.1| olfactory receptor 1155 [Mus musculus] gb|AAL61117.1| olfactory... receptor MOR174-10 [Mus musculus] gb|AAP71568.1| olfactory receptor Olfr1155 [Mus musculus] emb|CAM18637.1| olfactory... receptor 1155 [Mus musculus] gb|EDL27414.1| olfactory receptor 1155 [Mus musculus] NP_666854.1 1e-110 77% ...

  14. NCBI nr-aa BLAST: CBRC-STRI-01-1815 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1815 ref|NP_666644.1| olfactory receptor 994 [Mus musculus] gb|AAL61328.1| olfactory... receptor MOR203-4 [Mus musculus] gb|AAP71452.1| olfactory receptor Olfr994 [Mus musculus] emb|CAM24031.1| olfactory... receptor 994 [Mus musculus] gb|EDL27328.1| olfactory receptor 994 [Mus musculus] NP_666644.1 1e-139 79% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-1221 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1221 ref|NP_666646.1| olfactory receptor 993 [Mus musculus] gb|AAL61326.1| olfactory... receptor MOR203-2 [Mus musculus] gb|AAP71451.1| olfactory receptor Olfr993 [Mus musculus] emb|CAM24030.1| olfactory... receptor 993 [Mus musculus] gb|EDL27327.1| olfactory receptor 993 [Mus musculus] NP_666646.1 1e-139 77% ...

  16. NCBI nr-aa BLAST: CBRC-STRI-01-2296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2296 ref|NP_667194.1| olfactory receptor 1256 [Mus musculus] gb|AAL60768.1| olfactory... receptor MOR231-1 [Mus musculus] gb|AAP71649.1| olfactory receptor Olfr1256 [Mus musculus] emb|CAM19163.1| olfactory... receptor 1256 [Mus musculus] gb|EDL27463.1| olfactory receptor 1256 [Mus musculus] NP_667194.1 1e-130 74% ...

  17. NCBI nr-aa BLAST: CBRC-EEUR-01-1209 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1209 ref|NP_667088.1| olfactory receptor 1395 [Mus musculus] gb|AAL60876.1| olfactory... receptor MOR277-1 [Mus musculus] gb|AAP71777.1| olfactory receptor Olfr1395 [Mus musculus] emb|CAM46261.1| olfactory... receptor 1395 [Mus musculus] gb|EDL33774.1| olfactory receptor 1395 [Mus musculus] NP_667088.1 1e-101 58% ...

  18. NCBI nr-aa BLAST: CBRC-LAFR-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0121 ref|NP_667223.1| olfactory receptor 1047 [Mus musculus] gb|AAL60739.1| olfactory... receptor MOR188-3 [Mus musculus] gb|AAP71493.1| olfactory receptor Olfr1047 [Mus musculus] emb|CAM18161.1| olfactory... receptor 1047 [Mus musculus] gb|EDL27358.1| olfactory receptor 1047 [Mus musculus] NP_667223.1 1e-111 81% ...

  19. NCBI nr-aa BLAST: CBRC-MMUR-01-0611 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0611 ref|NP_667088.1| olfactory receptor 1395 [Mus musculus] gb|AAL60876.1| olfactory... receptor MOR277-1 [Mus musculus] gb|AAP71777.1| olfactory receptor Olfr1395 [Mus musculus] emb|CAM46261.1| olfactory... receptor 1395 [Mus musculus] gb|EDL33774.1| olfactory receptor 1395 [Mus musculus] NP_667088.1 1e-101 59% ...

  20. NCBI nr-aa BLAST: CBRC-MDOM-05-0203 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-05-0203 ref|NP_667189.1| olfactory receptor 1258 [Mus musculus] gb|AAL60773.1| olfactory... receptor MOR232-3 [Mus musculus] gb|AAP71652.1| olfactory receptor Olfr1258 [Mus musculus] emb|CAM27661.1| olfactory... receptor 1258 [Mus musculus] gb|EDL27464.1| olfactory receptor 1258 [Mus musculus] NP_667189.1 1e-148 83% ...