Multi-Index Stochastic Collocation (MISC) for random elliptic PDEs
Haji Ali, Abdul Lateef; Nobile, Fabio; Tamellini, Lorenzo; Tempone, Raul
2016-01-01
In this work we introduce the Multi-Index Stochastic Collocation method (MISC) for computing statistics of the solution of a PDE with random data. MISC is a combination technique based on mixed differences of spatial approximations and quadratures over the space of random data. We propose an optimization procedure to select the most effective mixed differences to include in the MISC estimator: such optimization is a crucial step and allows us to build a method that, provided with sufficient solution regularity, is potentially more effective than other multi-level collocation methods already available in literature. We then provide a complexity analysis that assumes decay rates of product type for such mixed differences, showing that in the optimal case the convergence rate of MISC is only dictated by the convergence of the deterministic solver applied to a one dimensional problem. We show the effectiveness of MISC with some computational tests, comparing it with other related methods available in the literature, such as the Multi-Index and Multilevel Monte Carlo, Multilevel Stochastic Collocation, Quasi Optimal Stochastic Collocation and Sparse Composite Collocation methods.
Multi-Index Stochastic Collocation (MISC) for random elliptic PDEs
Haji Ali, Abdul Lateef
2016-01-06
In this work we introduce the Multi-Index Stochastic Collocation method (MISC) for computing statistics of the solution of a PDE with random data. MISC is a combination technique based on mixed differences of spatial approximations and quadratures over the space of random data. We propose an optimization procedure to select the most effective mixed differences to include in the MISC estimator: such optimization is a crucial step and allows us to build a method that, provided with sufficient solution regularity, is potentially more effective than other multi-level collocation methods already available in literature. We then provide a complexity analysis that assumes decay rates of product type for such mixed differences, showing that in the optimal case the convergence rate of MISC is only dictated by the convergence of the deterministic solver applied to a one dimensional problem. We show the effectiveness of MISC with some computational tests, comparing it with other related methods available in the literature, such as the Multi-Index and Multilevel Monte Carlo, Multilevel Stochastic Collocation, Quasi Optimal Stochastic Collocation and Sparse Composite Collocation methods.
Anodic Aluminum Oxide (AAO) Membranes for Cellular Devices
Ventura, Anthony P.
Anodic Aluminum Oxide (AAO) membranes can be fabricated with a highly tunable pore structure making them a suitable candidate for cellular hybrid devices with single-molecule selectivity. The objective of this study was to characterize the cellular response of AAO membranes with varying pore sizes to serve as a proof-of-concept for an artificial material/cell synapse system. AAO membranes with pore diameters ranging from 34-117 nm were achieved via anodization at a temperature of -1°C in a 2.7% oxalic acid electrolyte. An operating window was established for this setup to create membranes with through-pore and disordered pore morphologies. C17.2 neural stem cells were seeded onto the membranes and differentiated via serum withdrawal. The data suggests a highly tunable correlation between AAO pore diameter and differentiated cell populations. Analysis of membranes before and after cell culture indicated no breakdown of the through-pore structure. Immunocytochemistry (ICC) showed that AAO membranes had increased neurite outgrowth when compared to tissue culture treated (TCT) glass, and neurite outgrowth varied with pore diameter. Additionally, lower neuronal percentages were found on AAO as compared to TCT glass; however, neuronal population was also found to vary with pore diameter. Scanning electron microscopy (SEM) and ICC images suggested the presence of a tissue-like layer with a mixed-phenotype population. AAO membranes appear to be an excellent candidate for cellular devices, but more work must be completed to understand the surface chemistry of the AAO membranes as it relates to cellular response.
[The photoluminescence and absorption properties of Co/AAO nano-array composites].
Li, Shou-Yi; Wang, Cheng-Wei; Li, Yan; Wang, Jian; Ma, Bao-Hong
2008-03-01
Ordered Co/AAO nano-array structures were fabricated by alternating current (AC) electrodeposition method within the cylindrical pores of anodic aluminum oxide (AAO) template prepared in oxalic acid electrolyte. The photoluminescence (PL) emission and photoabsorption of AAO templates and Co/AAO nano-array structures were investigated respectively. The results show that a marked photoluminescence band of AAO membranes occurs in the wavelength range of 350-550 nm and their PL peak position is at 395 nm. And with the increase in the deposition amount of Co nanoparticles, the PL intensity of Co/AAO nano-array structures decreases gradually, and their peak positions of the PL are invariable (395 nm). Meanwhile the absorption edges of Co/AAO show a larger redshift, and the largest shift from the near ultraviolet to the infrared exceeds 380 nm. The above phenomena caused by Co nano-particles in Co/AAO composite were analyzed.
International Nuclear Information System (INIS)
Michalska-Domańska, Marta; Norek, Małgorzata; Stępniowski, Wojciech J.; Budner, Bogusław
2013-01-01
Highlights: • Nanoporous alumina was fabricated by anodization in sulfuric acid solution with glycol. • The AAO manufacturing on low- and high-purity Al was compared. • The pores size was ranging between 30 and 50 nm. • No difference in the quality of the AAO fabricated on both Al types was observed. • The current vs. anodization time curves were recorded. -- Abstract: In this work the quality, arrangement, composition, and regularity of nanoporous AAO formed on the low-purity (AA1050) and high-purity aluminum during two-step anodization in a mixture of sulfuric acid solution (0.3 M), water and glycol (3:2, v/v), at various voltages (15, 20, 25, 30, 35 V) and at temperature of −1 °C, are investigated. The electrochemical conditions have allowed to obtain pores with the size ranging from 30 to 50 nm, which are much larger than those usually obtained by anodization in a pure sulfuric acid solution (<20 nm). The mechanism of the AAO growth is discussed. It was found that with the increase of applied anodizing voltage a number of incorporated sulfate ions in the aluminum oxide matrix increases, which was connected with the appearance of an unusual area in the current vs. time curves. On the surface of anodizing low- and high-purity aluminum, the formation of hillocks was observed, which was associated with the sulfate ions incorporation. The sulfate ions are replacing the oxygen atom/atoms in the AAO amorphous crystal structure and, consequently, the AAO template swells, the oxide cracks and uplifts causing the formation of hillocks. The same mechanism occurs for both low- and high-purity aluminum. Nanoporous AAO characterized by a very high regularity, not registered previously for low purity aluminum, was obtained. Furthermore, no significant difference in the regularity ratio between the AAO obtained on low- and high-purity aluminum, was observed. The electrochemical conditions applied in this study can be, thus, used for the fabrication of high quality
Four-year-BS-position-paper.pdf | misc docs | academy | Indian ...
Indian Academy of Sciences (India)
Home; academy; misc docs; Four-year-BS-position-paper.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of ...
Fabrication of nanopore and nanoparticle arrays with high aspect ratio AAO masks
Li, Z. P.; Xu, Z. M.; Qu, X. P.; Wang, S. B.; Peng, J.; Mei, L. H.
2017-03-01
How to use high aspect ratio anodic aluminum oxide (AAO) membranes as an etching and evaporation mask is one of the unsolved problems in the application of nanostructured arrays. Here we describe the versatile utilizations of the highly ordered AAO membranes with a high aspect ratio of more than 20 used as universal masks for the formation of various nanostructure arrays on various substrates. The result shows that the fabricated nanopore and nanoparticle arrays of substrates inherit the regularity of the AAO membranes completely. The flat AAO substrates and uneven AAO frontages were attached to the Si substrates respectively as an etching mask, which demonstrates that the two kinds of replication, positive and negative, represent the replication of the mirroring of Si substrates relative to the flat AAO substrates and uneven AAO frontages. Our work is a breakthrough for the broad research field of surface nano-masking.
Electrochemical synthesis of polydiphenylamine nanofibrils through AAO template
International Nuclear Information System (INIS)
Zhao Yanchun; Chen Miao; Liu Xiang; Xu Tao; Liu Weimin
2005-01-01
Highly ordered polydiphenylamine (PDPA) nanofibrils arrays have been fabricated within the pores of porous anodic aluminum oxide (AAO) template membrane by electrochemical polymerization. The morphology of PDPA nanofibrils array was observed using transmission electron microscopy (TEM) and its electrochemical behavior and structure were examined by cyclic voltammetry, UV-vis spectroscopy and Fourier transmission infrared spectrum. The result of TEM revealed that the obtained PDPA nanofibrils had uniform and well-aligned array. The UV-vis spectroscopy and electrochemical experimental result indicated that the spatial restraint in the pores of AAO membrane is sufficient to induce the formation of more ordered PDPA chains in the AAO membrane
Electrochemical synthesis of polydiphenylamine nanofibrils through AAO template
Energy Technology Data Exchange (ETDEWEB)
Yanchun, Zhao [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Miao, Chen [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Xiang, Liu [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Tao, Xu [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Weimin, Liu [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China)
2005-06-15
Highly ordered polydiphenylamine (PDPA) nanofibrils arrays have been fabricated within the pores of porous anodic aluminum oxide (AAO) template membrane by electrochemical polymerization. The morphology of PDPA nanofibrils array was observed using transmission electron microscopy (TEM) and its electrochemical behavior and structure were examined by cyclic voltammetry, UV-vis spectroscopy and Fourier transmission infrared spectrum. The result of TEM revealed that the obtained PDPA nanofibrils had uniform and well-aligned array. The UV-vis spectroscopy and electrochemical experimental result indicated that the spatial restraint in the pores of AAO membrane is sufficient to induce the formation of more ordered PDPA chains in the AAO membrane.
Synthesis of Hybrid Conducting Nanowire Using AAO Template
2006-09-28
oxide and alujminum oxide in anodized aluminum oxide ( AAO ) template with various aspect ratio and...than 3 nm. 2. Experimentals Anodized aluminum oxide ( AAO ) template was prepared from 99.999% purity aluminum foil by performing the following...to prepare uniform dimension of nanomaterials is to use anodized alumina membrane as template. The work emphasized self-organized arrangement of
Fast anodization fabrication of AAO and barrier perforation process on ITO glass
Liu, Sida; Xiong, Zuzhou; Zhu, Changqing; Li, Ma; Zheng, Maojun; Shen, Wenzhong
2014-04-01
Thin films of porous anodic aluminum oxide (AAO) on tin-doped indium oxide (ITO) substrates were fabricated through evaporation of a 1,000- to 2,000-nm-thick Al, followed by anodization with different durations, electrolytes, and pore widening. A faster method to obtain AAO on ITO substrates has been developed, which with 2.5 vol.% phosphoric acid at a voltage of 195 V at 269 K. It was found that the height of AAO films increased initially and then decreased with the increase of the anodizing time. Especially, the barrier layers can be removed by extending the anodizing duration, which is very useful for obtaining perforation AAO and will broaden the application of AAO on ITO substrates.
A Brief Note on the Magnetowetting of Magnetic Nanofluids on AAO Surfaces
Chien, Yu-Chin
2018-01-01
In magnetowetting, the material properties of liquid, surface morphology of solid, and applied external field are three major factors used to determine the wettability of a liquid droplet on a surface. For wetting measurements, an irregular or uneven surface could result in a significant experimental uncertainty. The periodic array with a hexagonal symmetry structure is an advantage of the anodic aluminum oxide (AAO) structure. This study presents the results of the wetting properties of magnetic nanofluid sessile droplets on surfaces of various AAO pore sizes under an applied external magnetic field. Stable, water-based magnetite nanofluids are prepared by combining the chemical co-precipitation with the sol-gel technique, and AAO surfaces are then generated by anodizing the aluminum sheet in the beginning. The influence of pore size and magnetic field gradient on the magnetowetting of magnetic nanofluids on AAO surfaces is then investigated by an optical test system. Experimental results show that increasing the processing voltage of AAO templates could result in enhanced non-wettability behavior; that is, the increase in AAO pore size could lead to the increase in contact angle. The contact angle could be reduced by the applied magnetic field gradient. In general, the magnetic field has a more significant effect at smaller AAO pore sizes. PMID:29461509
A Brief Note on the Magnetowetting of Magnetic Nanofluids on AAO Surfaces
Directory of Open Access Journals (Sweden)
Yu-Chin Chien
2018-02-01
Full Text Available In magnetowetting, the material properties of liquid, surface morphology of solid, and applied external field are three major factors used to determine the wettability of a liquid droplet on a surface. For wetting measurements, an irregular or uneven surface could result in a significant experimental uncertainty. The periodic array with a hexagonal symmetry structure is an advantage of the anodic aluminum oxide (AAO structure. This study presents the results of the wetting properties of magnetic nanofluid sessile droplets on surfaces of various AAO pore sizes under an applied external magnetic field. Stable, water-based magnetite nanofluids are prepared by combining the chemical co-precipitation with the sol-gel technique, and AAO surfaces are then generated by anodizing the aluminum sheet in the beginning. The influence of pore size and magnetic field gradient on the magnetowetting of magnetic nanofluids on AAO surfaces is then investigated by an optical test system. Experimental results show that increasing the processing voltage of AAO templates could result in enhanced non-wettability behavior; that is, the increase in AAO pore size could lead to the increase in contact angle. The contact angle could be reduced by the applied magnetic field gradient. In general, the magnetic field has a more significant effect at smaller AAO pore sizes.
AAO-CNTs electrode on microfluidic flow injection system for rapid iodide sensing.
Phokharatkul, Ditsayut; Karuwan, Chanpen; Lomas, Tanom; Nacapricha, Duangjai; Wisitsoraat, Anurat; Tuantranont, Adisorn
2011-06-15
In this work, carbon nanotubes (CNTs) nanoarrays in anodized aluminum oxide (AAO-CNTs) nanopore is integrated on a microfluidic flow injection system for in-channel electrochemical detection of iodide. The device was fabricated from PDMS (polydimethylsiloxane) microchannel bonded on glass substrates that contains three-electrode electrochemical system, including AAO-CNTs as a working electrode, silver as a reference electrode and platinum as an auxiliary electrode. Aluminum, stainless steel catalyst, silver and platinum layers were sputtered on the glass substrate through shadow masks. Aluminum layer was then anodized by two-step anodization process to form nanopore template. CNTs were then grown in AAO template by thermal chemical vapor deposition. The amperometric detection of iodide was performed in 500-μm-wide and 100-μm-deep microchannels on the microfluidic chip. The influences of flow rate, injection volume and detection potential on the current response were optimized. From experimental results, AAO-CNTs electrode on chip offers higher sensitivity and wider dynamic range than CNTs electrode with no AAO template. Copyright © 2011 Elsevier B.V. All rights reserved.
Luminescence parameters of InP/ZnS@AAO nanostructures
Savchenko, S. S.; Vokhmintsev, A. S.; Weinstein, I. A.
2016-03-01
Nanostructured membranes of anodic aluminum oxide (AAO) with InP/ZnS semiconductor nanocrystals deposited in pores were synthesized by electrochemical technique, physical deposition and post processing in an ultrasonic bath. Photoluminescence spectra of the samples were studied. Fluorescent properties of the quantum dots are found to be retained after the deposition. The color range is illustrated that can be covered using membranes annealed at temperatures AAO phosphor are (0.21, 0.26) and 4115 K, respectively.
Readability of Online Patient Education Materials From the AAOS Web Site
Badarudeen, Sameer; Unes Kunju, Shebna
2008-01-01
One of the goals of the American Academy of Orthopaedic Surgeons (AAOS) is to disseminate patient education materials that suit the readability skills of the patient population. According to standard guidelines from healthcare organizations, the readability of patient education materials should be no higher than the sixth-grade level. We hypothesized the readability level of patient education materials available on the AAOS Web site would be higher than the recommended grade level, regardless when the material was available online. Readability scores of all articles from the AAOS Internet-based patient information Web site, “Your Orthopaedic Connection,” were determined using the Flesch-Kincaid grade formula. The mean Flesch-Kincaid grade level of the 426 unique articles was 10.43. Only 10 (2%) of the articles had the recommended readability level of sixth grade or lower. The readability of the articles did not change with time. Our findings suggest the majority of the patient education materials available on the AAOS Web site had readability scores that may be too difficult for comprehension by a substantial portion of the patient population. PMID:18324452
High Density Silver Nanowire Arrays using Self-ordered Anodic Aluminum Oxide (AAO) Membrane
Han, Young-Hwan
2008-01-01
High density silver nanowire arrays were synthesized through the self-ordered Anodic Aluminum Oxide (AAO) template. The pore size in the AAO membrane was confirmed by processing the widening porosity with a honeycomb structure with cross sections of 20nm, 50nm, and 100nm, by SEM. Pore numbers by unit area were consistent; only pore size changed. The synthesized silver nanowire, which was crystallized, was dense in the cross sections of the amorphous AAO membrane. The synthesized silver nanowi...
Shaban, Mohamed; Mustafa, Mona; Hamdy, Hany
2016-04-01
In this study, Mg-doped CdS nanostructure was deposited onto anodic aluminum oxide (AAO) membrane substrate using sol-gel spin coating method. The AAO membrane was prepared by a two-step anodization process combined with pore widening process. The morphology, chemical composition, and structure of the spin- coated CdS nanostructure have been studied. The morphology of the fabricated AAO membrane and the deposited Mg-doped CdS nanostructure was investigated using scanning electron microscopy (SEM). The SEM of AAO illustrates a typical hexagonal and smooth nanoporous alumina membrane with interpore distance of ~ 100 nm, the pore diameter of ~ 60 nm. SEM of Mgdoped CdS shows porous nanostructured film of CdS nanoparticles. This film well adherents and covers the AAO substrate. The energy dispersive X-ray (EDX) pattern exhibits the signals of Al, O from AAO membrane and Mg, Cd, and S from the deposited CdS. This indicates the high purity of the fabricated membrane and the deposited Mg-doped CdS nanostructure. Using X-ray diffraction (XRD) pattern, Scherrer equation was used to calculate the average crystallite size. Additionally, the texture coefficients and density of dislocations were calculated. The fabricated CdS/AAO was applied to detect glucose of different concentrations. The proposed method has some advantages such as simple technology, low cost of processing, and high throughput. All of these factors facilitate the use of the prepared films in sensing applications.
Luminescence parameters of InP/ZnS@AAO nanostructures
International Nuclear Information System (INIS)
Savchenko, S. S.; Vokhmintsev, A. S.; Weinstein, I. A.
2016-01-01
Nanostructured membranes of anodic aluminum oxide (AAO) with InP/ZnS semiconductor nanocrystals deposited in pores were synthesized by electrochemical technique, physical deposition and post processing in an ultrasonic bath. Photoluminescence spectra of the samples were studied. Fluorescent properties of the quantum dots are found to be retained after the deposition. The color range is illustrated that can be covered using membranes annealed at temperatures < 900°C and by varying the concentration of the deposited InP/ZnS nanocrystals. Chromaticity coordinates and correlated color temperature for the fabricated white InP/ZnS@AAO phosphor are (0.21, 0.26) and 4115 K, respectively.
Luminescence parameters of InP/ZnS@AAO nanostructures
Energy Technology Data Exchange (ETDEWEB)
Savchenko, S. S.; Vokhmintsev, A. S.; Weinstein, I. A., E-mail: i.a.weinstein@urfu.ru [Ural Federal University, NANOTECH Centre, Mira str., 19, Yekaterinburg, Russia, 620002 (Russian Federation)
2016-03-29
Nanostructured membranes of anodic aluminum oxide (AAO) with InP/ZnS semiconductor nanocrystals deposited in pores were synthesized by electrochemical technique, physical deposition and post processing in an ultrasonic bath. Photoluminescence spectra of the samples were studied. Fluorescent properties of the quantum dots are found to be retained after the deposition. The color range is illustrated that can be covered using membranes annealed at temperatures < 900°C and by varying the concentration of the deposited InP/ZnS nanocrystals. Chromaticity coordinates and correlated color temperature for the fabricated white InP/ZnS@AAO phosphor are (0.21, 0.26) and 4115 K, respectively.
Self-ordering behavior of nanoporous anodic aluminum oxide (AAO) in malonic acid anodization
International Nuclear Information System (INIS)
Lee, W; Nielsch, K; Goesele, U
2007-01-01
The self-ordering behavior of anodic aluminum oxide (AAO) has been investigated for anodization of aluminum in malonic acid (H 4 C 3 O 4 ) solution. In the present study it is found that a porous oxide layer formed on the surface of aluminum can effectively suppress catastrophic local events (such as breakdown of the oxide film and plastic deformation of the aluminum substrate), and enables stable fast anodic oxidation under a high electric field of 110-140 V and ∼100 mA cm -2 . Studies on the self-ordering behavior of AAO indicated that the cell homogeneity of AAO increases dramatically as the anodization voltage gets higher than 120 V. Highly ordered AAO with a hexagonal arrangement of the nanopores could be obtained in a voltage range 125-140 V. The current density (i.e., the electric field strength (E) at the bottom of a pore) is an important parameter governing the self-ordering of the nanopores as well as the interpore distance (D int ) for a given anodization potential (U) during malonic acid anodization
Energy Technology Data Exchange (ETDEWEB)
Liu, Yi-Fan; Wang, Feng-Hua; Guo, Dong-Lai; Huang, Sheng-You; Zou, Xian-Wu [Wuhan University, Department of Physics, Wuhan (China); Sang, Jian-Ping [Wuhan University, Department of Physics, Wuhan (China); Jianghan University, Department of Physics, Wuhan (China)
2009-11-15
Ni-P/AAO nano-array composite structure assemblies with Ni and P grown in the pores of anodic aluminum oxide (AAO) membranes were prepared by electroless deposition. The results of SEM, TEM and SAED show that as-deposited Ni-P nanowires have an amorphous structure and a few nanocrystallites form after annealing. The optical absorption spectra reveal that, as the annealing temperature increases, the absorption band edge of the Ni-P/AAO composite structure is obviously blue shifted, which is attributed to a decrease of the internal pressure after heat treatment. Meanwhile, the annealed Ni-P/AAO nano-array composite structure exhibits the absorption behavior of a direct band gap semiconductor. Details of this behavior are discussed together with the implications for potential device applications. (orig.)
The Readability of AAOS Patient Education Materials: Evaluating the Progress Since 2008.
Roberts, Heather; Zhang, Dafang; Dyer, George S M
2016-09-07
The Internet has become a major resource for patients; however, patient education materials are frequently written at relatively high levels of reading ability. The purpose of this study was to evaluate the readability of patient education materials on the American Academy of Orthopaedic Surgeons (AAOS) web site. Readability scores were calculated for all patient education articles on the AAOS web site using 5 algorithms: Flesch Reading Ease, Flesch-Kincaid Grade Level, SMOG (Simple Measure of Gobbledygook) Grade, Coleman-Liau Index, and Gunning-Fog Index. The mean readability scores were compared across the anatomic categories to which they pertained. Using a liberal measure of readability, the Flesch-Kincaid Grade Level, 3.9% of articles were written at or below the recommended sixth-grade reading level, and 84% of the articles were written above the eighth-grade reading level. Articles in the present study had a lower mean Flesch-Kincaid Grade Level than those available in 2008 (p readability levels of AAOS articles are higher than generally recommended. Although the mean Flesch-Kincaid Grade Level was lower in the present study than it was in 2008, a need remains to improve the readability of AAOS patient education articles. Ensuring that online patient education materials are written at an appropriate reading grade level would be expected to improve physician-patient communication. Copyright © 2016 by The Journal of Bone and Joint Surgery, Incorporated.
International Nuclear Information System (INIS)
He, Geping; Fan, Huiqing; Wang, Kaige; Yin, Hongfeng; Wu, Junjun
2013-01-01
Highlights: • Tilted cathode was adopted to fabricate PAAM during the second anodization. • AAO/CeO 2 nanosystem was prepared from PAAM by electrochemical deposition. • The larger the cathode intersection angle, the more the charges are stored in the system. • The system's hydrophobicity was improved by an increase in tilted cathode angle. • The optimum angle of the tilted cathode is 40° for charge storage and hydrophobicity. -- Abstract: Tilted cathode was adopted to prepare porous anodic alumina membrane (PAAM) during the second aluminum anodic oxidation (AAO). A heterostructured AAO/CeO 2 nanosystem was fabricated by filling CeO 2 into the PAAM by electrochemical deposition. The larger the intersection angle of the cathode, the more the charge storage of the fabricated system. A lower potential scan rate is beneficial to the electrochemical charge storage of the system. With the cathode intersection angle increasing, the hydrophobicity of the AAO/CeO 2 system is greatly improved. As the 40° is the optimum angle, the charge storage and hydrophobicity of the system increase with the increasing cathode intersection angle up to 40°. The AAO/CeO 2 system could be utilized in both charge storage and self-cleaning
Fabrication and characterization of a flow-through nanoporous gold nanowire/AAO composite membrane
Energy Technology Data Exchange (ETDEWEB)
Liu, L; Lee, W; Huang, Z; Scholz, R; Goesele, U [Max Planck Institute of Microstructure Physics, Weinberg 2, D-06120 Halle (Germany)
2008-08-20
The fabrication of a composite membrane of nanoporous gold nanowires and anodic aluminum oxide (AAO) is demonstrated by the electrodeposition of Au-Ag alloy nanowires into an AAO membrane, followed by selective etching of silver from the alloy nanowires. This composite membrane is advantageous for flow-through type catalytic reactions. The morphology evolution of the nanoporous gold nanowires as a function of the diameter of the Au-Ag nanowire 'precursors' is also investigated.
Fabrication and characterization of a flow-through nanoporous gold nanowire/AAO composite membrane
International Nuclear Information System (INIS)
Liu, L; Lee, W; Huang, Z; Scholz, R; Goesele, U
2008-01-01
The fabrication of a composite membrane of nanoporous gold nanowires and anodic aluminum oxide (AAO) is demonstrated by the electrodeposition of Au-Ag alloy nanowires into an AAO membrane, followed by selective etching of silver from the alloy nanowires. This composite membrane is advantageous for flow-through type catalytic reactions. The morphology evolution of the nanoporous gold nanowires as a function of the diameter of the Au-Ag nanowire 'precursors' is also investigated
Fabrication and characterization of a flow-through nanoporous gold nanowire/AAO composite membrane.
Liu, L; Lee, W; Huang, Z; Scholz, R; Gösele, U
2008-08-20
The fabrication of a composite membrane of nanoporous gold nanowires and anodic aluminum oxide (AAO) is demonstrated by the electrodeposition of Au-Ag alloy nanowires into an AAO membrane, followed by selective etching of silver from the alloy nanowires. This composite membrane is advantageous for flow-through type catalytic reactions. The morphology evolution of the nanoporous gold nanowires as a function of the diameter of the Au-Ag nanowire 'precursors' is also investigated.
Choudhary, Eric; Szalai, Veronika
2016-01-01
Nanoporous anodic aluminum oxide (AAO) membranes are being used for an increasing number of applications. However, the original two-step anodization method in which the first anodization is sacrificial to pre-pattern the second is still widely used to produce them. This method provides relatively low throughput and material utilization as half of the films are discarded. An alternative scheme that relies on alternating anodization and cathodic delamination is demonstrated that allows for the fabrication of several AAO films with only one sacrificial layer thus greatly improving total aluminum to alumina yield. The thickness for which the cathodic delamination performs best to yield full, unbroken AAO sheets is around 85 μm. Additionally, an image analysis method is used to quantify the degree of long-range ordering of the unit cells in the AAO films which was found to increase with each successive iteration of the fabrication cycle.
Chahrour, Khaled M.; Ahmed, Naser M.; Hashim, M. R.; Elfadill, Nezar G.; Maryam, W.; Ahmad, M. A.; Bououdina, M.
2015-12-01
Highly-ordered and hexagonal-shaped nanoporous anodic aluminum oxide (AAO) of 1 μm thickness of Al pre-deposited onto Si substrate using two-step anodization was successfully fabricated. The growth mechanism of the porous AAO film was investigated by anodization current-time behavior for different anodizing voltages and by visualizing the microstructural procedure of the fabrication of AAO film by two-step anodization using cross-sectional and top view of FESEM imaging. Optimum conditions of the process variables such as annealing time of the as-deposited Al thin film and pore widening time of porous AAO film were experimentally determined to obtain AAO films with uniformly distributed and vertically aligned porous microstructure. Pores with diameter ranging from 50 nm to 110 nm and thicknesses between 250 nm and 1400 nm, were obtained by controlling two main influential anodization parameters: the anodizing voltage and time of the second-step anodization. X-ray diffraction analysis reveals amorphous-to-crystalline phase transformation after annealing at temperatures above 800 °C. AFM images show optimum ordering of the porous AAO film anodized under low voltage condition. AAO films may be exploited as templates with desired size distribution for the fabrication of CuO nanorod arrays. Such nanostructured materials exhibit unique properties and hold high potential for nanotechnology devices.
Simulation of Photon energy Spectra Using MISC, SOURCES, MCNP and GADRAS
International Nuclear Information System (INIS)
Tucker, Lucas P.; Shores, Erik F.; Myers, Steven C.; Felsher, Paul D.; Garner, Scott E.; Solomon, Clell J. Jr.
2012-01-01
The detector response functions included in the Gamma Detector Response and Analysis Software (GADRAS) are a valuable resource for simulating radioactive source emission spectra. Application of these response functions to the results of three-dimensional transport calculations is a useful modeling capability. Using a 26.2 kg shell of depleted uranium (DU) as a simple test problem, this work illustrates a method for manipulating current tally results from MCNP into the GAM file format necessary for a practical link to GADRAS detector response functions. MISC (MCNP Intrinsic Source Constructor) and SOURCES 4C were used to develop photon and neutron source terms for subsequent MCNP transport, and the resultant spectrum is shown to be in good agreement with that from GADRAS. A 1 kg DU sphere was also modeled with the method described here and showed similarly encouraging results.
Simulation of Photon energy Spectra Using MISC, SOURCES, MCNP and GADRAS
Energy Technology Data Exchange (ETDEWEB)
Tucker, Lucas P. [Los Alamos National Laboratory; Shores, Erik F. [Los Alamos National Laboratory; Myers, Steven C. [Los Alamos National Laboratory; Felsher, Paul D. [Los Alamos National Laboratory; Garner, Scott E. [Los Alamos National Laboratory; Solomon, Clell J. Jr. [Los Alamos National Laboratory
2012-08-14
The detector response functions included in the Gamma Detector Response and Analysis Software (GADRAS) are a valuable resource for simulating radioactive source emission spectra. Application of these response functions to the results of three-dimensional transport calculations is a useful modeling capability. Using a 26.2 kg shell of depleted uranium (DU) as a simple test problem, this work illustrates a method for manipulating current tally results from MCNP into the GAM file format necessary for a practical link to GADRAS detector response functions. MISC (MCNP Intrinsic Source Constructor) and SOURCES 4C were used to develop photon and neutron source terms for subsequent MCNP transport, and the resultant spectrum is shown to be in good agreement with that from GADRAS. A 1 kg DU sphere was also modeled with the method described here and showed similarly encouraging results.
Chahrour, Khaled M.; Ahmed, Naser M.; Hashim, M. R.; Elfadill, Nezar G.; Qaeed, M. A.; Bououdina, M.
2014-12-01
In this study, anodic aluminum oxide (AAO) templates of Aluminum thin films onto Ti-coated silicon substrates were prepared for growth of nanostructure materials. Hexagonally highly ordered thin AAO templates were fabricated under controllable conditions by using a two-step anodization. The obtained thin AAO templates were approximately 70 nm in pore diameter and 250 nm in length with 110 nm interpore distances within an area of 3 cm2. The difference between first and second anodization was investigated in details by in situ monitoring of current-time curve. A bottom barrier layer of the AAO templates was removed during dropping the voltage in the last period of the anodization process followed by a wet etching using phosphoric acid (5 wt%) for several minutes at ambient temperature. As an application, Zn nanorod arrays embedded in anodic alumina (AAO) template were fabricated by electrodeposition. Oxygen was used to oxidize the electrodeposited Zn nanorods in the AAO template at 700 °C. The morphology, structure and photoluminescence properties of ZnO/AAO assembly were analyzed using Field-emission scanning electron microscope (FESEM), Energy dispersive X-ray spectroscopy (EDX), Atomic force microscope (AFM), X-ray diffraction (XRD) and photoluminescence (PL).
Fabrication of indium sulfide nanofibers via a hydrothermal method assisted by AAO template
International Nuclear Information System (INIS)
Zhu Xiaoyi; Ma Junfeng; Wang Yonggang; Tao Jiantao; Zhou Jun; Zhao Zhongqiang; Xie Lijin; Tian Hua
2006-01-01
β-In 2 S 3 nanofibers were successfully synthesized via a hydrothermal method with AAO membrane as a template at 150 deg. C for 15 h. XRD patterns indicated the perfect crystallization of β-In 2 S 3 . SEM images showed that the β-In 2 S 3 nanofibers grew up from the channel ends of the AAO template. TEM images confirmed that the nanofibers had a high aspect ratio of ca. 40-50 and diameters of about 10 nm. The room temperature photoluminescence (PL) spectrum of the β-In 2 S 3 nanofibers indicated its potential applications in light-emission devices
Yang, Jiading; Worley, Eric
2014-01-01
Chlorophyll degradation is an important part of leaf senescence, but the underlying regulatory mechanisms are largely unknown. Excised leaves of an Arabidopsis thaliana NAC-LIKE, ACTIVATED BY AP3/PI (NAP) transcription factor mutant (nap) exhibited lower transcript levels of known chlorophyll degradation genes, STAY-GREEN1 (SGR1), NON-YELLOW COLORING1 (NYC1), PHEOPHYTINASE (PPH), and PHEIDE a OXYGENASE (PaO), and higher chlorophyll retention than the wild type during dark-induced senescence. Transcriptome coexpression analysis revealed that abscisic acid (ABA) metabolism/signaling genes were disproportionately represented among those positively correlated with NAP expression. ABA levels were abnormally low in nap leaves during extended darkness. The ABA biosynthetic genes 9-CIS-EPOXYCAROTENOID DIOXYGENASE2, ABA DEFICIENT3, and ABSCISIC ALDEHYDE OXIDASE3 (AAO3) exhibited abnormally low transcript levels in dark-treated nap leaves. NAP transactivated the promoter of AAO3 in mesophyll cell protoplasts, and electrophoretic mobility shift assays showed that NAP can bind directly to a segment (−196 to −162 relative to the ATG start codon) of the AAO3 promoter. Exogenous application of ABA increased the transcript levels of SGR1, NYC1, PPH, and PaO and suppressed the stay-green phenotype of nap leaves during extended darkness. Overexpression of AAO3 in nap leaves also suppressed the stay-green phenotype under extended darkness. Collectively, the results show that NAP promotes chlorophyll degradation by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone ABA. PMID:25516602
Lim, Namsoo; Pak, Yusin; Kim, Jin Tae; Hwang, Youngkyu; Lee, Ryeri; Kumaresan, Yogeenth; Myoung, Nosoung; Ko, Heung Cho; Jung, Gun Young
2015-08-01
Highly ordered silicon (Si) nanopores with a tunable sub-100 nm diameter were fabricated by a CF4 plasma etching process using an anodic aluminum oxide (AAO) membrane as an etching mask. To enhance the conformal contact of the AAO membrane mask to the underlying Si substrate, poly(methyl methacrylate) (PMMA) was spin-coated on top of the Si substrate prior to the transfer of the AAO membrane. The AAO membrane mask was fabricated by two-step anodization and subsequent removal of the aluminum support and the barrier layer, which was then transferred to the PMMA-coated Si substrate. Contact printing was performed on the sample with a pressure of 50 psi and a temperature of 120 °C to make a conformal contact of the AAO membrane mask to the Si substrate. The CF4 plasma etching was conducted to transfer nanopores onto the Si substrate through the PMMA interlayer. The introduced PMMA interlayer prevented unwanted surface etching of the Si substrate by eliminating the etching ions and radicals bouncing at the gap between the mask and the substrate, resulting in a smooth Si nanopore array.Highly ordered silicon (Si) nanopores with a tunable sub-100 nm diameter were fabricated by a CF4 plasma etching process using an anodic aluminum oxide (AAO) membrane as an etching mask. To enhance the conformal contact of the AAO membrane mask to the underlying Si substrate, poly(methyl methacrylate) (PMMA) was spin-coated on top of the Si substrate prior to the transfer of the AAO membrane. The AAO membrane mask was fabricated by two-step anodization and subsequent removal of the aluminum support and the barrier layer, which was then transferred to the PMMA-coated Si substrate. Contact printing was performed on the sample with a pressure of 50 psi and a temperature of 120 °C to make a conformal contact of the AAO membrane mask to the Si substrate. The CF4 plasma etching was conducted to transfer nanopores onto the Si substrate through the PMMA interlayer. The introduced PMMA interlayer
Magnetoresistive multilayers deposited on the AAO membranes
International Nuclear Information System (INIS)
Malkinski, Leszek M.; Chalastaras, Athanasios; Vovk, Andriy; Jung, Jin-Seung; Kim, Eun-Mee; Jun, Jong-Ho; Ventrice, Carl A.
2005-01-01
Silicon and GaAs wafers are the most commonly used substrates for deposition of giant magnetoresistive (GMR) multilayers. We explored a new type of a substrate, prepared electrochemically by anodization of aluminum sheets, for deposition of GMR multilayers. The surface of this AAO substrate consists of nanosized hemispheres organized in a regular hexagonal array. The current applied along the substrate surface intersects many magnetic layers in the multilayered structure, which results in enhancement of giant magnetoresistance effect. The GMR effect in uncoupled Co/Cu multilayers was significantly larger than the magnetoresistance of similar structures deposited on Si
Sui, Chaofan; Wang, Kaige; Wang, Shuang; Ren, Junying; Bai, Xiaohong; Bai, Jintao
2016-03-01
Most of SERS applications are constricted by heterogeneous hotspots and aggregates of nanostructure, which result in low sensitivity and poor reproducibility of characteristic signals. This work intends to introduce SERS properties of a type of SERS-active substrate, Au-CuCl2-AAO, which is innovatively developed on a porous anodic alumina oxide (AAO) template. Spectral measuring results of Rhodamine 6G (R6G) on this substrate optimized by controlling morphology and gold thickness showed that enhancement factor (2.30 × 107) and detection limit (10-10 M) were both improved and represented better performance than its template AAO. Homogenous hot spots across the region of interest were achieved by scanning SERS intensity distribution for the band at 1505 cm-1 in 5 × 5 μm2 area. Furthermore, the promising SERS activity of the flower-patterned substrate was theoretically explained through simulation of the electromagnetic field distribution. In addition, this SERS substrate is proposed for applications within the field of chemical and biochemical analyses.Most of SERS applications are constricted by heterogeneous hotspots and aggregates of nanostructure, which result in low sensitivity and poor reproducibility of characteristic signals. This work intends to introduce SERS properties of a type of SERS-active substrate, Au-CuCl2-AAO, which is innovatively developed on a porous anodic alumina oxide (AAO) template. Spectral measuring results of Rhodamine 6G (R6G) on this substrate optimized by controlling morphology and gold thickness showed that enhancement factor (2.30 × 107) and detection limit (10-10 M) were both improved and represented better performance than its template AAO. Homogenous hot spots across the region of interest were achieved by scanning SERS intensity distribution for the band at 1505 cm-1 in 5 × 5 μm2 area. Furthermore, the promising SERS activity of the flower-patterned substrate was theoretically explained through simulation of the
Carlson, Victor Rex; Ong, Alvin Chua; Orozco, Fabio Ramiro; Hernandez, Victor Hugo; Lutz, Rex William; Post, Zachary Douglas
2018-02-01
The American Academy of Orthopaedic Surgeons (AAOS) published a series of evidence-based guidelines for treatment of knee osteoarthritis (OA). We studied compliance with these guidelines among orthopaedic surgeons. We sent a survey to members of the American Association of Hip and Knee Surgeons. It included five clinical vignettes based on the Kellgren-Lawrence radiographic system for classification of knee OA. Respondents selected treatment currently supported or not supported by the AAOS guidelines. Of 345 responses, the frequency of use of recommended interventions was 80%, 82%, 21%, 50%, and 98% for OA at stages 0 through 4, respectively. For stage 2 and stage 3 OA, intra-articular hyaluronic acid was the most commonly selected intervention not recommended by the AAOS. Apparently, AAOS guidelines on the treatment of OA have not reached the orthopaedic community, resulting in lack of treatment consensus and continued use of modalities with no proven patient benefits. Management of moderate to severe knee OA does not align with AAOS guidelines. We encourage researchers to conduct clinical trials to identify the role of intra-articular corticosteroids in treating this condition.
Directory of Open Access Journals (Sweden)
Yüzer Hayrettin
2010-01-01
Full Text Available Abstract A vertically aligned Pd nanowire array was successfully fabricated on an Au/Ti substrate using an anodic aluminum oxide (AAO template by a direct voltage electrodeposition method at room temperature using diluted neutral electrolyte. The fabrication of Pd nanowires was controlled by analyzing the current–time transient during electrodeposition using potentiostat. The AAO template and the Pd nanowires were characterized by scanning electron microscopy (SEM, energy-dispersive X-ray (EDX methods and X-Ray diffraction (XRD. It was observed that the Pd nanowire array was standing freely on an Au-coated Ti substrate after removing the AAO template in a relatively large area of about 5 cm2, approximately 50 nm in diameter and 2.5 μm in length with a high aspect ratio. The nucleation rate and the number of atoms in the critical nucleus were determined from the analysis of current transients. Pd nuclei density was calculated as 3.55 × 108 cm−2. Usage of diluted neutral electrolyte enables slower growing of Pd nanowires owing to increase in the electrodeposition potential and thus obtained Pd nanowires have higher crystallinity with lower dislocations. In fact, this high crystallinity of Pd nanowires provides them positive effect for sensor performances especially.
Enhanced ionic conductivity of AgI nanowires/AAO composites fabricated by a simple approach
International Nuclear Information System (INIS)
Liu Lifeng; Alexe, Marin; Lee, Woo; Goesele, Ulrich; Lee, Seung-Woo; Li Jingbo; Rao Guanghui; Zhou Weiya; Lee, Jae-Jong
2008-01-01
AgI nanowires/anodic aluminum oxide (AgI NWs/AAO) composites have been fabricated by a simple approach, which involves the thermal melting of AgI powders on the surface of the AAO membrane, followed by the infiltration of the molten AgI inside the nanochannels. As-prepared AgI nanowires have corrugated outer surfaces and are polycrystalline according to scanning electron microscopy (SEM) and transmission electron microscopy (TEM) observations. X-ray diffraction (XRD) shows that a considerable amount of 7H polytype AgI exists in the composites, which is supposed to arise from the interfacial interactions between the embedded AgI and the alumina. AC conductivity measurements for the AgI nanowires/AAO composites exhibit a notable conductivity enhancement by three orders of magnitude at room temperature compared with that of pristine bulk AgI. Furthermore, a large conductivity hysteresis and abnormal conductivity transitions were observed in the temperature-dependent conductivity measurements, from which an ionic conductivity as high as 8.0 x 10 2 Ω -1 cm -1 was obtained at around 70 deg. C upon cooling. The differential scanning calorimetry (DSC) result demonstrates a similar phase transition behavior as that found in the AC conductivity measurements. The enhanced ionic conductivity, as well as the abnormal phase transitions, can be explained in terms of the existence of the highly conducting 7H polytype AgI and the formation of well-defined conduction paths in the composites.
Enhanced ionic conductivity of AgI nanowires/AAO composites fabricated by a simple approach.
Liu, Li-Feng; Lee, Seung-Woo; Li, Jing-Bo; Alexe, Marin; Rao, Guang-Hui; Zhou, Wei-Ya; Lee, Jae-Jong; Lee, Woo; Gösele, Ulrich
2008-12-10
AgI nanowires/anodic aluminum oxide (AgI NWs/AAO) composites have been fabricated by a simple approach, which involves the thermal melting of AgI powders on the surface of the AAO membrane, followed by the infiltration of the molten AgI inside the nanochannels. As-prepared AgI nanowires have corrugated outer surfaces and are polycrystalline according to scanning electron microscopy (SEM) and transmission electron microscopy (TEM) observations. X-ray diffraction (XRD) shows that a considerable amount of 7H polytype AgI exists in the composites, which is supposed to arise from the interfacial interactions between the embedded AgI and the alumina. AC conductivity measurements for the AgI nanowires/AAO composites exhibit a notable conductivity enhancement by three orders of magnitude at room temperature compared with that of pristine bulk AgI. Furthermore, a large conductivity hysteresis and abnormal conductivity transitions were observed in the temperature-dependent conductivity measurements, from which an ionic conductivity as high as 8.0 × 10(2) Ω(-1) cm(-1) was obtained at around 70 °C upon cooling. The differential scanning calorimetry (DSC) result demonstrates a similar phase transition behavior as that found in the AC conductivity measurements. The enhanced ionic conductivity, as well as the abnormal phase transitions, can be explained in terms of the existence of the highly conducting 7H polytype AgI and the formation of well-defined conduction paths in the composites.
Effectiveness of the AAOS Leadership Fellows Program for Orthopaedic Surgeons.
Day, Charles S; Tabrizi, Shervin; Kramer, Jeffrey; Yule, Arthur C; Ahn, Brian S
2010-11-17
Effective physician leadership is critical to the future success of healthcare organizations. The American Academy of Orthopaedic Surgeons (AAOS) Leadership Fellows Program is a one-year program designed to train young orthopaedic surgeons to become future leaders in orthopaedics. The purpose of this study was to evaluate the impact of the AAOS Leadership Fellows Program on the leadership skills and achievements of its participants. Graduates of the Leadership Fellows Program were compared with a control group of previous applicants who were not accepted to the program (applicants) in a retrospective cohort comparison study. A subjective survey of leadership skills was used to assess the confidence of the two cohorts in eight areas of leadership. In addition, an updated curriculum vitae from each of sixty leadership fellows from the classes of 2003 through 2009 and from each of forty-seven applicants was retrospectively reviewed for evidence of leadership. The updated curriculum vitae of the leadership fellows was evaluated for leadership activity attained prior to and following participation in the program, while the updated curriculum vitae of applicants was evaluated for leadership activity attained prior to and following the last year of application to the program. Curricula vitae were assessed for demonstration of national leadership, academic rank, hospital administrative rank, and research experience. On the leadership survey, the graduates of the Leadership Fellows Program scored higher than the applicants in seven of eight categories. The review of the curricula vitae demonstrated that, prior to the Leadership Fellows Program, the leadership fellows were more likely than the applicants to have an academic practice and hold an academic rank. The difference between the two cohorts in administrative rank and leadership of national committees was not significant. Following the program, the leadership fellows were more likely to chair national committees (p
DC electrodeposition of NiGa alloy nanowires in AAO template
Energy Technology Data Exchange (ETDEWEB)
Maleki, K. [Nanomaterials Group, Department of Materials Engineering, Tarbiat Modares University, Iran, P.O. Box: 14115-143, Tehran (Iran, Islamic Republic of); Sanjabi, S., E-mail: sanjabi@modares.ac.ir [Nanomaterials Group, Department of Materials Engineering, Tarbiat Modares University, Iran, P.O. Box: 14115-143, Tehran (Iran, Islamic Republic of); Alemipour, Z. [Department of Physics, University of Kurdistan, Sanandaj (Iran, Islamic Republic of)
2015-12-01
NiGa alloy nanowires were electrodeposited from an acidic sulfate bath into nanoporous anodized alumina oxide (AAO). This template was fabricated by two-step anodizing. The effects of bath composition and current density were explored on the Ga content of electrodeposited nanowires. The Ga content in the deposits was increased by increasing both Ga in the bath composition and electrodepositing current density. The NiGa alloy nanowires were synthesized for Ga content up to 2–4% without significant improving the magnetic properties. Above this threshold Ga clusters were formed and decreased the magnetic properties of the nanowires. For Ga content of the alloy above 30%, the wires were too short and incomplete. X-ray diffraction patterns reveal that the significant increase of Ga content in the nanowires, changes the FCC crystal structure of Ni to an amorphous phase. It also causes a sizeable increase in the Ga cluster size; these both lead to a significant reduction in the coercivity and the magnetization respectively. - Highlights: • NiGa alloy nanowires were electrodeposited from acidic sulphate baths into nanoporous anodized alumina oxide (AAO) template. • The Ga content was increased by increasing the Ga in the bath composition and electrodeposition current density. • The magnetic parameters such as coercivity and magnetization were not changed for the alloy nanowire with Ga content less than 4%.
Du, Xiaoqing; Yang, Yumeng; Yi, Chenxi; Chen, Yu; Cai, Chao; Zhang, Zhao
2017-02-01
The coaxial arrays of AAO-CeO2 NTs have been successfully galvanostatically deposited on an anode, characterized and adopted as a catalyst for removing organic sulfurs from diesel. The influence of the main electrochemical oxidation factors on the efficiency of desulfurization have also been investigated. The results show that the fabrication process of AAO-CeO2 NTs is accompanied by the formation of a new phase, namely Al3Ce, and the main oxidation products of the diesel are soluble inorganic sulphides, especially Ce2(SO4)3. When compared with dibenzothiophene and 4, 6-dimethyldibenzothiophene, benzothiophene is much more easily removed, with a removal efficiency that reaches 87.2%. Finally, a possible electrochemical oxidation desulfurization pathway for diesel is proposed.
Goebel, Joel A
2016-03-01
Ménière's disease is a disorder of the inner ear that causes attacks of vertigo and hearing loss, tinnitus, aural fullness in the involved ear. Over the past 4 decades, the Equilibrium Committee of the AAO-HNS has issued guidelines for diagnostic criteria, with the latest version being published in 1995. These criteria were reviewed in 2015 by the Equilibrium Committee, and revisions were approved at the recent meeting of the committee at the 2015 AAO-HNSF Annual Meeting. The following commentary outlines the amended and approved criteria. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2016.
Energy Technology Data Exchange (ETDEWEB)
Awad, Ahmed M. [Chemical Engineering & Pilot Plant Department, National Research Centre, Dokki, Giza (Egypt); Shehata, Omnia S. [Physical Chemistry Department, National Research Centre, Dokki, Giza (Egypt); Heakal, Fakiha El-Taib, E-mail: fakihaheakal@yahoo.com [Chemistry Department, Faculty of Science, Cairo University, Giza 12613 (Egypt)
2015-12-30
Highlights: • Three de-anodization methods were used during two-step fabrication of nanoporous AAO. • Electrolytic etching (EE), chemical etching with H{sub 3}PO{sub 4} (PE) or NaOH (HE) were adopted. • After the second anodizing step, HE film was the thinnest as compared to EE and HE. • Stability order of nanoporous AAO films in 0.5 M HCl solution was: PE > EE > HE. • For the colored films by electrodeposited Cu atoms, the order was: HE > EE > PE. - Abstract: Anodic aluminum oxide (AAO) is well known as an important nanostructured material, and a useful template in the fabrication of nanostructures. Nanoporous anodic alumina (PAA) with high open porosity was prepared by adopting three de-anodizing regimes following the first anodizing step and preceding the second one. The de-anodizing methods include electrolytic etching (EE) and chemical etching using either phosphoric acid (PE) or sodium hydroxide (HE) solutions. Three of the obtained AAO samples were black colored by electrodeposition of copper nanoparticles in their pores. Electrochemical impedance spectroscopy (EIS) and potentiodynamic polarization techniques were used to characterize the electrochemical performance of the two sets of the prepared samples. In general, the data obtained in aggressive aerated 0.5 M HCl solution demonstrated dissimilar behavior for the three prepared samples despite that the second anodizing step was the same for all of them. The data indicated that the resistance and thickness of the inner barrier part of nano-PAA film, are the main controlling factors determining its stability. On the other hand, coloring the film decreased its stability due to the galvanic effect. The difference in the electrochemical behavior of the three colored samples was discussed based on the difference in both the pore size and thickness of the outer porous part of PAA film as supported by SEM, TEM and cross-sectional micrographs. These results can thus contribute for better engineering
Crystal orientation of PEO confined within the nanorod templated by AAO nanochannels.
Liu, Chien-Liang; Chen, Hsin-Lung
2018-06-18
The orientation of poly(ethylene oxide) (PEO) crystallites developed in the nanochannels of anodic aluminum oxide (AAO) membrane has been investigated. PEO was filled homogeneously into the nanochannels in the melt state, and the crystallization confined within the PEO nanorod thus formed was allowed to take place subsequently at different temperatures. The effects of PEO molecular weight (MPEO), crystallization temperature (Tc) and AAO channel diameter (DAAO) on the crystal orientation attained in the nanorod were revealed by 2-D wide angle X-ray scattering (WAXS) patterns. In the nanochannels with DAAO = 23 nm, the crystallites formed from PEO with the lowest MPEO (= 3400 g mol-1) were found to adopt a predominantly perpendicular orientation with the crystalline stems aligning normal to the channel axis irrespective of Tc (ranging from -40 to 20 °C). Increasing MPEO or decreasing Tc tended to induce the development of the tilt orientation characterized by the tilt of the (120) plane by 45° from the channel axis. In the case of the highest MPEO (= 95 000 g mol-1) studied, both perpendicular and tilt orientations coexisted irrespective of Tc. Coexistent orientation was always observed in the channels with a larger diameter (DAAO = 89 nm) irrespective of MPEO and Tc. Compared with the previous results of the crystal orientation attained in nanotubes templated by the preferential wetting of the channel walls by PEO, the window of the perpendicular crystal orientation in the nanorod was much narrower due to its weaker confinement effect imposed on the crystal growth than that set by the nanotube.
ToxRefDB - Release user-friendly web-based tool for mining ToxRefDB
The updated URL link is for a table of NCCT ToxCast public datasets. The next to last row of the table has the link for the US EPA ToxCast ToxRefDB Data Release October 2014. ToxRefDB provides detailed chemical toxicity data in a publically accessible searchable format. ToxRefD...
International Nuclear Information System (INIS)
Shen, Lan; Ali, Mubarak; Gu, Zhengbin; Min, Bonggi; Kim, Dongwook; Park, Chinho
2013-01-01
Anodized aluminum oxide (AAO) nanotemplates were prepared using the Al/Si substrates with an aluminum layer thickness of about 300 nm. A two-step anodization process was used to prepare an ordered porous alumina nanotemplate, and the pores of various sizes and depths were constructed electrochemically through anodic oxidation. The optimum morphological structure for large area application was constructed by adjusting the applied potential, temperature, time, and electrolyte concentration. SEM investigations showed that hexagonal-close-packed alumina nano-pore arrays were nicely constructed on Si substrate, having smooth wall morphologies and well-defined diameters. It is also reported that one dimensional copper nanopillars can be fabricated using the tunable nanopore sized AAO/Si template, by controlling the copper deposition process
Directory of Open Access Journals (Sweden)
Maikon Passos A. Alves
2017-03-01
Full Text Available This paper examines the relationship between the Antarctic Oscillation (AAO, cold waves and occurrence of frosts in the state of Santa Catarina, Brazil, during the winter quarter. Research on this topic can assist different spheres of society, such as public health and agriculture, since cold waves can influence and/or aggravate health problems and frosts can inflict economic losses especially in the agricultural sector. For the purpose of this paper, cold wave is considered as the event in which the daily average surface air temperature was at least two standard deviations below the average value of the series on the day and for two consecutive days or more. The data on the average air temperature and frost occurrences are provided by the Company of Agricultural Research and Rural Extension of Santa Catarina/Center for Environmental Information and Hydrometeorology (EPAGRI/CIRAM. The AAO was subjected to statistical analysis using significance tests for the averages (Student’s t-test and variances (F-test with a significance level of α = 5%. The results show that cold waves are unevenly distributed in the agroecological zones of Santa Catarina. It is found that the AAO is associated with the occurrence of frosts (in the agroecological zones represented by the municipalities of Itajaí and São José in the state of Santa Catarina.
Fabrication of nanostructure via self-assembly of nanowires within the AAO template
Directory of Open Access Journals (Sweden)
Brust Mathias
2006-01-01
Full Text Available AbstractThe novel nanostructures are fabricated by the spatial chemical modification of nanowires within the anodic aluminum oxide (AAO template. To make the nanowires better dispersion in the aqueous solution, the copper is first deposited to fill the dendrite structure at the bottom of template. During the process of self-assembly, the dithiol compound was used as the connector between the nanowires and nanoparticles by a self-assembly method. The nanostructures of the nano cigars and structure which is containing particles junction are characterized by transmission electron microscopy (TEM. These kinds of novel nanostructure will be the building blocks for nanoelectronic and nanophotonic devices.
Magnetic properties of nickel nanostructures grown in AAO membrane
International Nuclear Information System (INIS)
Oh, S.-L.; Kim, Y.-R.; Malkinski, L.; Vovk, A.; Whittenburg, S.L.; Kim, E.-M.; Jung, J.-S.
2007-01-01
One-dimensional nanostructures can be built by performing chemical or electrochemical reactions in the pores of a suitable host or matrix material. We have developed a method of electrodeposition of nickel nanostructures inside cylindrical pores of the anodic aluminum oxide (AAO) membranes, which provides precise control of the nanostructure height. We were able to fabricate hexagonal arrays of particles in the form of spheres, rods and long wires. Magnetization measurements of these nanostructures as function of field and temperature were carried out using a superconducting quantum-interference device magnetometer. The shape of nickel nanostructures has been investigated by field emission scanning electron microscope. The coercivity of the nickel nanostructures measured with the field perpendicular to the membrane was increasing with increasing aspect ratio of the nanostructures. These experimental values of the coercivity, varying from 200 Oe for the spherical nanodots to 730 Oe for the nanowires, are in a fair agreement with our micromagnetic modeling calculations
Magnetic properties of nickel nanostructures grown in AAO membrane
Energy Technology Data Exchange (ETDEWEB)
Oh, S -L [Department of Chemistry, Yonsei University, Seoul (Korea, Republic of); Kim, Y -R [Department of Chemistry, Yonsei University, Seoul (Korea, Republic of); Malkinski, L [Advanced Material Research Institute, University of New Orleans, New Orleans, LA 70148 (United States); Vovk, A [Advanced Material Research Institute, University of New Orleans, New Orleans, LA 70148 (United States); Whittenburg, S L [Advanced Material Research Institute, University of New Orleans, New Orleans, LA 70148 (United States); Kim, E -M [Korea Basic Science Institute, Kangnung 210-702 (Korea, Republic of); Jung, J -S [Department of Chemistry, Kangnung National University, Kangnung 210-702 (Korea, Republic of)
2007-03-15
One-dimensional nanostructures can be built by performing chemical or electrochemical reactions in the pores of a suitable host or matrix material. We have developed a method of electrodeposition of nickel nanostructures inside cylindrical pores of the anodic aluminum oxide (AAO) membranes, which provides precise control of the nanostructure height. We were able to fabricate hexagonal arrays of particles in the form of spheres, rods and long wires. Magnetization measurements of these nanostructures as function of field and temperature were carried out using a superconducting quantum-interference device magnetometer. The shape of nickel nanostructures has been investigated by field emission scanning electron microscope. The coercivity of the nickel nanostructures measured with the field perpendicular to the membrane was increasing with increasing aspect ratio of the nanostructures. These experimental values of the coercivity, varying from 200 Oe for the spherical nanodots to 730 Oe for the nanowires, are in a fair agreement with our micromagnetic modeling calculations.
Belwalkar, A.; Grasing, E.; Van Geertruyden, W.; Huang, Z.; Misiolek, W.Z.
2008-01-01
Nanoporous anodic aluminum oxide (AAO) tubular membranes were fabricated from aluminum alloy tubes in sulfuric and oxalic acid electrolytes using a two-step anodization process. The membranes were investigated for characteristics such as pore size, interpore distance and thickness by varying applied voltage and electrolyte concentration. Morphology of the membranes was examined using light optical and scanning electron microscopy and characterized using ImageJ software. Results showed that me...
International Nuclear Information System (INIS)
Zhang, Bin; Zheng, Maojun; Xiong, Zuzhou; Zhu, Changqing; Li, Hong; Wang, Faze; Shen, Wenzhong; Zhou, Tao; Ma, Li
2014-01-01
Quaternary nanostructured Cu(In 1 − x Ga x )Se 2 (CIGS) arrays were successfully fabricated via a novel and simple solution-based protocol on the electroless deposition method, using a flexible, highly ordered anodic aluminium oxide (AAO) substrate. This method does not require electric power, complicated sensitization processes, or complexing agents, but provides nearly 100% pore fill factor to AAO templates. The field emission scanning electron microscopy (FE-SEM) images show that we obtained uniformly three-dimensional nanostructured CIGS arrays, and we can tailor the diameter and wall thicknesses of the nanostructure by adjusting the pore diameter of the AAO and metal Mo layer. Their chemical composition was determined by energy-dispersive spectroscopy analysis, which is very close to the stoichiometric value. The Raman spectroscopy, x-ray diffraction (XRD) pattern, and transmission electron microscopy (TEM) further confirm the formation of nanostructured CIGS with prominent chalcopyrite structure. The nanostructured CIGS arrays can support the design of low-cost, highlight-trapping, and enhanced carrier collection nanostructured solar cells. (paper)
Awad, Ahmed M.; Shehata, Omnia S.; Heakal, Fakiha El-Taib
2015-12-01
Anodic aluminum oxide (AAO) is well known as an important nanostructured material, and a useful template in the fabrication of nanostructures. Nanoporous anodic alumina (PAA) with high open porosity was prepared by adopting three de-anodizing regimes following the first anodizing step and preceding the second one. The de-anodizing methods include electrolytic etching (EE) and chemical etching using either phosphoric acid (PE) or sodium hydroxide (HE) solutions. Three of the obtained AAO samples were black colored by electrodeposition of copper nanoparticles in their pores. Electrochemical impedance spectroscopy (EIS) and potentiodynamic polarization techniques were used to characterize the electrochemical performance of the two sets of the prepared samples. In general, the data obtained in aggressive aerated 0.5 M HCl solution demonstrated dissimilar behavior for the three prepared samples despite that the second anodizing step was the same for all of them. The data indicated that the resistance and thickness of the inner barrier part of nano-PAA film, are the main controlling factors determining its stability. On the other hand, coloring the film decreased its stability due to the galvanic effect. The difference in the electrochemical behavior of the three colored samples was discussed based on the difference in both the pore size and thickness of the outer porous part of PAA film as supported by SEM, TEM and cross-sectional micrographs. These results can thus contribute for better engineering applications of nanoporous AAO.
2009-06-01
Bianchi. MISC MISC MISC 1498 Sergeant McCain: Yeah, this is Sergeant Gaber from the 178th Op. I’d like to go secure. TIE TIE TIE 1499 Male Speaker...Sergeant Bianchi: Okay. MISC MISC MISC 1502 Sergeant Gaber : Northeast Air Defense Sector, this is Sergeant McCain, MISC MISC MISC may...Terrorist Team. TKS TKS TKS We need to get a BPR so the plane can land in Boston. TSOG TSOG TSOG 1504 Sergeant Gaber : Counter terrorist team
Optical characterization of nanoporous AAO sensor substrate
Kassu, Aschalew; Farley, Carlton W.; Sharma, Anup
2014-05-01
Nanoporous anodic aluminum oxide (AAO) has been investigated as an ideal and cost-effective chemical and biosensing platform. In this paper, we report the optical properties of periodic 100 micron thick nanoporous anodic alumina membranes with uniform and high density cylindrical pores penetrating the entire thickness of the substrate, ranging in size from 18 nm to 150 nm in diameter and pore periods from 44 nm to 243 nm. The surface geometry of the top and bottom surface of each membrane is studied using atomic force microscopy. The optical properties including transmittance, reflectance, and absorbance spectra on both sides of each substrate are studied and found to be symmetrical. It is observed that, as the pore size increases, the peak resonance intensity in transmittance decreases and in absorbance increases. The effects of the pore sizes on the optical properties of the bare nanoporous membranes and the benefit of using arrays of nanohole arrays with varying hole size and periodicity as a chemical sensing platform is also discussed. To characterize the optical sensing technique, transmittance and reflectance measurements of various concentrations of a standard chemical adsorbed on the bare nanoporous substrates are investigated. The preliminary results presented here show variation in transmittance and reflectance spectra with the concentration of the chemical used or the amount of the material adsorbed on the surface of the substrate.
Do AAO-HNSF CORE Grants Predict Future NIH Funding Success?
Eloy, Jean Anderson; Svider, Peter F; Kanumuri, Vivek V; Folbe, Adam J; Setzen, Michael; Baredes, Soly
2014-08-01
To determine (1) whether academic otolaryngologists who have received an American Academy of Otolaryngology- Head and Neck Surgery Foundation (AAO-HNSF) Centralized Otolaryngology Research Efforts (CORE) grant are more likely to procure future National Institutes of Health (NIH) funding; (2) whether CORE grants or NIH Career Development (K) awards have a stronger association with scholarly impact. Historical cohort. Scholarly impact, as measured by the h-index, publication experience, and prior grant history, were determined for CORE-funded and non-CORE-funded academic otolaryngologists. All individuals were assessed for NIH funding history. Of 192 academic otolaryngologists with a CORE funding history, 39.6% had active or prior NIH awards versus 15.1% of 1002 non-CORE-funded faculty (P productivity than those with CORE funding history. Both cohorts had higher scholarly impact values than previously published figures among academic otolaryngologists, highlighting that both CORE grants and NIH K-grants awards are effective career development resources. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2014.
CrossRef text and data mining services
Directory of Open Access Journals (Sweden)
Rachael Lammey
2015-02-01
Full Text Available CrossRef is an association of scholarly publishers that develops shared infrastructure to support more effective scholarly communications. It is a registration agency for the digital object identifier (DOI, and has built additional services for CrossRef members around the DOI and the bibliographic metadata that publishers deposit in order to register DOIs for their publications. Among these services are CrossCheck, powered by iThenticate, which helps publishers screen for plagiarism in submitted manuscripts and FundRef, which gives publishers standard way to report funding sources for published scholarly research. To add to these services, Cross-Ref launched CrossRef text and data mining services in May 2014. This article will explain the thinking behind CrossRef launching this new service, what it offers to publishers and researchers alike, how publishers can participate in it, and the uptake of the service so far.
Energy Technology Data Exchange (ETDEWEB)
Zak, D. B.; Church, H.; Ivey, M.; Yellowhorse, L.; Zirzow, J.; Widener, K. B.; Rhodes, P.; Turney, C.; Koontz, A.; Stamnes, K.; Storvold, R.; Eide, H. A.; Utley, P.; Eagan, R.; Cook, D.; Hart, D.; Wesely, M.
2000-04-04
Since the 1997 Atmospheric Radiation Measurement (ARM) Science Team Meeting, the North Slope of Alaska and Adjacent Arctic Ocean (NSA/AAO) Cloud and Radiation Testbed (CART) site has come into being. Much has happened even since the 1998 Science Team Meeting at which this paper was presented. To maximize its usefulness, this paper has been updated to include developments through July 1998.
International Nuclear Information System (INIS)
Esfandi, F.; Saramad, S.; Shahmirzadi, M. Rezaei
2017-01-01
In this work, a new method is proposed for extracting some X-ray detection properties of ZnO nanowires electrodeposited on Anodized Aluminum Oxide (AAO) nanoporous template. The results show that the detection efficiency for 12μm thickness of zinc oxide nano scintillator at an energy of 9.8 keV, near the K-edge of ZnO (9.65 keV), is 24%. The X-rays that interact with AAO can also generate electrons that reach the nano scintillator. The scintillation events of these electrons are seen as a low energy tail in the spectrum. In addition, it is found that all the X-rays that are absorbed in 300 nm thickness of the gold layer on the top of the zinc oxide nanowires can participate in the scintillation process with an efficiency of 6%. Hence, the scintillation detection efficiency of the whole detector for 9.8 keV X-ray energy is 30%. The simulation results from Geant4 and the experimental detected photons per MeV energy deposition are also used to extract the light yield of the zinc oxide nano scintillator. The results show that the light yield of the zinc oxide nanowires deposited by the electrochemical method is approximately the same as for single crystal zinc oxide scintillator (9000). Much better spatial resolution of this nano scintillator in comparison to the bulk ones is an advantage which candidates this nano scintillator for medical imaging applications.
Rank hypocrisies the insult of the REF
Sayer, Derek
2015-01-01
"The REF is right out of Havel's and Kundera's Eastern Europe: a state-administered exercise to rank academic research like hotel chains dependent on the active collaboration of the UK professoriate. In crystalline text steeped in cold rage, Sayer takes aim at the REF's central claim, that it is a legitimate process of expert peer review. He critiques university and national-level REF processes against actual practices of scholarly review as found in academic journals, university presses, and North American tenure procedures. His analysis is damning. If the REF fails as scholarly review, how can academics and universities continue to participate? And how can government use its rankings as a basis for public policy?" - Tarak Barkawi, Reader in the Department of International Relations, London School of Economics "Many academics across the world have come to see the REF as an arrogant attempt to raise national research standards that has resulted in a variety of self-inflicted wounds to UK higher education. Der...
The basics of CrossRef extensible markup language
Directory of Open Access Journals (Sweden)
Rachael Lammey
2014-08-01
Full Text Available CrossRef is an association of scholarly publishers that develops shared infrastructure to support more effective scholarly communications. Launched in 2000, CrossRef’s citation-linking network today covers over 68 million journal articles and other content items (books chapters, data, theses, and technical reports from thousands of scholarly and professional publishers around the globe. CrossRef has over 4,000 member publishers who join as members in order to avail of a number of CrossRef services, reference linking via the Digital Object Identifier (DOI being the core service. To deposit CrossRef DOIs, publishers and editors need to become familiar with the basics of extensible markup language (XML. This article will give an introduction to CrossRef XML and what publishers need to do in order to start to deposit DOIs with CrossRef and thus ensure their publications are discoverable and can be linked to consistently in an online environment.
Park, Ji-Hwan; Oh, Seung-Ju; Lee, Hyo-Chang; Kim, Yu-Sin; Kim, Young-Cheol; Kim, June Young; Ha, Chang-Seoung; Kwon, Soon-Ho; Lee, Jung-Joong; Chung, Chin-Wook
2014-10-01
As the critical dimension of the nano-device shrinks, an undesired etch profile occurs during plasma etch process. One of the reasons is the local electric field due to the surface charge accumulation. To demonstrate the surface charge accumulation, an anodic aluminum oxide (AAO) membrane which has high aspect ratio is used. The potential difference between top electrode and bottom electrode in an anodic aluminum oxide contact structure is measured during inductively coupled plasma exposure. The voltage difference is changed with external discharge conditions, such as gas pressure, input power, and gas species and the result is analyzed with the measured plasma parameters.
HeREF-2003: Helium Refrigeration Techniques
2003-01-01
CERN Technical Training 2003: Learning for the LHC ! Theory, Technology, Maintenance and Control of Helium Refrigerators HeREF-2003 is a course in the framework of the 2002 Technical Training Programme, that will provide a complete introduction to Helium refrigeration, with a practical approach to theory, technology, maintenance and control of Helium refrigeration installations. Theoretical aspects and equations will be limited to a minimum. HeREF-2003 targets an audience of technicians and operators of Helium refrigeration plants at CERN, as well as physicists and engineers needing an overview of current Helium refrigeration techniques. HeREF-2003 will address, among other, issues related to component technology, installation maintenance, process control and Helium purity. A commented visit to a couple of CERN Helium refrigeration or liquefaction plants will also take place. Duration: 7 half days (4 mornings and 3 afternoons), 6-10 October, 2003 Cost per participant: 500.- CHF Language: Bilingual English...
HeREF-2003 : Helium Refrigeration Techniques
2003-01-01
CERN Technical Training 2003: Learning for the LHC ! Theory, Technology, Maintenance and Control of Helium Refrigerators HeREF-2003 is a course in the framework of the 2002 Technical Training Programme, that will provide a complete introduction to Helium refrigeration, with a practical approach to theory, technology, maintenance and control of Helium refrigeration installations. Theoretical aspects and equations will be limited to a minimum. HeREF-2003 targets an audience of technicians and operators of Helium refrigeration plants at CERN, as well as physicists and engineers needing an overview of current Helium refrigeration techniques. HeREF-2003 will address, among other, issues related to component technology, installation maintenance, process control and Helium purity. A commented visit to a couple of CERN Helium refrigeration or liquefaction plants will also take place. Duration: 7 half days (4 mornings and 3 afternoons), 6-10 October, 2003 Cost per participant: 500.- CHF ...
Directory of Open Access Journals (Sweden)
Simon Kerridge
2014-03-01
Full Text Available Open access (OA may have been the ‘big thing’ in 2013 but the OA juggernaut is still rolling and plans are now afoot for the requirements for the ‘next REF’ (which from now on we will refer to as REF2020. In 2013, on behalf of the four UK Funding Councils, the Higher Education Funding Council for England (HEFCE undertook a two-stage consultation exercise on open access requirements for articles submitted to REF2020. There are a number of nuances and caveats to the current proposals. This article will reflect on what the probable rules might be, and their implications for research managers, administrators and institutional repository managers alike.
Boivin, Michael J; Bangirana, Paul; Nakasujja, Noeline; Page, Connie F; Shohet, Cilly; Givon, Deborah; Bass, Judith K; Opoka, Robert O; Klein, Pnina S
2013-11-01
To evaluate mediational intervention for sensitizing caregivers (MISC). MISC biweekly caregiver training significantly enhanced child development compared with biweekly training on health and nutrition (active control) and to evaluate whether MISC training improved the emotional well-being of the caregivers compared with controls. Sixty of 120 rural Ugandan preschool child/caregiver dyads with HIV were assigned by randomized clusters to biweekly MISC training, alternating between home and clinic for 1 year. Control dyads received a health and nutrition curriculum. Children were evaluated at baseline, 6 months, and 1 year with the Mullen Early Learning Scales and the Color-Object Association Test for memory. Caldwell Home Observation for Measurement of the Environment and videotaped child/caregiver MISC interactions also were evaluated. Caregivers were evaluated for depression and anxiety with the Hopkins Symptoms Checklist. Between-group repeated-measures ANCOVA comparisons were made with age, sex, CD4 levels, viral load, material socioeconomic status, physical development, and highly active anti-retroviral therapy treatment status as covariates. The children given MISC had significantly greater gains compared with controls on the Mullen Visual Reception scale (visual-spatial memory) and on Color-Object Association Test memory. MISC caregivers significantly improved on Caldwell Home Observation for Measurement of the Environment scale and total frequency of MISC videotaped interactions. MISC caregivers also were less depressed. Mortality was less for children given MISC compared with controls during the training year. MISC was effective in teaching Ugandan caregivers to enhance their children's cognitive development through practical and sustainable techniques applied during daily interactions in the home. Copyright © 2013 Mosby, Inc. All rights reserved.
Maristem—Stem Cells of Marine/Aquatic Invertebrates: From Basic Research to Innovative Applications
Directory of Open Access Journals (Sweden)
Loriano Ballarin
2018-02-01
Full Text Available The “stem cells” discipline represents one of the most dynamic areas in biomedicine. While adult marine/aquatic invertebrate stem cell (MISC biology is of prime research and medical interest, studies on stem cells from organisms outside the classical vertebrate (e.g., human, mouse, and zebrafish and invertebrate (e.g., Drosophila, Caenorhabditis models have not been pursued vigorously. Marine/aquatic invertebrates constitute the largest biodiversity and the widest phylogenetic radiation on Earth, from morphologically simple organisms (e.g., sponges, cnidarians, to the more complex mollusks, crustaceans, echinoderms, and protochordates. These organisms contain a kaleidoscope of MISC-types that allow the production of a large number of novel bioactive-molecules, many of which are of significant potential interest for human health. MISCs further participate in aging and regeneration phenomena, including whole-body regeneration. For years, the European MISC-community has been highly fragmented and has established scarce ties with biomedical industries in an attempt to harness MISCs for human welfare. Thus, it is important to (i consolidate the European community of researchers working on MISCs; (ii promote and coordinate European research on MISC biology; (iii stimulate young researchers to embark on research in MISC-biology; (iv develop, validate, and share novel MISC tools and methodologies; (v establish the MISC discipline as a forefront interest of biomedical disciplines, including nanobiomedicine; and (vi establish collaborations with industries to exploit MISCs as sources of bioactive molecules. In order to fill the recognized gaps, the EC-COST Action 16203 “MARISTEM” has recently been launched. At its initial stage, the consortium unites 26 scientists from EC countries, Cooperating countries, and Near Neighbor Countries.
Ibrahim, Talal; Hegazy, Abdelsalam; Abulhail, Safa I S; Ghomrawi, Hassan M K
2017-01-01
The American Academy of Orthopaedic Surgeons (AAOS) recently developed an Appropriate Use Criteria (AUC) for pediatric supracondylar humerus fractures (PSHF). The AUC is intended to improve quality of care by informing surgeon decision making. The aim of our study was to cross-reference the management of operatively treated PSHF with the AAOS-published AUC. The AUC for PSHF include 220 patient scenarios, based on different combinations of 6 factors. For each patient scenario, 8 treatment options are evaluated as "appropriate," "maybe appropriate," and "rarely appropriate." We retrospectively reviewed the medical charts and radiographs of all operatively treated PSHF at our hospital from January 2013 to December 2014 and determined the appropriateness of the treatment. Over the study period, 94 children (mean age: 5.2 y; 51 male, 43 female) were admitted with PSHF and underwent a surgical procedure (type IIA: 7, type IIB: 14, type III: 70, flexion type: 3). Only 8 of the 220 scenarios were observed in our patient cohort. The most frequent scenario was represented by a type III fracture, palpable distal pulse, no nerve injury, closed soft-tissue envelope, no radius/ulna fracture, and typical swelling. Of the 94 fractures, the AUC was "appropriate" for 84 cases and "maybe appropriate" for 9 cases. There was only 1 case of "rarely appropriate" management. Closed reduction with lateral pinning and immobilization was the most prevalent treatment option (58.5%). The rate of appropriateness was not affected by the operating surgeon. However, the definition of a case as emergent had a significant impact on the rate of appropriateness. Application of the AUC to actual clinical data was relatively simple. The majority of operatively treated PSHF (89.4%) were managed appropriately. With the introduction of electronic medical charts, an AUC application becomes attractive and easy for orthopaedic surgeons to utilize in clinical practice. However, validity studies of the AUC in
González-Sánchez, Manuel; Velasco-Ramos, Esther; Ruiz-Muñoz, Maria; Cuesta-Vargas, Antonio I
2016-07-06
The current study performed a cross-cultural adaptation to Spanish and examined the internal and external validation of the AAOS-FAM questionnaire. A direct translation (English to Spanish) and a reverse translation (Spanish to English) were performed by two independent professional native translators. Cronbach's α coefficients were calculated to analyse the internal consistency of the measure. The factor structure and construct validity were analysed after extraction by maximum likelihood (EML); extraction was necessary if the following three requirements were met: accounting for ≥10 % of variance, Eigenvalue >1.0 and a scree plot inflexion point. The standard error of measurement and minimal detectable change 90 (MDC90) were calculated. Criterion validity was calculated by analysing the correlation between the American Academy of Orthopaedic Surgeons-Foot and Ankle Module (Spanish version) (AAOS-FAMsp) and Spanish versions of the questionnaires FFI and FHSQ. Regarding internal consistency, Cronbach's α was 0.877, and in the test-retest analysis, the ICC ranged between 0.899 and 0.942. Error measures were calculated by MDC90 and SEM, which showed values of 3.444 and 1.476 %, respectively. The analysis demonstrated a goodness of fit chi-squared value of 803.166 (p validity, the correlation value with FFIsp was r = 0.837 (p Spanish-speaking individuals into both research and clinical practice.
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc
Assessing Impact Submissions for REF 2014: An Evaluation
Manville, Catriona; Guthrie, Susan; Henham, Marie-Louise; Garrod, Bryn; Sousa, Sonia; Kirtley, Anne; Castle-Clarke, Sophie; Ling, Tom
2015-01-01
The Research Excellence Framework (REF) is a new system for assessing the quality of research in UK higher education institutions (HEIs). For the first time, part of the assessment included the wider impact of research. RAND Europe was commissioned to evaluate the assessment process of the impact element of REF submissions, and to explore the…
International Nuclear Information System (INIS)
Karyakin, A.M.
1988-01-01
Up-to-date state of the problem of acute arterial obstruction (AAO) is considered and clinical observations of patients with acute emboli and thrombosis of abdominal aorta and main arteries of lower extremitics are analyzed. Complex of detoxication therapy and measures on controlling AAO in patients during postoperation period is presented. Complex application of hemosorption, ultraviolet irradiation of autoblood and hyperbaric oxygenation enabled to achieve correction of some indices. Reliable evidences of high therapeutic efficiency of combined application of mentioned methods to patients with reconstructed blood flow are presented. 38 refs.; 3 tabs
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis
ORF Alignment: NC_004668 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...
NCBI nr-aa BLAST: CBRC-CPOR-01-0881 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CPOR-01-0881 ref|NP_862834.2| envelope protein [Enzootic nasal tumour virus of goat...s] gb|AAO85307.2| envelope protein [Enzootic nasal tumour virus of goats] NP_862834.2 2e-44 28% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0161 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0161 ref|NP_862834.2| envelope protein [Enzootic nasal tumour virus of goat...s] gb|AAO85307.2| envelope protein [Enzootic nasal tumour virus of goats] NP_862834.2 6e-21 27% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1094 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1094 ref|NP_862834.2| envelope protein [Enzootic nasal tumour virus of goat...s] gb|AAO85307.2| envelope protein [Enzootic nasal tumour virus of goats] NP_862834.2 6e-11 48% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0917 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0917 ref|NP_862834.2| envelope protein [Enzootic nasal tumour virus of goat...s] gb|AAO85307.2| envelope protein [Enzootic nasal tumour virus of goats] NP_862834.2 5e-64 29% ...
ORF Alignment: NC_004578 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa
ORF Alignment: NC_004557 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248
NCBI nr-aa BLAST: CBRC-DYAK-01-0052 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-01-0052 ref|NP_788008.1| CG32988-PA [Drosophila melanogaster] gb|AAO41173....1| CG32988-PA [Drosophila melanogaster] gb|AAX33504.1| LP15408p [Drosophila melanogaster] NP_788008.1 1e-11 20% ...
NCBI nr-aa BLAST: CBRC-DMEL-04-0011 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0011 ref|NP_649764.1| CG7918-PA [Drosophila melanogaster] gb|AAF54188....2| CG7918-PA [Drosophila melanogaster] gb|AAO39464.1| RH14214p [Drosophila melanogaster] NP_649764.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1133 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-VPAC-01-1133 ref|NP_862833.2| gag-pro-pol fusion [Enzootic nasal tumour virus of goat...s] gb|AAO85306.2| gag-pro-pol fusion [Enzootic nasal tumour virus of goats] NP_862833.2 0.0 61% ...
NCBI nr-aa BLAST: CBRC-CPOR-01-1958 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CPOR-01-1958 ref|NP_764829.1| ComEC late competence protein 3 [Staphylococcus ...epidermidis ATCC 12228] gb|AAO04873.1|AE016748_107 ComEC late competence protein 3 [Staphylococcus epidermidis ATCC 12228] NP_764829.1 3e-04 23% ...
NCBI nr-aa BLAST: CBRC-DRER-19-0035 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-19-0035 ref|NP_775386.1| melanocortin 5a receptor [Danio rerio] gb|AAL85495.1| mela...nocortin 5a receptor [Danio rerio] gb|AAO24747.1| melanocortin 5b receptor [Danio rerio] NP_775386.1 1e-180 100% ...
International Nuclear Information System (INIS)
Tu, J.P.; Jiang, C.X.; Guo, S.Y.; Fu, M.F.
2005-01-01
The amorphous carbon films with different degrees of graphitization were synthesized by the pyrolysis of polyethleneglycol 400 infiltrated in the nano-sized pores of anodic aluminum oxide (AAO) membrane. The morphology and microstructure of the carbon films were characterized by scanning electron microscopy, X-ray diffraction and Raman spectroscopy. The micro-friction behavior of the amorphous carbon films sliding against GCr15 steel in ambient air was investigated using a ball-on-disk tester at an applied load of 980 mN and a sliding velocity of 0.2 m s -1 . The graphitization degree in the carbon films had effect on the micro-friction properties. In comparison, the amorphous carbon film with high graphitization degree showed low friction coefficient and high wear resistance. An efficient approach was brought for enhancing the friction performance of aluminum
Energy Technology Data Exchange (ETDEWEB)
Tu, J P [Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Jiang, C X [Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Department of Mechanical and Electronic Engineering, Nanchang University, Nanchang 330029 (China); Guo, S Y [Department of Mechanical Engineering, Zhejiang Sci-Tech University, Hangzhou 310033 (China); Fu, M F [Department of Mechanical and Electronic Engineering, Nanchang University, Nanchang 330029 (China)
2005-05-25
The amorphous carbon films with different degrees of graphitization were synthesized by the pyrolysis of polyethleneglycol 400 infiltrated in the nano-sized pores of anodic aluminum oxide (AAO) membrane. The morphology and microstructure of the carbon films were characterized by scanning electron microscopy, X-ray diffraction and Raman spectroscopy. The micro-friction behavior of the amorphous carbon films sliding against GCr15 steel in ambient air was investigated using a ball-on-disk tester at an applied load of 980 mN and a sliding velocity of 0.2 m s{sup -1}. The graphitization degree in the carbon films had effect on the micro-friction properties. In comparison, the amorphous carbon film with high graphitization degree showed low friction coefficient and high wear resistance. An efficient approach was brought for enhancing the friction performance of aluminum.
2012-03-30
... population (Ref. 3). This peer-reviewed journal article presented the following findings regarding primary Mo... resurfacing). FDA intends to make background material available to the public no later than 2 business days... Implants: A Technology Overview'' (July 15, 2011), accessed online at http://www.aaos.org/research...
Belwalkar, A.; Grasing, E.; Huang, Z.; Misiolek, W.Z.
2008-01-01
Nanoporous anodic aluminum oxide (AAO) tubular membranes were fabricated from aluminum alloy tubes in sulfuric and oxalic acid electrolytes using a two-step anodization process. The membranes were investigated for characteristics such as pore size, interpore distance and thickness by varying applied voltage and electrolyte concentration. Morphology of the membranes was examined using light optical and scanning electron microscopy and characterized using ImageJ software. Results showed that membranes having narrow pore size and uniform pore distribution with parallel channel arrays were obtained. The pore sizes were ranging from 14 to 24 nm and the wall thicknesses as high as 76 µm. It was found that the pore size increased in direct proportion with the applied voltage and inversely with the electrolyte concentration while the interpore distance increased linearly with the applied voltage. It was also observed that increase in acid concentration increased tubular membrane wall thickness that improved mechanical handling. By using anodic alumina technology, robust ceramic tubes with uniformly distributed pore-structure and parallel nano-channels of lengths and sizes practical for industrial applications were reliably produced in quantity. PMID:19578471
Belwalkar, A; Grasing, E; Van Geertruyden, W; Huang, Z; Misiolek, W Z
2008-07-01
Nanoporous anodic aluminum oxide (AAO) tubular membranes were fabricated from aluminum alloy tubes in sulfuric and oxalic acid electrolytes using a two-step anodization process. The membranes were investigated for characteristics such as pore size, interpore distance and thickness by varying applied voltage and electrolyte concentration. Morphology of the membranes was examined using light optical and scanning electron microscopy and characterized using ImageJ software. Results showed that membranes having narrow pore size and uniform pore distribution with parallel channel arrays were obtained. The pore sizes were ranging from 14 to 24 nm and the wall thicknesses as high as 76 microm. It was found that the pore size increased in direct proportion with the applied voltage and inversely with the electrolyte concentration while the interpore distance increased linearly with the applied voltage. It was also observed that increase in acid concentration increased tubular membrane wall thickness that improved mechanical handling. By using anodic alumina technology, robust ceramic tubes with uniformly distributed pore-structure and parallel nano-channels of lengths and sizes practical for industrial applications were reliably produced in quantity.
Seq2Ref: a web server to facilitate functional interpretation
Directory of Open Access Journals (Sweden)
Li Wenlin
2013-01-01
Full Text Available Abstract Background The size of the protein sequence database has been exponentially increasing due to advances in genome sequencing. However, experimentally characterized proteins only constitute a small portion of the database, such that the majority of sequences have been annotated by computational approaches. Current automatic annotation pipelines inevitably introduce errors, making the annotations unreliable. Instead of such error-prone automatic annotations, functional interpretation should rely on annotations of ‘reference proteins’ that have been experimentally characterized or manually curated. Results The Seq2Ref server uses BLAST to detect proteins homologous to a query sequence and identifies the reference proteins among them. Seq2Ref then reports publications with experimental characterizations of the identified reference proteins that might be relevant to the query. Furthermore, a plurality-based rating system is developed to evaluate the homologous relationships and rank the reference proteins by their relevance to the query. Conclusions The reference proteins detected by our server will lend insight into proteins of unknown function and provide extensive information to develop in-depth understanding of uncharacterized proteins. Seq2Ref is available at: http://prodata.swmed.edu/seq2ref.
Multi-Index Stochastic Collocation for random PDEs
Haji Ali, Abdul Lateef
2016-03-28
In this work we introduce the Multi-Index Stochastic Collocation method (MISC) for computing statistics of the solution of a PDE with random data. MISC is a combination technique based on mixed differences of spatial approximations and quadratures over the space of random data. We propose an optimization procedure to select the most effective mixed differences to include in the MISC estimator: such optimization is a crucial step and allows us to build a method that, provided with sufficient solution regularity, is potentially more effective than other multi-level collocation methods already available in literature. We then provide a complexity analysis that assumes decay rates of product type for such mixed differences, showing that in the optimal case the convergence rate of MISC is only dictated by the convergence of the deterministic solver applied to a one dimensional problem. We show the effectiveness of MISC with some computational tests, comparing it with other related methods available in the literature, such as the Multi-Index and Multilevel Monte Carlo, Multilevel Stochastic Collocation, Quasi Optimal Stochastic Collocation and Sparse Composite Collocation methods.
Multi-Index Stochastic Collocation for random PDEs
Haji Ali, Abdul Lateef; Nobile, Fabio; Tamellini, Lorenzo; Tempone, Raul
2016-01-01
In this work we introduce the Multi-Index Stochastic Collocation method (MISC) for computing statistics of the solution of a PDE with random data. MISC is a combination technique based on mixed differences of spatial approximations and quadratures over the space of random data. We propose an optimization procedure to select the most effective mixed differences to include in the MISC estimator: such optimization is a crucial step and allows us to build a method that, provided with sufficient solution regularity, is potentially more effective than other multi-level collocation methods already available in literature. We then provide a complexity analysis that assumes decay rates of product type for such mixed differences, showing that in the optimal case the convergence rate of MISC is only dictated by the convergence of the deterministic solver applied to a one dimensional problem. We show the effectiveness of MISC with some computational tests, comparing it with other related methods available in the literature, such as the Multi-Index and Multilevel Monte Carlo, Multilevel Stochastic Collocation, Quasi Optimal Stochastic Collocation and Sparse Composite Collocation methods.
APE/Ref-1 is increased in nuclear fractions of human thyroid hyperfunctioning nodules.
Russo, D; Celano, M; Bulotta, S; Bruno, R; Arturi, F; Giannasio, P; Filetti, S; Damante, G; Tell, G
2002-08-30
Apurinic/apyrimidinic endonuclease APE/Ref-1 is a multifunctional protein provided with DNA repair, transcription-factor regulation and anti-apoptotic activities. We have previously reported that, in thyroid cells, TSH regulates both the synthesis and nuclear translocation of APE/Ref-1. We have also shown that nuclear levels of this protein are reduced both in thyroid carcinoma tissues and cell lines. In the present study, APE/Ref-1 expression and cellular localization were analysed by Western blot in hyperfunctioning thyroid nodules from patients with toxic adenoma and/or toxic multinodular goiter. The total content of APE/Ref-1 protein was increased in the majority of the hyperfunctioning tissues with respect to normal adjacent tissue. There was also an increase in the nuclear levels of APE/Ref-1, suggesting enhanced cytoplasm-to-nucleus translocation of the protein in addition to its increased rate of synthesis. These results demonstrate that the phenomenon of nuclear translocation of APE/Ref-1 hypothesized on the basis of cell culture experiments does actually occur in vivo. Together with previous observations in thyroid carcinomas and tumoral cell lines, our findings suggest a two-stage model of APE/Ref-1 behaviour during malignant thyrocyte transformation: an early stage characterized by simple hyperplasia and upregulation of APE/Ref-1 in the nuclear compartment of the cell and a later stage in which nuclear levels of the protein drop to below-normal levels as the cell becomes progressively undifferentiated.
Multi-Index Monte Carlo and stochastic collocation methods for random PDEs
Nobile, Fabio; Haji Ali, Abdul Lateef; Tamellini, Lorenzo; Tempone, Raul
2016-01-01
In this talk we consider the problem of computing statistics of the solution of a partial differential equation with random data, where the random coefficient is parametrized by means of a finite or countable sequence of terms in a suitable expansion. We describe and analyze a Multi-Index Monte Carlo (MIMC) and a Multi-Index Stochastic Collocation method (MISC). the former is both a stochastic version of the combination technique introduced by Zenger, Griebel and collaborators and an extension of the Multilevel Monte Carlo (MLMC) method first described by Heinrich and Giles. Instead of using firstorder differences as in MLMC, MIMC uses mixed differences to reduce the variance of the hierarchical differences dramatically. This in turn yields new and improved complexity results, which are natural generalizations of Giles s MLMC analysis, and which increase the domain of problem parameters for which we achieve the optimal convergence, O(TOL-2). On the same vein, MISC is a deterministic combination technique based on mixed differences of spatial approximations and quadratures over the space of random data. Provided enough mixed regularity, MISC can achieve better complexity than MIMC. Moreover, we show that in the optimal case the convergence rate of MISC is only dictated by the convergence of the deterministic solver applied to a one-dimensional spatial problem. We propose optimization procedures to select the most effective mixed differences to include in MIMC and MISC. Such optimization is a crucial step that allows us to make MIMC and MISC computationally effective. We finally show the effectiveness of MIMC and MISC with some computational tests, including tests with a infinite countable number of random parameters.
Multi-Index Monte Carlo and stochastic collocation methods for random PDEs
Nobile, Fabio
2016-01-09
In this talk we consider the problem of computing statistics of the solution of a partial differential equation with random data, where the random coefficient is parametrized by means of a finite or countable sequence of terms in a suitable expansion. We describe and analyze a Multi-Index Monte Carlo (MIMC) and a Multi-Index Stochastic Collocation method (MISC). the former is both a stochastic version of the combination technique introduced by Zenger, Griebel and collaborators and an extension of the Multilevel Monte Carlo (MLMC) method first described by Heinrich and Giles. Instead of using firstorder differences as in MLMC, MIMC uses mixed differences to reduce the variance of the hierarchical differences dramatically. This in turn yields new and improved complexity results, which are natural generalizations of Giles s MLMC analysis, and which increase the domain of problem parameters for which we achieve the optimal convergence, O(TOL-2). On the same vein, MISC is a deterministic combination technique based on mixed differences of spatial approximations and quadratures over the space of random data. Provided enough mixed regularity, MISC can achieve better complexity than MIMC. Moreover, we show that in the optimal case the convergence rate of MISC is only dictated by the convergence of the deterministic solver applied to a one-dimensional spatial problem. We propose optimization procedures to select the most effective mixed differences to include in MIMC and MISC. Such optimization is a crucial step that allows us to make MIMC and MISC computationally effective. We finally show the effectiveness of MIMC and MISC with some computational tests, including tests with a infinite countable number of random parameters.
Boivin, Michael J; Bangirana, Paul; Nakasujja, Noeline; Page, Connie F; Shohet, Cilly; Givon, Deborah; Bass, Judith K; Opoka, Robert O; Klein, Pnina S
2013-05-01
Mediational intervention for sensitizing caregivers (MISC) is a structured program enabling caregivers to enhance their child's cognitive and emotional development through daily interactions. The principal aim was to evaluate if a year-long MISC caregiver training program produced greater improvement in child cognitive and emotional development compared with a control program. One hundred and nineteen uninfected HIV-exposed preschool children and their caregivers were randomly assigned to 1 of 2 treatment arms: biweekly MISC training alternating between home and clinic for 1 year or a health and nutrition curriculum. All children were evaluated at baseline, 6 months, and 1 year with the Mullen Early Learning Scales, Color-Object Association Test for memory, and Achenbach Child Behavior Checklist for psychiatric symptoms. Caregivers were evaluated on the same schedule with the Hopkins Symptoms Checklist-25 for depression and anxiety. The treatment arms were compared using repeated-measures analysis of covariance with child age, gender, weight, socioeconomic status, caregiving quality, caregiver anxiety, and caregiver education as covariates. The MISC children had significantly greater gains compared to controls on the Mullen Receptive and Expressive Language development, and on the Mullen composite score of cognitive ability. Color-Object Association Test total memory for MISC children was marginally better than controls. No Achenbach Child Behavior Checklist differences between the groups were noted. Caldwell Home Observation for Measurement of the Environment scores and observed mediational interaction scores from videotapes measuring caregiving quality also improved significantly more for the MISC group. The MISC enhanced cognitive performance, especially in language development. These benefits were possibly mediated by improved caregiving and positive emotional benefit to the caregiver.
Song, Cunfeng; Wang, Meijie; Liu, Xin; Wang, He; Chen, Xiaoling; Dai, Lizong
2017-09-01
Surface-initiated reversible addition-fragmentation chain transfer (RAFT) polymerization has been utilized to fabricate high-capacity strong anion-exchange (AEX) membrane for the separation of protein. By means of RAFT polymerization, quaternized poly(3-(methacrylamidomethyl)-pyridine) brushes formed 3-dimensional nanolayers on the surface of porous anodic aluminum oxide (AAO)-silica composite membrane. The surface properties of the membranes were analyzed by SEM, water contact angle, ATR-FTIR, XPS and TGA. To investigate the adsorption performance, the new AEX membranes were applied to recover a model protein, ovalbumin (OVA). High adsorption capacities of 95.8mg/g membranes (static) and 65.3mg/g membranes (dynamic) were obtained at ambient temperature. In the further studies, up to 90% of the adsorbed OVA was efficiently eluted by using phosphate buffer-1M NaCl as elution medium. The successful separation of OVA with high purity from a mixture protein solution was also achieved by using the AEX membranes. The present study demonstrated that under mild reaction condition, RAFT polymerization can be used to fabricate ion-exchange membrane which has many remarkable features, such as high capacity and selectivity, easy elution and so on. Copyright © 2017. Published by Elsevier B.V.
RefDB: The Reference Database for CMS Monte Carlo Production
Lefébure, V
2003-01-01
RefDB is the CMS Monte Carlo Reference Database. It is used for recording and managing all details of physics simulation, reconstruction and analysis requests, for coordinating task assignments to world-wide distributed Regional Centers, Grid-enabled or not, and trace their progress rate. RefDB is also the central database that the workflow-planner contacts in order to get task instructions. It is automatically and asynchronously updated with book-keeping run summaries. Finally it is the end-user interface to data catalogues.
Bass, Judith K; Opoka, Robert; Familiar, Itziar; Nakasujja, Noeline; Sikorskii, Alla; Awadu, Jorem; Givon, Deborah; Shohet, Cilly; Murray, Sarah M; Augustinavicius, Jura; Mendelson, Tamar; Boivin, Michael
2017-08-24
HIV infection places children at neurodevelopmental risk; for young children in poverty, risk is compounded by compromised caregiving quality. The mediational intervention for sensitizing caregivers (MISC) program trained caregivers on fostering daily interactions with young children. We hypothesized that MISC could enhance neurodevelopment of rural Ugandan HIV-infected children and improve mental health outcomes of their caregivers, which might mediate improved caregiving quality. A randomized trial of HIV-infected young children (ages 2-5 years) and their female caregivers; cluster randomization was to MISC or a nutrition curriculum. A total of 18 geographic clusters in rural Uganda. Children and caregivers were evaluated at baseline, 6 months, 1 year, and 1-year post-training. Mullen Scales of Early Learning, the Color-Object Association Test for memory, the Early Childhood Vigilance Test of attention, and the Behavior Rating Inventory of Executive Function for the children. Caregivers completed measures of depression and anxiety symptoms and daily functioning. MISC had a significant impact on postintervention receptive language (adjusted mean difference = 3.13, 95% confidence interval 0.08, 6.18) that persisted at 1-year follow-up. MISC caregivers reported significantly less functional impairment postprogram (adjusted mean difference = -0.15, 95% confidence interval -0.28, -0.01). Other outcomes were NS. Both intervention conditions resulted in improvements in the study children over time. MISC showed additional impacts on child language and caregiver well-being. Future directions that include assessing the extent enhanced language development resulting from improved caregiving may better prepare impoverished children for school.
Ref-1/APE1 as a Transcriptional Regulator and Novel Therapeutic Target in Pediatric T-cell Leukemia.
Ding, Jixin; Fishel, Melissa L; Reed, April M; McAdams, Erin; Czader, Magdalena B; Cardoso, Angelo A; Kelley, Mark R
2017-07-01
The increasing characterization of childhood acute lymphoblastic leukemia (ALL) has led to the identification of multiple molecular targets but has yet to translate into more effective targeted therapies, particularly for high-risk, relapsed T-cell ALL. Searching for master regulators controlling multiple signaling pathways in T-ALL, we investigated the multifunctional protein redox factor-1 (Ref-1/APE1), which acts as a signaling "node" by exerting redox regulatory control of transcription factors important in leukemia. Leukemia patients' transcriptome databases showed increased expression in T-ALL of Ref-1 and other genes of the Ref-1/SET interactome. Validation studies demonstrated that Ref-1 is expressed in high-risk leukemia T cells, including in patient biopsies. Ref-1 redox function is active in leukemia T cells, regulating the Ref-1 target NF-κB, and inhibited by the redox-selective Ref-1 inhibitor E3330. Ref-1 expression is not regulated by Notch signaling, but is upregulated by glucocorticoid treatment. E3330 disrupted Ref-1 redox activity in functional studies and resulted in marked inhibition of leukemia cell viability, including T-ALL lines representing different genotypes and risk groups. Potent leukemia cell inhibition was seen in primary cells from ALL patients, relapsed and glucocorticoid-resistant T-ALL cells, and cells from a murine model of Notch-induced leukemia. Ref-1 redox inhibition triggered leukemia cell apoptosis and downregulation of survival genes regulated by Ref-1 targets. For the first time, this work identifies Ref-1 as a novel molecular effector in T-ALL and demonstrates that Ref-1 redox inhibition results in potent inhibition of leukemia T cells, including relapsed T-ALL. These data also support E3330 as a specific Ref-1 small-molecule inhibitor for leukemia. Mol Cancer Ther; 16(7); 1401-11. ©2017 AACR . ©2017 American Association for Cancer Research.
Studies of neutron irradiation effects at IPNS-REF
International Nuclear Information System (INIS)
Kirk, M.A.
1983-09-01
Neutron irradiation effects studies at the Radiation Effects Facility (REF) at the Intense Pulsed Neutron Source (IPNS) located at Argonne National Laboratory (ANL) are reviewed. A brief history of the development of this user facility is followed by an overview of the scientific program. Experiments unique to a spallation neutron source are covered in more detail. Future direction of research at this facility is suggested
76 FR 79190 - Agency Information Collection Activities; Submission for OMB Review; Comment Request
2011-12-21
... heightened security screening. As a result, we encourage you to submit your comments online, or to send them... Total hours Applications to the Commission 75 2 hours 150 Misc. and fraud-related consumer complaints 262,000 6.1min 26,724 (phone). Misc. and fraud-related consumer complaints 281,000 5 min 23,323...
Perfil da REF dos anos 1999-2012
Directory of Open Access Journals (Sweden)
Lucila Scavone
2013-11-01
Full Text Available http://dx.doi.org/10.1590/S0104-026X2013000200010 O artigo resulta de pesquisa mais ampla sobre a produção acadêmica de gênero efeminista em revistas científicas deste campo, com metodologia peculiar. Trata dos eixostemáticos da Revista Estudos Feministas/REF de 1999-2012 por meio de levantamento de todos osartigos publicados neste período. Analisa a coerência de seu conteúdo com a política editorialproposta, bem como as tendências e características de suas publicações.
Rubber particle proteins, HbREF and HbSRPP, show different interactions with model membranes.
Berthelot, Karine; Lecomte, Sophie; Estevez, Yannick; Zhendre, Vanessa; Henry, Sarah; Thévenot, Julie; Dufourc, Erick J; Alves, Isabel D; Peruch, Frédéric
2014-01-01
The biomembrane surrounding rubber particles from the hevea latex is well known for its content of numerous allergen proteins. HbREF (Hevb1) and HbSRPP (Hevb3) are major components, linked on rubber particles, and they have been shown to be involved in rubber synthesis or quality (mass regulation), but their exact function is still to be determined. In this study we highlighted the different modes of interactions of both recombinant proteins with various membrane models (lipid monolayers, liposomes or supported bilayers, and multilamellar vesicles) to mimic the latex particle membrane. We combined various biophysical methods (polarization-modulation-infrared reflection-adsorption spectroscopy (PM-IRRAS)/ellipsometry, attenuated-total reflectance Fourier-transform infrared (ATR-FTIR), solid-state nuclear magnetic resonance (NMR), plasmon waveguide resonance (PWR), fluorescence spectroscopy) to elucidate their interactions. Small rubber particle protein (SRPP) shows less affinity than rubber elongation factor (REF) for the membranes but displays a kind of "covering" effect on the lipid headgroups without disturbing the membrane integrity. Its structure is conserved in the presence of lipids. Contrarily, REF demonstrates higher membrane affinity with changes in its aggregation properties, the amyloid nature of REF, which we previously reported, is not favored in the presence of lipids. REF binds and inserts into membranes. The membrane integrity is highly perturbed, and we suspect that REF is even able to remove lipids from the membrane leading to the formation of mixed micelles. These two homologous proteins show affinity to all membrane models tested but neatly differ in their interacting features. This could imply differential roles on the surface of rubber particles. © 2013.
Kim, Minwoo; Ha, Yoon-Cheol; Nhat Nguyen, Truong; Choi, Hae Young; Kim, Doohun
2013-12-01
We report here a fast and reliable hard anodization process to make asymmetric anodic aluminum oxide (AAO) membranes which can serve as a template for large pitch-distance nanostructures. In order to make larger pitch distances possible, the common burning failure associated with the high current density during the conventional constant voltage hard anodization, especially at a voltage higher than a known limit, i.e., 155 V for oxalic acid, was effectively suppressed by using a burning-protective agent. A new self-ordering regime beyond the voltage limit was observed with a different voltage-interpore distance relationship of 2.2 nm V-1 compared to the reported 2.0 nm V-1 for hard anodization. Combining a sulfuric acid mild anodization with this new regime of hard anodization, we further demonstrate a scalable process to make an asymmetric membrane with size up to ˜47 mm in diameter and ˜60 μm in thickness. This free-standing membrane can be used as a template for novel nanopatterned structures such as arrays of quantum dots, nanowires or nanotubes with diameters of a few tens of nanometers and pitch distance of over 400 nm.
DNA Repair and Cancer Therapy: Targeting APE1/Ref-1 Using Dietary Agents
Directory of Open Access Journals (Sweden)
Julian J. Raffoul
2012-01-01
Full Text Available Epidemiological studies have demonstrated the cancer protective effects of dietary agents and other natural compounds isolated from fruits, soybeans, and vegetables on neoplasia. Studies have also revealed the potential for these natural products to be combined with chemotherapy or radiotherapy for the more effective treatment of cancer. In this paper we discuss the potential for targeting the DNA base excision repair enzyme APE1/Ref-1 using dietary agents such as soy isoflavones, resveratrol, curcumin, and the vitamins ascorbate and α-tocopherol. We also discuss the potential role of soy isoflavones in sensitizing cancer cells to the effects of radiotherapy. A comprehensive review of the dual nature of APE1/Ref-1 in DNA repair and redox activation of cellular transcription factors, NF-κB and HIF-1α, is also discussed. Further research efforts dedicated to delineating the role of APE1/Ref-1 DNA repair versus redox activity in sensitizing cancer cells to conventional treatment are warranted.
Warnick, Brittany; Drake, Morgan; Vidrine, Stephanie
2015-01-01
The Delis Rating of Executive Function (D-REF) is a set of rating scales designed to assess executive functions and their constituent sub-processes in children and adolescents between the ages of 5 and 18. More specifically, the D-REF is a supplemental assessment of children and adolescents demonstrating behavioral or cognitive difficulties often…
Multi-index Stochastic Collocation Convergence Rates for Random PDEs with Parametric Regularity
Haji Ali, Abdul Lateef; Nobile, Fabio; Tamellini, Lorenzo; Tempone, Raul
2016-01-01
We analyze the recent Multi-index Stochastic Collocation (MISC) method for computing statistics of the solution of a partial differential equation (PDE) with random data, where the random coefficient is parametrized by means of a countable sequence of terms in a suitable expansion. MISC is a combination technique based on mixed differences of spatial approximations and quadratures over the space of random data, and naturally, the error analysis uses the joint regularity of the solution with respect to both the variables in the physical domain and parametric variables. In MISC, the number of problem solutions performed at each discretization level is not determined by balancing the spatial and stochastic components of the error, but rather by suitably extending the knapsack-problem approach employed in the construction of the quasi-optimal sparse-grids and Multi-index Monte Carlo methods, i.e., we use a greedy optimization procedure to select the most effective mixed differences to include in the MISC estimator. We apply our theoretical estimates to a linear elliptic PDE in which the log-diffusion coefficient is modeled as a random field, with a covariance similar to a Matérn model, whose realizations have spatial regularity determined by a scalar parameter. We conduct a complexity analysis based on a summability argument showing algebraic rates of convergence with respect to the overall computational work. The rate of convergence depends on the smoothness parameter, the physical dimensionality and the efficiency of the linear solver. Numerical experiments show the effectiveness of MISC in this infinite dimensional setting compared with the Multi-index Monte Carlo method and compare the convergence rate against the rates predicted in our theoretical analysis. © 2016 SFoCM
Multi-index Stochastic Collocation Convergence Rates for Random PDEs with Parametric Regularity
Haji Ali, Abdul Lateef
2016-08-26
We analyze the recent Multi-index Stochastic Collocation (MISC) method for computing statistics of the solution of a partial differential equation (PDE) with random data, where the random coefficient is parametrized by means of a countable sequence of terms in a suitable expansion. MISC is a combination technique based on mixed differences of spatial approximations and quadratures over the space of random data, and naturally, the error analysis uses the joint regularity of the solution with respect to both the variables in the physical domain and parametric variables. In MISC, the number of problem solutions performed at each discretization level is not determined by balancing the spatial and stochastic components of the error, but rather by suitably extending the knapsack-problem approach employed in the construction of the quasi-optimal sparse-grids and Multi-index Monte Carlo methods, i.e., we use a greedy optimization procedure to select the most effective mixed differences to include in the MISC estimator. We apply our theoretical estimates to a linear elliptic PDE in which the log-diffusion coefficient is modeled as a random field, with a covariance similar to a Matérn model, whose realizations have spatial regularity determined by a scalar parameter. We conduct a complexity analysis based on a summability argument showing algebraic rates of convergence with respect to the overall computational work. The rate of convergence depends on the smoothness parameter, the physical dimensionality and the efficiency of the linear solver. Numerical experiments show the effectiveness of MISC in this infinite dimensional setting compared with the Multi-index Monte Carlo method and compare the convergence rate against the rates predicted in our theoretical analysis. © 2016 SFoCM
Energy Technology Data Exchange (ETDEWEB)
Gruenig, Marielle C.; Lu, Duo; Won, Sang Joon; Dulberger, Charles L.; Manlick, Angela J.; Keck, James L.; Cox, Michael M. (UW)
2012-03-16
The bacteriophage P1-encoded Ref protein enhances RecA-dependent recombination in vivo by an unknown mechanism. We demonstrate that Ref is a new type of enzyme; that is, a RecA-dependent nuclease. Ref binds to ss- and dsDNA but does not cleave any DNA substrate until RecA protein and ATP are added to form RecA nucleoprotein filaments. Ref cleaves only where RecA protein is bound. RecA functions as a co-nuclease in the Ref/RecA system. Ref nuclease activity can be limited to the targeted strands of short RecA-containing D-loops. The result is a uniquely programmable endonuclease activity, producing targeted double-strand breaks at any chosen DNA sequence in an oligonucleotide-directed fashion. We present evidence indicating that cleavage occurs in the RecA filament groove. The structure of the Ref protein has been determined to 1.4 {angstrom} resolution. The core structure, consisting of residues 77-186, consists of a central 2-stranded {beta}-hairpin that is sandwiched between several {alpha}-helical and extended loop elements. The N-terminal 76 amino acid residues are disordered; this flexible region is required for optimal activity. The overall structure of Ref, including several putative active site histidine residues, defines a new subclass of HNH-family nucleases. We propose that enhancement of recombination by Ref reflects the introduction of directed, recombinogenic double-strand breaks.
International Nuclear Information System (INIS)
Kim, Minwoo; Ha, Yoon-Cheol; Choi, Hae Young; Kim, Doohun; Nguyen, Truong Nhat
2013-01-01
We report here a fast and reliable hard anodization process to make asymmetric anodic aluminum oxide (AAO) membranes which can serve as a template for large pitch-distance nanostructures. In order to make larger pitch distances possible, the common burning failure associated with the high current density during the conventional constant voltage hard anodization, especially at a voltage higher than a known limit, i.e., 155 V for oxalic acid, was effectively suppressed by using a burning-protective agent. A new self-ordering regime beyond the voltage limit was observed with a different voltage–interpore distance relationship of 2.2 nm V −1 compared to the reported 2.0 nm V −1 for hard anodization. Combining a sulfuric acid mild anodization with this new regime of hard anodization, we further demonstrate a scalable process to make an asymmetric membrane with size up to ∼47 mm in diameter and ∼60 μm in thickness. This free-standing membrane can be used as a template for novel nanopatterned structures such as arrays of quantum dots, nanowires or nanotubes with diameters of a few tens of nanometers and pitch distance of over 400 nm. (paper)
Energy Technology Data Exchange (ETDEWEB)
Kim, Minwoo; Ha, Yoon-Cheol; Choi, Hae Young; Kim, Doohun [Creative and Fundamental Research Division, Korea Electrotechnology Research Institute, Changwon 642-120 (Korea, Republic of); Nguyen, Truong Nhat, E-mail: ycha@keri.re.kr [Department of Materials Science and Engineering, University of Erlangen-Nuremberg, D-91058 Erlangen (Germany)
2013-12-20
We report here a fast and reliable hard anodization process to make asymmetric anodic aluminum oxide (AAO) membranes which can serve as a template for large pitch-distance nanostructures. In order to make larger pitch distances possible, the common burning failure associated with the high current density during the conventional constant voltage hard anodization, especially at a voltage higher than a known limit, i.e., 155 V for oxalic acid, was effectively suppressed by using a burning-protective agent. A new self-ordering regime beyond the voltage limit was observed with a different voltage–interpore distance relationship of 2.2 nm V{sup −1} compared to the reported 2.0 nm V{sup −1} for hard anodization. Combining a sulfuric acid mild anodization with this new regime of hard anodization, we further demonstrate a scalable process to make an asymmetric membrane with size up to ∼47 mm in diameter and ∼60 μm in thickness. This free-standing membrane can be used as a template for novel nanopatterned structures such as arrays of quantum dots, nanowires or nanotubes with diameters of a few tens of nanometers and pitch distance of over 400 nm. (paper)
International Nuclear Information System (INIS)
Norek, Małgorzata; Michalska-Domańska, Marta; Stępniowski, Wojciech J.; Ayala, Israel; Bombalska, Aneta; Budner, Bogusław
2013-01-01
The photoluminescence (PL) properties of tin oxide nanostructures are investigated. Three samples of different morphology, induced by deposition process and various geometrical features of nanoporous anodic aluminum oxide (AAO) substrate, are analyzed. X-ray photoelectronic spectroscopy (XPS) analysis reveals the presence of two forms of tin oxide on the surface of all studied samples: SnO and SnO 2 . The former form is typical for reduced surface with bridging oxygen atoms and every other row of in-plane oxygen atoms removed. The oxygen defects give rise to a strong emission in visible region. Two intense PL peaks are observed centered at about 540 (band I) and 620 (band II) nm. The origin of these bands was ascribed to the recombination of electrons from the conduction band (band I) and shallow traps levels (band II) to the surface oxygen vacancy levels. Upon deposition of Au nanoparticles on the top of tin oxide nanostructures the emission at 540 and 620 nm disappears and a new band (band III) occurs in the range >760 nm. The PL mechanism operating in the studied systems is discussed. The tin oxide/Au nanocomposites can be used as efficient multi-band light emitters in a wide (from visible to near infrared) wavelength range.
CERN Technical Training 2002: Learning for the LHC ! HeREF-2002 : Helium Refrigeration Techniques
Davide Vitè
2002-01-01
Theory, Technology, Maintenance and Control of Helium Refrigerators HeREF-2002 is a new course, in the framework of the 2002 Technical Training Programme, that will provide a complete introduction to Helium refrigeration, with a practical approach to theory, technology, maintenance and control of Helium refrigeration installations. Theoretical aspects and equations will be limited to a minimum. HeREF-2002 targets an audience of technicians and operators of Helium refrigeration plants at CERN, as well as physicists and engineers needing an overview of current Helium refrigeration techniques. HeREF-2002 will address, among other, issues related to component technology, installation maintenance, process control and Helium purity. A commented visit to a couple of CERN Helium refrigeration or liquefaction plants will also take place. Duration: 7 half days (5 mornings and 2 afternoons), 21-25 October 2002. Estimated cost: 300.- CHF Language: Bilingual English-French. The course support will be in English, the...
International Nuclear Information System (INIS)
Huang, Manhong; Qi, Fangfang; Wang, Jue; Xu, Qi; Lin, Li
2015-01-01
Highlights: • High-throughput sequencing was used to compare sludge bacteria with and without TC. • Bacterial diversity increased with TC addition despite of various oxygen conditions. • Total TRGs proliferated with TC addition in three kinds of sludge. • The concentration of efflux pump genes was the highest in the three groups of TRGs. - Abstract: Two lab-scale anaerobic-anoxic-oxic (AAO) systems were used to investigate the changes in tetracycline (TC) resistance and bacterial diversity upon exposure to TC pressure. High-throughput sequencing was used to detect diversity changes in microorganisms at the level of class in sludge from different bioreactors with and without TC. Real-time fluorescence quantitative polymerase chain reaction (RT-qPCR) was used to detect the abundances of eight tetracycline resistance genes (TRGs), tetA, tetB, tetC, tetE, tetM, tetO, tetS and tetX. The results showed that the diversities of the microbial communities of anoxic, anaerobic and aerobic sludge all increased with the addition of TC. TC substantially changed the structure of the microbial community regardless of oxygen conditions. Bacteroidetes and Proteobacteria were the dominant species in the three kinds of sludge and were substantially enriched with TC pressure. In sludge with TC added, almost all target TRGs proliferated more than those in sludge without TC except tetX, which decreased in anaerobic sludge with TC addition. The concentration of efflux pump genes, tet(A–C, E), was the highest among the three groups of TRGs in the different kinds of sludge
Energy Technology Data Exchange (ETDEWEB)
Huang, Manhong, E-mail: egghmh@163.com; Qi, Fangfang; Wang, Jue; Xu, Qi; Lin, Li
2015-11-15
Highlights: • High-throughput sequencing was used to compare sludge bacteria with and without TC. • Bacterial diversity increased with TC addition despite of various oxygen conditions. • Total TRGs proliferated with TC addition in three kinds of sludge. • The concentration of efflux pump genes was the highest in the three groups of TRGs. - Abstract: Two lab-scale anaerobic-anoxic-oxic (AAO) systems were used to investigate the changes in tetracycline (TC) resistance and bacterial diversity upon exposure to TC pressure. High-throughput sequencing was used to detect diversity changes in microorganisms at the level of class in sludge from different bioreactors with and without TC. Real-time fluorescence quantitative polymerase chain reaction (RT-qPCR) was used to detect the abundances of eight tetracycline resistance genes (TRGs), tetA, tetB, tetC, tetE, tetM, tetO, tetS and tetX. The results showed that the diversities of the microbial communities of anoxic, anaerobic and aerobic sludge all increased with the addition of TC. TC substantially changed the structure of the microbial community regardless of oxygen conditions. Bacteroidetes and Proteobacteria were the dominant species in the three kinds of sludge and were substantially enriched with TC pressure. In sludge with TC added, almost all target TRGs proliferated more than those in sludge without TC except tetX, which decreased in anaerobic sludge with TC addition. The concentration of efflux pump genes, tet(A–C, E), was the highest among the three groups of TRGs in the different kinds of sludge.
Intrinsic Radiation Source Generation with the ISC Package: Data Comparisons and Benchmarking
International Nuclear Information System (INIS)
Solomon, Clell J. Jr.
2012-01-01
The characterization of radioactive emissions from unstable isotopes (intrinsic radiation) is necessary for shielding and radiological-dose calculations from radioactive materials. While most radiation transport codes, e.g., MCNP [X-5 Monte Carlo Team, 2003], provide the capability to input user prescribed source definitions, such as radioactive emissions, they do not provide the capability to calculate the correct radioactive-source definition given the material compositions. Special modifications to MCNP have been developed in the past to allow the user to specify an intrinsic source, but these modification have not been implemented into the primary source base [Estes et al., 1988]. To facilitate the description of the intrinsic radiation source from a material with a specific composition, the Intrinsic Source Constructor library (LIBISC) and MCNP Intrinsic Source Constructor (MISC) utility have been written. The combination of LIBISC and MISC will be herein referred to as the ISC package. LIBISC is a statically linkable C++ library that provides the necessary functionality to construct the intrinsic-radiation source generated by a material. Furthermore, LIBISC provides the ability use different particle-emission databases, radioactive-decay databases, and natural-abundance databases allowing the user flexibility in the specification of the source, if one database is preferred over others. LIBISC also provides functionality for aging materials and producing a thick-target bremsstrahlung photon source approximation from the electron emissions. The MISC utility links to LIBISC and facilitates the description of intrinsic-radiation sources into a format directly usable with the MCNP transport code. Through a series of input keywords and arguments the MISC user can specify the material, age the material if desired, and produce a source description of the radioactive emissions from the material in an MCNP readable format. Further details of using the MISC utility can
Directory of Open Access Journals (Sweden)
Karine Berthelot
Full Text Available REF (Hevb1 and SRPP (Hevb3 are two major components of Hevea brasiliensis latex, well known for their allergenic properties. They are obviously taking part in the biosynthesis of natural rubber, but their exact function is still unclear. They could be involved in defense/stress mechanisms after tapping or directly acting on the isoprenoid biosynthetic pathway. The structure of these two proteins is still not described. In this work, it was discovered that REF has amyloid properties, contrary to SRPP. We investigated their structure by CD, TEM, ATR-FTIR and WAXS and neatly showed the presence of β-sheet organized aggregates for REF, whereas SRPP mainly fold as a helical protein. Both proteins are highly hydrophobic but differ in their interaction with lipid monolayers used to mimic the monomembrane surrounding the rubber particles. Ellipsometry experiments showed that REF seems to penetrate deeply into the monolayer and SRPP only binds to the lipid surface. These results could therefore clarify the role of these two paralogous proteins in latex production, either in the coagulation of natural rubber or in stress-related responses. To our knowledge, this is the first report of an amyloid formed from a plant protein. This suggests also the presence of functional amyloid in the plant kingdom.
Initial Validation of Ballistic Shock Transducers
2017-06-05
Access to an air compressor for operation of a gas gun. (3) The capability for reference measurements via a LDV. 2.2 Instrumentation. a. High-g...MISC TB 10004 BTSX Calibration4, and ATC IOP MISC TB10005 BTSX Signal Conditioner /Digitizer Add-On Module Procedure5. TOP 01-1-070 5 June 2017...accelerometer, that while not noticeable in the acceleration-time history , accumulate large errors during the integration process and are present in the
Lord, Sarah Peregrine; Can, Doğan; Yi, Michael; Marin, Rebeca; Dunn, Christopher W; Imel, Zac E; Georgiou, Panayiotis; Narayanan, Shrikanth; Steyvers, Mark; Atkins, David C
2015-02-01
The current paper presents novel methods for collecting MISC data and accurately assessing reliability of behavior codes at the level of the utterance. The MISC 2.1 was used to rate MI interviews from five randomized trials targeting alcohol and drug use. Sessions were coded at the utterance-level. Utterance-based coding reliability was estimated using three methods and compared to traditional reliability estimates of session tallies. Session-level reliability was generally higher compared to reliability using utterance-based codes, suggesting that typical methods for MISC reliability may be biased. These novel methods in MI fidelity data collection and reliability assessment provided rich data for therapist feedback and further analyses. Beyond implications for fidelity coding, utterance-level coding schemes may elucidate important elements in the counselor-client interaction that could inform theories of change and the practice of MI. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Vittorio Di Maso
Full Text Available Human Hepatocellular Carcinoma (HCC is the fifth most frequent neoplasm worldwide and the most serious complication of long-standing chronic liver diseases (CLD. Its development is associated with chronic inflammation and sustained oxidative stress. Deregulation of apurinic apyrimidinic endonuclease 1/redox effector factor 1 (APE1/Ref-1, a master regulator of cellular response to oxidative stress, has been associated with poor prognosis in several cancers including HCC.In the present study we investigated the APE1/Ref-1 mRNA levels in cirrhotic and HCC tissues obtained during HCC resection. The possible protective role of APE1/Ref-1 against oxidative stress and apoptosis was evaluated in vitro in immortalized human hepatocytes (IHH over-expressing APE1/Ref-1.APE1/Ref-1 was up-regulated in HCC, regulation occurring at the transcriptional level. APE1/Ref-1 mRNA content increased with the progression of liver disease with the transcriptional up-regulation present in cirrhosis significantly increased in HCC. The up-regulation was higher in the less differentiated cancers. In vitro, over-expression of APE1/Ref-1 in normal hepatocytes conferred cell protection against oxidative stress and it was associated with BAX inhibition and escape from apoptosis.APE1/Ref-1 is up-regulated in HCC and this over-expression correlates with cancer aggressiveness. The up-regulation occurs at the transcriptional level and it is present in the earliest phases of hepatocarcinogenesis. The APE-1/Ref-1 over-expression is associated with hepatocyte survival and inhibits BAX activation and apoptosis. These data suggest a possible role of APE1/Ref-1 over-expression both in hepatocyte survival and HCC development calling attention to this molecule as a promising marker for HCC diagnosis and treatment.
Liu, Long; Zhang, Qian; Lu, Yuanshen; Du, Wei; Li, Bin; Cui, Yushuang; Yuan, Changsheng; Zhan, Peng; Ge, Haixiong; Wang, Zhenling; Chen, Yanfeng
2017-06-01
As a powerful spectroscopy technique, surface-enhanced Raman scattering (SERS) can provide non-destructive and sensitive characterization down to a single molecular level. Aiming to the main challenges of high-performance SERS-active substrates for their real-world applications involving the ultra-sensitive and reproducible signals detection and signal uniformity with large-area, herein, a facile and reliable strategy based on combination of thermal imprinting polycarbonate (PC) film with porous anodic aluminum oxide (AAO) mold and E-beam evaporation of gold is provided to fabricate a high-quality SERS-active substrate consisting of ultra-dense hot-spots with large-area uniformity. Two kinds of sub-10 nm gaps were obtained, including the nanogaps between the neighboring gold coated PC-nanopillars and those between gold on the top of the nanopillars and that on the base, which actually build up a three-dimensional (3D) hot-spot network for high-performance SERS detection. The effect of structural parameters on SERS enhancement was investigated numerically and experimentally, and by optimizing the structural parameters, a remarkable average SERS enhancement factor up to of 1.4×108 is achieved and it shows an excellent reproducibility with a relative standard deviation of 18%, which allows for enhanced practicability in the application of quantitative biochemical detection.
Directory of Open Access Journals (Sweden)
Long Liu
2017-06-01
Full Text Available As a powerful spectroscopy technique, surface-enhanced Raman scattering (SERS can provide non-destructive and sensitive characterization down to a single molecular level. Aiming to the main challenges of high-performance SERS-active substrates for their real-world applications involving the ultra-sensitive and reproducible signals detection and signal uniformity with large-area, herein, a facile and reliable strategy based on combination of thermal imprinting polycarbonate (PC film with porous anodic aluminum oxide (AAO mold and E-beam evaporation of gold is provided to fabricate a high-quality SERS-active substrate consisting of ultra-dense hot-spots with large-area uniformity. Two kinds of sub-10 nm gaps were obtained, including the nanogaps between the neighboring gold coated PC-nanopillars and those between gold on the top of the nanopillars and that on the base, which actually build up a three-dimensional (3D hot-spot network for high-performance SERS detection. The effect of structural parameters on SERS enhancement was investigated numerically and experimentally, and by optimizing the structural parameters, a remarkable average SERS enhancement factor up to of 1.4×108 is achieved and it shows an excellent reproducibility with a relative standard deviation of 18%, which allows for enhanced practicability in the application of quantitative biochemical detection.
Reynolds, David; Rasch, William; Kozlowski, Daniel; Burks, Jason; Zavodsky, Bradley; Bernardet, Ligia; Jankov, Isidora; Albers, Steve
2014-01-01
The Experimental Regional Ensemble Forecast (ExREF) system is a tool for the development and testing of new Numerical Weather Prediction (NWP) methodologies. ExREF is run in near-realtime by the Global Systems Division (GSD) of the NOAA Earth System Research Laboratory (ESRL) and its products are made available through a website, an ftp site, and via the Unidata Local Data Manager (LDM). The ExREF domain covers most of North America and has 9-km horizontal grid spacing. The ensemble has eight members, all employing WRF-ARW. The ensemble uses a variety of initial conditions from LAPS and the Global Forecasting System (GFS) and multiple boundary conditions from the GFS ensemble. Additionally, a diversity of physical parameterizations is used to increase ensemble spread and to account for the uncertainty in forecasting extreme precipitation events. ExREF has been a component of the Hydrometeorology Testbed (HMT) NWP suite in the 2012-2013 and 2013-2014 winters. A smaller domain covering just the West Coast was created to minimize band-width consumption for the NWS. This smaller domain has and is being distributed to the National Weather Service (NWS) Weather Forecast Office and California Nevada River Forecast Center in Sacramento, California, where it is ingested into the Advanced Weather Interactive Processing System (AWIPS I and II) to provide guidance on the forecasting of extreme precipitation events. This paper will review the cooperative effort employed by NOAA ESRL, NASA SPoRT (Short-term Prediction Research and Transition Center), and the NWS to facilitate the ingest and display of ExREF data utilizing the AWIPS I and II D2D and GFE (Graphical Software Editor) software. Within GFE is a very useful verification software package called BoiVer that allows the NWS to utilize the River Forecast Center's 4 km gridded QPE to compare with all operational NWP models 6-hr QPF along with the ExREF mean 6-hr QPF so the forecasters can build confidence in the use of the
Com traduir i modificar un dels formats bibliogràfics de RefWorks al castellà
Feliu, M. Àngels
2010-01-01
L'ús de gestors de referències com RefWorks agilitza el treball dels autors però el seu ús en castellà presenta dificultats a causa de la seva construcció original en anglès. Per això, un dels formats de RefWorks s'ha adaptat a les normes gramaticals i ortogràfiques del castellà i s'ha posat a disposició de la comunitat científica.
Wadeesirisak, Kanthida; Castano, Sabine; Berthelot, Karine; Vaysse, Laurent; Bonfils, Frédéric; Peruch, Frédéric; Rattanaporn, Kittipong; Liengprayoon, Siriluck; Lecomte, Sophie; Bottier, Céline
2017-02-01
Rubber particle membranes from the Hevea latex contain predominantly two proteins, REF1 and SRPP1 involved in poly(cis-1,4-isoprene) synthesis or rubber quality. The repartition of both proteins on the small or large rubber particles seems to differ, but their role in the irreversible coagulation of the rubber particle is still unknown. In this study we highlighted the different modes of interactions of both recombinant proteins with different classes of lipids extracted from Hevea brasiliensis latex, and defined as phospholipids (PL), glycolipids (GL) and neutral lipids (NL). We combined two biophysical methods, polarization modulated-infrared reflection adsorption spectroscopy (PM-IRRAS) and ellipsometry to elucidate their interactions with monolayers of each class of lipids. REF1 and SRPP1 interactions with native lipids are clearly different; SRPP1 interacts mostly in surface with PL, GL or NL, without modification of its structure. In contrast REF1 inserts deeply in the lipid monolayers with all lipid classes. With NL, REF1 is even able to switch from α-helice conformation to β-sheet structure, as in its aggregated form (amyloid form). Interaction between REF1 and NL may therefore have a specific role in the irreversible coagulation of rubber particles. Copyright © 2016 Elsevier B.V. All rights reserved.
Laev, Sergey S; Salakhutdinov, Nariman F; Lavrik, Olga I
2017-05-01
Human apurinic/apyrimidinic endonuclease 1/redox effector factor 1 (APE1/Ref-1) is a multifunctional protein which is essential in the base excision repair (BER) pathway of DNA lesions caused by oxidation and alkylation. This protein hydrolyzes DNA adjacent to the 5'-end of an apurinic/apyrimidinic (AP) site to produce a nick with a 3'-hydroxyl group and a 5'-deoxyribose phosphate moiety or activates the DNA-binding activity of certain transcription factors through its redox function. Studies have indicated a role for APE1/Ref-1 in the pathogenesis of cancer and in resistance to DNA-interactive drugs. Thus, this protein has potential as a target in cancer treatment. As a result, major efforts have been directed to identify small molecule inhibitors against APE1/Ref-1 activities. These agents have the potential to become anticancer drugs. The aim of this review is to present recent progress in studies of all published small molecule APE1/Ref-1 inhibitors. The structures and activities of APE1/Ref-1 inhibitors, that target both DNA repair and redox activities, are presented and discussed. To date, there is an urgent need for further development of the design and synthesis of APE1/Ref-1 inhibitors due to high importance of this protein target. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Zheng Tong
2017-05-01
Full Text Available Rubber elongation factor (REF and small rubber particle protein (SRPP are two key factors for natural rubber biosynthesis. To further understand the roles of these proteins in rubber formation, six different genes for latex abundant REF or SRPP proteins, including REF138,175,258 and SRPP117,204,243, were characterized from Hevea brasiliensis Reyan (RY 7-33-97. Sequence analysis showed that REFs have a variable and long N-terminal, whereas SRPPs have a variable and long C-terminal beyond the REF domain, and REF258 has a β subunit of ATPase in its N-terminal. Through two-dimensional electrophoresis (2-DE, each REF/SRPP protein was separated into multiple protein spots on 2-DE gels, indicating they have multiple protein species. The abundance of REF/SRPP proteins was compared between ethylene and control treatments or among rubber tree clones with different levels of latex productivity by analyzing 2-DE gels. The total abundance of each REF/SRPP protein decreased or changed a little upon ethylene stimulation, whereas the abundance of multiple protein species of the same REF/SRPP changed diversely. Among the three rubber tree clones, the abundance of the protein species also differed significantly. Especially, two protein species of REF175 or REF258 were ethylene-responsive only in the high latex productivity clone RY 8-79 instead of in RY 7-33-97 and PR 107. Some individual protein species were positively related to ethylene stimulation and latex productivity. These results suggested that the specific protein species could be more important than others for rubber production and post-translational modifications might play important roles in rubber biosynthesis.
The FachRef-Assistant: Personalised, subject specific, and transparent stock management
Directory of Open Access Journals (Sweden)
Eike T. Spielberg
2017-07-01
Full Text Available We present in this paper a personalized web application for the weeding of printed resources: the FachRef-Assistant. It offers an extensive range of tools for evidence based stock management, based on the thorough analysis of usage statistics. Special attention is paid to the criteria individualization, transparency of the parameters used, and generic functions. Currently, it is designed to work with the Aleph-System from ExLibris, but efforts were spent to keep the application as generic as possible. For example, all procedures specific to the local library system have been collected in one Java package. The inclusion of library specific properties such as collections and systematics has been designed to be highly generic as well by mapping the individual entries onto an in-memory database. Hence simple adaption of the package and the mappings would render the FachRef-Assistant compatible to other library systems. The personalization of the application allows for the inclusion of subject specific usage properties as well as of variations between different collections within one subject area. The parameter sets used to analyse the stock and to prepare weeding and purchase proposal lists are included in the output XML-files to facilitate a high degree of transparency, objectivity and reproducibility.
Ref2RIS: Importing Word-Processed Bibliographies into Bibliographic Management Software
Deborah Fitchett
2012-01-01
Many who would benefit the most from timesaving bibliographic managers hesitate to adopt the technology due to the difficulties in importing legacy bibliographies developed over years. Existing shortcuts rely on manual reformatting or on re-searching online databases for the records - often almost as laborious as retyping the references. Ref2RIS was developed to automate the task of converting a bibliography in specific citation styles from common word processing document formats into the wid...
NCBI nr-aa BLAST: CBRC-DNOV-01-3215 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-3215 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-TBEL-01-2154 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TBEL-01-2154 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-ETEL-01-0353 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0353 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-FCAT-01-0282 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FCAT-01-0282 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-OLAT-16-0022 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-16-0022 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-PABE-01-0133 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PABE-01-0133 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-ACAR-01-0569 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0569 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-XTRO-01-2431 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2431 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-EEUR-01-1511 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-1511 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-BTAU-01-3054 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-3054 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-RMAC-01-0015 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RMAC-01-0015 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-GGAL-23-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-23-0008 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-HSAP-01-0032 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-01-0032 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-CFAM-02-0024 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-02-0024 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-RNOR-05-0237 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0237 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-PTRO-01-0019 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-01-0019 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-OANA-01-1293 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OANA-01-1293 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-TGUT-26-0004 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-26-0004 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-CJAC-01-1490 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1490 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-TNIG-22-0071 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-22-0071 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-MMUS-04-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-04-0074 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
NCBI nr-aa BLAST: CBRC-RNOR-05-0235 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0235 ref|NP_848509.1| progestin and adipoQ receptor family member VII ...[Homo sapiens] sp|Q86WK9|MPRA_HUMAN Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ rece...ptor family member VII) gb|AAO47233.1|AF313620_1 putative membrane steroid receptor [Homo sapiens] gb|AAR08373.1| progesti...1| hCG1642829 [Homo sapiens] emb|CAM12867.1| progestin and adipoQ receptor family member VII [Homo sapiens] NP_848509.1 1e-169 84% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0499 ref|NP_848509.1| progestin and adipoQ receptor family member VII ...[Homo sapiens] sp|Q86WK9|MPRA_HUMAN Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ rece...ptor family member VII) gb|AAO47233.1|AF313620_1 putative membrane steroid receptor [Homo sapiens] gb|AAR08373.1| progesti...1| hCG1642829 [Homo sapiens] emb|CAM12867.1| progestin and adipoQ receptor family member VII [Homo sapiens] NP_848509.1 1e-175 85% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0432 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0432 ref|NP_848509.1| progestin and adipoQ receptor family member VII ...[Homo sapiens] sp|Q86WK9|MPRA_HUMAN Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ rece...ptor family member VII) gb|AAO47233.1|AF313620_1 putative membrane steroid receptor [Homo sapiens] gb|AAR08373.1| progesti...1| hCG1642829 [Homo sapiens] emb|CAM12867.1| progestin and adipoQ receptor family member VII [Homo sapiens] NP_848509.1 0.0 95% ...
NCBI nr-aa BLAST: CBRC-GGAL-23-0005 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-23-0005 ref|NP_848509.1| progestin and adipoQ receptor family member VII ...[Homo sapiens] sp|Q86WK9|MPRA_HUMAN Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ rece...ptor family member VII) gb|AAO47233.1|AF313620_1 putative membrane steroid receptor [Homo sapiens] gb|AAR08373.1| progesti...1| hCG1642829 [Homo sapiens] emb|CAM12867.1| progestin and adipoQ receptor family member VII [Homo sapiens] NP_848509.1 1e-120 66% ...
Analysis of evidence within the AUA's clinical practice guidelines.
Antoine, Samuel G; Small, Alexander C; McKiernan, James M; Shah, Ojas
2018-02-01
Surgical subspecialty societies release clinical practice guidelines (CPGs) to provide topic-specific recommendations to healthcare providers. We hypothesize that there may be significant differences in statement strength and evidence quality both within the American Urological Association (AUA) guidelines and compared to those published by the American Academy of Orthopedic Surgeons (AAOS) and American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS). CPGs issued through 2017 were extracted from the AUAnet.org. Statements were characterized by evidence basis, strength, and evidence quality. CPGs were compared among urologic subspecialties and to those from the AAOS and AAO-HNS. Analysis used Fisher's exact tests and Student's t-tests with significance p < 0.05. A total of 25 AUA CPGs (672 statements) were reviewed and 34.6% were non-evidence based with the highest proportions in pediatrics (47.5%) and sexual medicine (46.5%). The AUA has published over twice as many statements as the AAOS and quadruple that of the AAO-HNS. A smaller proportion of the AUA statements were evidence-based (65.4%) compared to the AAOS (80.5%, p < 0.001) and AAO-HNS (99.8%, p < 0.001), and fewer used "high" quality evidence (AUA 7.2% versus AAOS 21.2%, p < 0.001; versus AAO-HNS 16.1%, p < 0.001). The AUA has published broad CPGs that far exceed those from the AAOS and AAO-HNS. The AUA has utilized extensive resources to provide guidance to help standardize care among urologists. The AAOS and AAO-HNS may not provide guidelines when evidence is limited. With the continued increase of high quality clinical trials, the AUA will be able to continue improving its robust set of evidence-based CPGs.
Niobium and hafnium grown on porous membranes
International Nuclear Information System (INIS)
Morant, C.; Marquez, F.; Campo, T.; Sanz, J.M.; Elizalde, E.
2010-01-01
In this work we report on a method for fabricating highly ordered nanostructures of niobium and hafnium metals by physical vapour deposition using two different templates: anodized aluminum oxide membranes (AAO) and zirconium onto AAO membranes (Zr/AAO). The growth mechanism of these metal nanostructures is clearly different depending on the material used as a template. A different morphology was obtained by using AAO or Zr/AAO templates: when the metal is deposited onto AAO membranes, nanospheres with ordered hexagonal regularity are obtained; however, when the metal is deposited onto a Zr/AAO template, highly ordered nanocones are formed. The experimental approach described in this work is simple and suitable for synthesizing nanospheres or nanoholes of niobium and hafnium metals in a highly ordered structure.
International Nuclear Information System (INIS)
Juliana, Farha M.; Nara, Hidetoshi; Onoda, Tadashi; Rahman, Mizanur; Araki, Akemi; Jin, Lianjin; Fujii, Hodaka; Tanaka, Nobuyuki; Hoshino, Tomoaki; Asao, Hironobu
2012-01-01
Highlights: ► IL-21 induces nuclear accumulation of Ape1/Ref-1 protein. ► Ape1/Ref-1 is indispensable in IL-21-induced cell proliferation and survival signal. ► Ape1/Ref-1 is required for IL-21-induced ERK1/2 activation. -- Abstract: IL-21 is a pleiotropic cytokine that regulates T-cell and B-cell differentiation, NK-cell activation, and dendritic cell functions. IL-21 activates the JAK-STAT, ERK, and PI3K pathways. We report here that Ape1/Ref-1 has an essential role in IL-21-induced cell growth signal transduction. Overexpression of Ape1/Ref-1 enhances IL-21-induced cell proliferation, but it is suppressed by overexpressing an N-terminal deletion mutant of Ape1/Ref-1 that lacks the redox domain. Furthermore, knockdown of the Ape1/Ref-1 mRNA dramatically compromises IL-21-induced ERK1/2 activation and cell proliferation with increasing cell death. These impaired activities are recovered by the re-expression of Ape1/Ref-1 in the knockdown cells. Our findings are the first demonstration that Ape1/Ref-1 is an indispensable molecule for the IL-21-mediated signal transduction through ERK1/2 activation.
A facile and efficient approach for pore-opening detection of anodic aluminum oxide membranes
Cui, Jiewu; Wu, Yucheng; Wang, Yan; Zheng, Hongmei; Xu, Guangqing; Zhang, Xinyi
2012-05-01
The well aligned porous anodic aluminum oxide (AAO) membrane is fabricated by a two-step anodization method. The oxide barrier layer of AAO membrane must be removed to get through-hole membrane for synthesizing nanowires and nanotubes of metals, semiconductors and conducting polymers. Removal of the barrier layer of oxide and pore-extending is of significant importance for the preparation of AAO membrane with through-hole pore morphology and desired pore diameter. The conventional method for pore opening is that AAO membrane after removing of aluminum substrate is immersed in chemical etching solution, which is completely empirical and results in catastrophic damage for AAO membrane frequently. A very simple and efficient approach based on capillary action for detecting pore opening of AAO membrane is introduced in this paper, this method can achieve the detection for pore opening visually and control the pore diameter precisely to get desired morphology and the pore diameter of AAO membrane. Two kinds of AAO membranes with different pore shape were obtained by different pore opening methods. In addition, one-dimensional gradient gold nanowires are also fabricated by electrodeposition based on AAO membranes.
2016-05-31
such processes. To advance a facile process technique for nanopatterned graphene (NPG), we have specifically utilized an anodic aluminum oxide ( AAO ...to this success was the thinness and uniformity of the AAO membrane that we fabricated. After the oxide template was placed on top of graphene, O 2...a) AAO template (top view), b) tilted view AAO membrane with nm thickness. c) Histogram of the AAO pore size with average pore size of 77.2 nm
Age at onset in Huntington's disease: replication study on the association of HAP1.
Karadima, Georgia; Dimovasili, Christina; Koutsis, Georgios; Vassilopoulos, Demetris; Panas, Marios
2012-11-01
In recent years two association studies investigating the HAP1 T441M (rs4523977) polymorphism as a potential modifying factor of the age at onset (AAO) of Huntington's disease (HD), have been reported. Initially evidence for association was found between the M441 risk allele and the AAO. Subsequently, a second study, although failing to replicate these findings, found evidence for association between the same risk allele and AAO of motor symptoms (mAAO). In the present study, the role of the HAP1 T441M polymorphism as a modifier of the AAO in HD was investigated in a cohort of 298 Greek HD patients. In this cohort the CAG repeat number accounted for 55% of the variance in AAO. No association was found between the HAP1 T441M polymorphism and the AAO of HD. © 2012 Elsevier Ltd. All rights reserved.
Petrochenko, Peter E; Kumar, Girish; Fu, Wujun; Zhang, Qin; Zheng, Jiwen; Liang, Chengdu; Goering, Peter L; Narayan, Roger J
2015-12-01
The surface topographies of nanoporous anodic aluminum oxide (AAO) and titanium dioxide (TiO2) membranes have been shown to modulate cell response in orthopedic and skin wound repair applications. In this study, we: (1) demonstrate an improved atomic layer deposition (ALD) method for coating the porous structures of 20, 100, and 200 nm pore diameter AAO with nanometer-thick layers of TiO2 and (2) evaluate the effects of uncoated AAO and TiO2-coated AAO on cellular responses. The TiO2 coatings were deposited on the AAO membranes without compromising the openings of the nanoscale pores. The 20 nm TiO2-coated membranes showed the highest amount of initial protein adsorption via the micro bicinchoninic acid (micro-BCA) assay; all of the TiO2-coated membranes showed slightly higher protein adsorption than the uncoated control materials. Cell viability, proliferation, and inflammatory responses on the TiO2-coated AAO membranes showed no adverse outcomes. For all of the tested surfaces, normal increases in proliferation (DNA content) of L929 fibroblasts were observed over from 4 hours to 72 hours. No increases in TNF-alpha production were seen in RAW 264.7 macrophages grown on TiO2-coated AAO membranes compared to uncoated AAO membranes and tissue culture polystyrene (TCPS) surfaces. Both uncoated AAO membranes and TiO2-coated AAO membranes showed no significant effects on cell growth and inflammatory responses. The results suggest that TiO2-coated AAO may serve as a reasonable prototype material for the development of nanostructured wound repair devices and orthopedic implants.
TERRA REF: Advancing phenomics with high resolution, open access sensor and genomics data
LeBauer, D.; Kooper, R.; Burnette, M.; Willis, C.
2017-12-01
Automated plant measurement has the potential to improve understanding of genetic and environmental controls on plant traits (phenotypes). The application of sensors and software in the automation of high throughput phenotyping reflects a fundamental shift from labor intensive hand measurements to drone, tractor, and robot mounted sensing platforms. These tools are expected to speed the rate of crop improvement by enabling plant breeders to more accurately select plants with improved yields, resource use efficiency, and stress tolerance. However, there are many challenges facing high throughput phenomics: sensors and platforms are expensive, currently there are few standard methods of data collection and storage, and the analysis of large data sets requires high performance computers and automated, reproducible computing pipelines. To overcome these obstacles and advance the science of high throughput phenomics, the TERRA Phenotyping Reference Platform (TERRA-REF) team is developing an open-access database of high resolution sensor data. TERRA REF is an integrated field and greenhouse phenotyping system that includes: a reference field scanner with fifteen sensors that can generate terrabytes of data each day at mm resolution; UAV, tractor, and fixed field sensing platforms; and an automated controlled-environment scanner. These platforms will enable investigation of diverse sensing modalities, and the investigation of traits under controlled and field environments. It is the goal of TERRA REF to lower the barrier to entry for academic and industry researchers by providing high-resolution data, open source software, and online computing resources. Our project is unique in that all data will be made fully public in November 2018, and is already available to early adopters through the beta-user program. We will describe the datasets and how to use them as well as the databases and computing pipeline and how these can be reused and remixed in other phenomics pipelines
Hao, Qi; Huang, Hao; Fan, Xingce; Hou, Xiangyu; Yin, Yin; Li, Wan; Si, Lifang; Nan, Haiyan; Wang, Huaiyu; Mei, Yongfeng; Qiu, Teng; Chu, Paul K.
2017-03-01
Ultra-thin anodic aluminum oxide (AAO) membranes are efficient templates for the fabrication of patterned nanostructures. Herein, a three-step etching method to control the morphology of AAO is described. The morphological evolution of the AAO during phosphoric acid etching is systematically investigated and a nonlinear growth mechanism during unsteady-state anodization is revealed. The thickness of the AAO can be quantitatively controlled from ˜100 nm to several micrometers while maintaining the tunablity of the pore diameter. The AAO membranes are robust and readily transferable to different types of substrates to prepare patterned plasmonic nanoarrays such as nanoislands, nanoclusters, ultra-small nanodots, and core-satellite superstructures. The localized surface plasmon resonance from these nanostructures can be easily tuned by adjusting the morphology of the AAO template. The custom AAO template provides a platform for the fabrication of low-cost and large-scale functional nanoarrays suitable for fundamental studies as well as applications including biochemical sensing, imaging, photocatalysis, and photovoltaics.
Xiong, Guang; Elam, Jeffrey W; Feng, Hao; Han, Catherine Y; Wang, Hsien-Hau; Iton, Lennox E; Curtiss, Larry A; Pellin, Michael J; Kung, Mayfair; Kung, Harold; Stair, Peter C
2005-07-28
Anodic aluminum oxide (AAO) membranes were characterized by UV Raman and FT-IR spectroscopies before and after coating the entire surface (including the interior pore walls) of the AAO membranes by atomic layer deposition (ALD). UV Raman reveals the presence of aluminum oxalate in bulk AAO, both before and after ALD coating with Al2O3, because of acid anion incorporation during the anodization process used to produce AAO membranes. The aluminum oxalate in AAO exhibits remarkable thermal stability, not totally decomposing in air until exposed to a temperature >900 degrees C. ALD was used to cover the surface of AAO with either Al2O3 or TiO2. Uncoated AAO have FT-IR spectra with two separate types of OH stretches that can be assigned to isolated OH groups and hydrogen-bonded surface OH groups, respectively. In contrast, AAO surfaces coated by ALD with Al2O3 display a single, broad band of hydrogen-bonded OH groups. AAO substrates coated with TiO2 show a more complicated behavior. UV Raman results show that very thin TiO2 coatings (1 nm) are not stable upon annealing to 500 degrees C. In contrast, thicker coatings can totally cover the contaminated alumina surface and are stable at temperatures in excess of 500 degrees C.
International Nuclear Information System (INIS)
Kukkola, Jarmo; Rautio, Aatto; Sala, Giovanni; Pino, Flavio; Toth, Geza; Leino, Anne-Riikka; Maeklin, Jani; Jantunen, Heli; Uusimaeki, Antti; Kordas, Krisztian; Gracia, Eduardo; Terrones, Mauricio; Shchukarev, Andrey; Mikkola, Jyri-Pekka
2010-01-01
Aluminum foils were anodized in sulfuric acid solution to form thick porous anodic aluminum oxide (AAO) films of thickness ∼6 μm. Electrodes of carboxyl-functionalized single-wall carbon nanotube (SWCNT) thin films were inkjet printed on the anodic oxide layer and the electrical characteristics of the as-obtained SWCNT-AAO-Al structures were studied. Nonlinear current-voltage transport and strong temperature dependence of conduction through the structure was measured. The microstructure and chemical composition of the anodic oxide layer was analyzed using transmission and scanning electron microscopy as well as x-ray photoelectron spectroscopy. Schottky emission at the SWCNT-AAO and AAO-Al interfaces allowed by impurity states in the anodic aluminum oxide film together with ionic surface conduction on the pore walls of AAO gives a reasonable explanation for the measured electrical conduction. Calcined AAO is proposed as a dielectric material for SWCNT-field effect transistors.
International Nuclear Information System (INIS)
Lo, Pei-Hsuan; Lee, Chih-Chun; Fang, Weileun; Luo, Guo-Lun
2015-01-01
This study presents the approach to implement the electrostatically-controlled thin film optical filter by using a nanoporous anodic aluminum oxide (np-AAO) layer as the key suspended micro structure. The bi-stable optical filter operates in the visible spectral range. In this work, the presented bi-stable optical filter has averaged reflectivity of 60%, and the central wavelengths are 580 and 690 nm respectively for on and off states. The presented np-AAO layer offers the following merits for the thin film optical filter: (1) material properties of np-AAO film, such as refractive index, elastic modulus and dielectric constant, can be easily changed by a low temperature pore-widening process, (2) in-use stiction of the suspended np-AAO structure can be reduced by the small contact area of nanoporous textures, (3) driving (pull-in) voltage can be reduced due to a large dielectric constant (ε AAO is 7.05) and small stiffness of np-AAO film and (4) dielectric charging can be reduced by the np-AAO material; thus the offset voltage is small. The study reports the design, fabrication and experimental results of the bi-stable optical filter to demonstrate the advantages of the presented device. The np-AAO material also has the potential for applications of other electrostatic drive micro devices. (paper)
Growth control of carbon nanotubes using by anodic aluminum oxide nano templates.
Park, Yong Seob; Choi, Won Seek; Yi, Junsin; Lee, Jaehyeong
2014-05-01
Anodic Aluminum Oxide (AAO) template prepared in acid electrolyte possess regular and highly anisotropic porous structure with pore diameter range from five to several hundred nanometers, and with a density of pores ranging from 10(9) to 10(11) cm(-2). AAO can be used as microfilters and templates for the growth of CNTs and metal or semiconductor nanowires. Varying anodizing conditions such as temperature, electrolyte, applied voltage, anodizing and widening time, one can control the diameter, the length, and the density of pores. In this work, we deposited Al thin film by radio frequency magnetron sputtering method to fabricate AAO nano template and synthesized multi-well carbon nanotubes on a glass substrate by microwave plasma-enhanced chemical vapor deposition (MPECVD). AAO nano-porous templates with various pore sizes and depths were introduced to control the dimension and density of CNT arrays. The AAO nano template was synthesize on glass by two-step anodization technique. The average diameter and interpore distance of AAO nano template are about 65 nm and 82 nm. The pore density and AAO nano template thickness are about 2.1 x 10(10) pores/cm2 and 1 microm, respectively. Aligned CNTs on the AAO nano template were synthesized by MPECVD at 650 degrees C with the Ni catalyst layer. The length and diameter of CNTs were grown 2 microm and 50 nm, respectively.
The Seamount Catalog in EarthRef.org
Gotberg, N. K.; Koppers, A. A.; Staudigel, H.; Perez, J.
2004-12-01
Seamounts are important to research and education in many scientific fields, providing a wide range of data on physical, chemical, biological and geological processes. In order to make a diverse set of seamount data accessible we have developed the Seamount Catalog in EarthRef.org, available through the http://earthref.org/databases/SC/. The primary goal of the Seamount Catalog is to provide access to digital data files on a large assortment of interdisciplinary seamount research. The catalog can be searched at a variety of ability or expert levels allowing it to be used from basic education to advanced research. Each seamount is described in terms of its location, height, volume, elongation, azimuth, irregularity, rifts, morphological classification and relation to other features. GEBCO (General Bathymetric Chart of the Ocean) gazetteer data (2002; 2003) is included in the database in order to provide information on the history, discovery and names of the seamounts. Screen-optimized bathymetry maps, grid files and the original multibeam data files are available for online viewing with higher resolution downloadable versions (AI, PS, PDF) also offered. The data files for each seamount include a map made from the multibeam data only, a map made from Smith and Sandwell's (1996) predicted bathymetry, a merged map incorporating both data sets, and a map showing the differences between the two data sets. We are working towards expanding the Seamount Catalog by integrating bathymetry data from various sources, developing and linking disciplinary reference models, and integrating information from multiple disciplines and from the literature. We hope to create a data integrative environment that provides access to seamount data and the tools needed for working with that data.
Fan, Jiangxia; Zhu, Xinxin; Wang, Kunzhou; Chen, Xiaoyuan; Wang, Xinqing; Yan, Minhao; Ren, Yong
2018-05-01
We have fabricated highly ordered anodized aluminum oxide (AAO) membranes with different diameter through improved hard anodization (HA) at high temperature. This process can generate thick AAO membranes (30 μm) in a short anodizing time with high growth rate 20-60 μm h-1 which is much faster than that in traditional mild two-step anodization. We enlarged the AAO pore diameter by adjusting the voltage rise rate at the same time, which has a great influence on current density and temperature. The AAO pore diameter varies from 60-110 nm to 160-190 nm. The pore diameter (Dp) of the AAO prepared by this improved process is much larger than that prepared by HA (40-60 nm) when H2C2O4 as electrolyte. It can expand potential use of the AAO membranes such as for the template-based synthesis of nanowires or nanotubes with modulated diameters and also for practical separation technology. We also has used the AAO with different diameters prepared by this improved HA to fabricate Co nanowires and γ-Fe2O3 superparamagnetic nanorods.
Feng, Xunda; Mei, Shilin; Jin, Zhaoxia
2011-12-06
We apply the concept of wettability transition to manipulate the morphology and entrapment of polymer nanostructures inside cylindrical nanopores of anodic aluminum oxide (AAO) membranes. When AAO/polystyrene (PS) hybrids, i.e., AAO/PS nanorods or AAO/PS nanotubes, are immersed into a polyethylene glycol (PEG) reservoir above the glass transition temperature of PS, a wettability transition from wetting to nonwetting of PS can be triggered due to the invasion of the more wettable PEG melt. The wettability transition enables us to develop a nondestructive method to entrap hemispherically capped nanorods inside nanopores. Moreover, we can obtain single nanorods with the desired aspect ratio by further dissolving the AAO template, in contrast to the drawbacks of nonuniformity or destructiveness from the conventional ultrasonication method. In the case of AAO/PS nanotubes, the wettability transition induced dewetting of PS nanotube walls results in the disconnection and entrapment of nonwetting PS domains (i.e., nanospheres, nanocapsules, or capped nanorods). Moreover, PEG is then washed to recover the pristine wettability of PS on the alumina surface; further annealing of the PS nanospheres inside AAO nanopores under vacuum can generate some unique nanostructures, particularly semicylindrical nanorods. © 2011 American Chemical Society
Arctic and Antarctic Oscillation signatures in tropical coral proxies over the South China Sea
Directory of Open Access Journals (Sweden)
D.-Y. Gong
2009-05-01
Full Text Available Arctic Oscillation (AO and Antarctic Oscillation (AAO are the leading modes of atmospheric circulation in mid-high latitudes. Previous studies have revealed that the climatic influences of the two modes are dominant in extra-tropical regions. This study finds that AO and AAO signals are also well recorded in coral proxies in the tropical South China Sea. There are significant interannual signals of AO and AAO in the strontium (Sr content, which represents the sea surface temperature (SST. Among all the seasons, the most significant correlation occurs during winter in both hemispheres: the strongest AO-Sr and AAO-Sr coral correlations occur in January and August, respectively. This study also determined that the Sr content lags behind AO and AAO by 1–3 months. Large-scale anomalies in sea level pressure and horizontal wind at 850 hPa level support the strength of AO/AAO-coral teleconnections. In addition, a comparison with oxygen isotope records from two coral sites in neighboring oceans yields significant AO and AAO signatures with similar time lags. These results help to better understand monsoon climates and their teleconnection to high-latitude climate changes.
DEFF Research Database (Denmark)
Rytter, Hana Malá; Mogensen, Jesper
The REF (Reorganization of Elementary Functions) model suggests mechanisms of posttraumatic reorganization, and resolves the contradiction between localization and functional recovery. In the process of developing this model, we have reconceptualised the term ‘function’ and introduced a concept...... across situations and cognitive domains. Since novel ASs are created and selected according to situation dependent feedback mechanisms, dissimilar external conditions may call for different ASs. Consequently, therapeutically established ASs may not be adequate in the settings of daily life. Additionally......, upon the loss of a particular brain structure, the structure and networks mediating recovery will not be identical in case of different cognitive and situational demands. Therapeutically, an important implication is that rehabilitative training should include as naturalistic settings as possible....
Reconstruction and validation of RefRec: a global model for the yeast molecular interaction network.
Directory of Open Access Journals (Sweden)
Tommi Aho
2010-05-01
Full Text Available Molecular interaction networks establish all cell biological processes. The networks are under intensive research that is facilitated by new high-throughput measurement techniques for the detection, quantification, and characterization of molecules and their physical interactions. For the common model organism yeast Saccharomyces cerevisiae, public databases store a significant part of the accumulated information and, on the way to better understanding of the cellular processes, there is a need to integrate this information into a consistent reconstruction of the molecular interaction network. This work presents and validates RefRec, the most comprehensive molecular interaction network reconstruction currently available for yeast. The reconstruction integrates protein synthesis pathways, a metabolic network, and a protein-protein interaction network from major biological databases. The core of the reconstruction is based on a reference object approach in which genes, transcripts, and proteins are identified using their primary sequences. This enables their unambiguous identification and non-redundant integration. The obtained total number of different molecular species and their connecting interactions is approximately 67,000. In order to demonstrate the capacity of RefRec for functional predictions, it was used for simulating the gene knockout damage propagation in the molecular interaction network in approximately 590,000 experimentally validated mutant strains. Based on the simulation results, a statistical classifier was subsequently able to correctly predict the viability of most of the strains. The results also showed that the usage of different types of molecular species in the reconstruction is important for accurate phenotype prediction. In general, the findings demonstrate the benefits of global reconstructions of molecular interaction networks. With all the molecular species and their physical interactions explicitly modeled, our
The Integration of Nanoscale Techniques for an Improved Battery Technology
2012-06-08
anodized aluminum oxide ( AAO ) membranes that were 13...nanoporous anodized aluminum oxide ( AAO ) substrate [13]. During sputtering, thickened columnar growths form around the pores of the substrate...investigates an interpenetrating network structure where ―tubes‖ of polymer electrolyte are placed in the nanopores of anodic aluminum oxide ( AAO
Decelle, Johan; Romac, Sarah; Stern, Rowena F; Bendif, El Mahdi; Zingone, Adriana; Audic, Stéphane; Guiry, Michael D; Guillou, Laure; Tessier, Désiré; Le Gall, Florence; Gourvil, Priscillia; Dos Santos, Adriana L; Probert, Ian; Vaulot, Daniel; de Vargas, Colomban; Christen, Richard
2015-11-01
Photosynthetic eukaryotes have a critical role as the main producers in most ecosystems of the biosphere. The ongoing environmental metabarcoding revolution opens the perspective for holistic ecosystems biological studies of these organisms, in particular the unicellular microalgae that often lack distinctive morphological characters and have complex life cycles. To interpret environmental sequences, metabarcoding necessarily relies on taxonomically curated databases containing reference sequences of the targeted gene (or barcode) from identified organisms. To date, no such reference framework exists for photosynthetic eukaryotes. In this study, we built the PhytoREF database that contains 6490 plastidial 16S rDNA reference sequences that originate from a large diversity of eukaryotes representing all known major photosynthetic lineages. We compiled 3333 amplicon sequences available from public databases and 879 sequences extracted from plastidial genomes, and generated 411 novel sequences from cultured marine microalgal strains belonging to different eukaryotic lineages. A total of 1867 environmental Sanger 16S rDNA sequences were also included in the database. Stringent quality filtering and a phylogeny-based taxonomic classification were applied for each 16S rDNA sequence. The database mainly focuses on marine microalgae, but sequences from land plants (representing half of the PhytoREF sequences) and freshwater taxa were also included to broaden the applicability of PhytoREF to different aquatic and terrestrial habitats. PhytoREF, accessible via a web interface (http://phytoref.fr), is a new resource in molecular ecology to foster the discovery, assessment and monitoring of the diversity of photosynthetic eukaryotes using high-throughput sequencing. © 2015 John Wiley & Sons Ltd.
Lindahl, Erik; Azuara, Cyril; Koehl, Patrice; Delarue, Marc
2006-07-01
Normal mode analysis (NMA) is an efficient way to study collective motions in biomolecules that bypasses the computational costs and many limitations associated with full dynamics simulations. The NOMAD-Ref web server presented here provides tools for online calculation of the normal modes of large molecules (up to 100,000 atoms) maintaining a full all-atom representation of their structures, as well as access to a number of programs that utilize these collective motions for deformation and refinement of biomolecular structures. Applications include the generation of sets of decoys with correct stereochemistry but arbitrary large amplitude movements, the quantification of the overlap between alternative conformations of a molecule, refinement of structures against experimental data, such as X-ray diffraction structure factors or Cryo-EM maps and optimization of docked complexes by modeling receptor/ligand flexibility through normal mode motions. The server can be accessed at the URL http://lorentz.immstr.pasteur.fr/nomad-ref.php.
Data Flow for the TERRA-REF project
Kooper, R.; Burnette, M.; Maloney, J.; LeBauer, D.
2017-12-01
The Transportation Energy Resources from Renewable Agriculture Phenotyping Reference Platform (TERRA-REF) program aims to identify crop traits that are best suited to producing high-energy sustainable biofuels and match those plant characteristics to their genes to speed the plant breeding process. One tool used to achieve this goal is a high-throughput phenotyping robot outfitted with sensors and cameras to monitor the growth of 1.25 acres of sorghum. Data types range from hyperspectral imaging to 3D reconstructions and thermal profiles, all at 1mm resolution. This system produces thousands of daily measurements with high spatiotemporal resolution. The team at NCSA processes, annotates, organizes and stores the massive amounts of data produced by this system - up to 5 TB per day. Data from the sensors is streamed to a local gantry-cache server. The standardized sensor raw data stream is automatically and securely delivered to NCSA using Globus Connect service. Once files have been successfully received by the Globus endpoint, the files are removed from the gantry-cache server. As each dataset arrives or is created the Clowder system automatically triggers different software tools to analyze each file, extract information, and convert files to a common format. Other tools can be triggered to run after all required data is uploaded. For example, a stitched image of the entire field is created after all images of the field become available. Some of these tools were developed by external collaborators based on predictive models and algorithms, others were developed as part of other projects and could be leveraged by the TERRA project. Data will be stored for the lifetime of the project and is estimated to reach 10 PB over 3 years. The Clowder system, BETY and other systems will allow users to easily find data by browsing or searching the extracted information.
Readability of Orthopedic Trauma Patient Education Materials on the Internet.
Mohan, Rohith; Yi, Paul H; Morshed, Saam
In this study, we used the Flesch-Kincaid Readability Scale to determine the readability levels of orthopedic trauma patient education materials on the American Academy of Orthopaedic Surgeons (AAOS) website and to examine how subspecialty coauthorship affects readability level. Included articles from the AAOS online patient education library and the AAOS OrthoPortal website were categorized as trauma or broken bones and injuries on the AAOS online library or were screened by study authors for relevance to orthopedic trauma. Subsequently, the Flesch-Kincaid scale was used to determine each article's readability level, which was reported as a grade level. Subspecialty coauthorship was noted for each article. A total of 115 articles from the AAOS website were included in the study and reviewed. Mean reading level was grade 9.1 for all articles reviewed. Nineteen articles (16.5%) were found to be at or below the eighth-grade level, and only 1 article was at or below the sixth-grade level. In addition, there was no statistically significant difference between articles coauthored by the various orthopedic subspecialties and those authored exclusively by AAOS. Orthopedic trauma readability materials on the AAOS website appear to be written at a reading comprehension level too high for the average patient to understand.
Xue, Maoqiang; Ling, Yisheng; Wu, Guisen; Liu, Xin; Ge, Dongtao; Shi, Wei
2013-01-01
Microporous anodic aluminum oxide (AAO) membranes were modified by 3-glycidoxypropyltrimethoxysilane to produce terminal epoxy groups. These were used to covalently link hydroxyethyl celluloses (HEC) to amplify reactive groups of AAO membrane. The hydroxyl groups of HEC-AAO composite membrane were further modified with 1,4-butanediol diglycidyl ether to link arginine as an affinity ligand. The contents of HEC and arginine of arginine-immobilized HEC-AAO membrane were 52.1 and 19.7mg/g membrane, respectively. As biomedical adsorbents, the arginine-immobilized HEC-AAO membranes were tested for bilirubin removal. The non-specific bilirubin adsorption on the unmodified HEC-AAO composite membranes was 0.8mg/g membrane. Higher bilirubin adsorption values, up to 52.6mg/g membrane, were obtained with the arginine-immobilized HEC-AAO membranes. Elution of bilirubin showed desorption ratio was up to 85% using 0.3M NaSCN solution as the desorption agent. Comparisons equilibrium and dynamic capacities showed that dynamic capacities were lower than the equilibrium capacities. In addition, the adsorption mechanism of bilirubin and the effects of temperature, initial concentration of bilirubin, albumin concentration and ionic strength on adsorption were also investigated. Copyright © 2012 Elsevier B.V. All rights reserved.
2013-04-04
... Leather Tanning TTTT X X & Finishing. 67 Cellulose UUUU X X Ethers Prod. Misc. Viscose Processes. 68 Boat... Leather-Finishing Operations... X UUUU Cellulose Products X VVVV Boat Manufacturing X WWWW Reinforced...
REVIEWS OF BOOKS : BOEKRESE SIES 969
African Journals Online (AJOL)
Glaucoma. Surgery. Therapy. MisceLlaneou . The Ear. Vestibular Function and Vertigo. Hearing .... The book will appeal to biochemists and physical chemists alike and will do .... and appendicitis to the bugbear of geriatrics-bedsores. Helpful.
Leong, Sze Ying; Oey, Indrawati
2014-03-01
The objective of this research was to study the enzyme kinetics and thermostability of endogenous ascorbic acid oxidase (AAO) in carrot purée (Daucus carota cv. Nantes) after being treated with pulsed electric field (PEF) processing. Various PEF treatments using electric field strength between 0.2 and 1.2kV/cm and pulsed electrical energy between 1 and 520kJ/kg were conducted. The enzyme kinetics and the kinetics of AAO thermal inactivation (55-70°C) were described using Michaelis-Menten model and first order reaction model, respectively. Overall, the estimated Vmax and KM values were situated in the same order of magnitude as the untreated carrot purée after being exposed to pulsed electrical energy between 1 and 400kJ/kg, but slightly changed at pulsed electrical energy above 500kJ/kg. However, AAO presented different thermostability depending on the electric field strength applied. After PEF treatment at the electric field strength between 0.2 and 0.5kV/cm, AAO became thermolabile (i.e. increase in inactivation rate (k value) at reference temperature) but the temperature dependence of k value (Ea value) for AAO inactivation in carrot purée decreased, indicating that the changes in k values were less temperature dependent. It is obvious that PEF treatment affects the temperature stability of endogenous AAO. The changes in enzyme kinetics and thermostability of AAO in carrot purée could be related to the resulting carrot purée composition, alteration in intracellular environment and the effective concentration of AAO released after being subjected to PEF treatment. Copyright © 2013 Elsevier Ltd. All rights reserved.
Yeom, Se-Hyuk; Kim, Ok-Geun; Kang, Byoung-Ho; Kim, Kyu-Jin; Yuan, Heng; Kwon, Dae-Hyuk; Kim, Hak-Rin; Kang, Shin-Won
2011-11-07
We propose a design for a highly sensitive biosensor based on nanostructured anodized aluminum oxide (AAO) substrates. A gold-deposited AAO substrate exhibits both optical interference and localized surface plasmon resonance (LSPR). In our sensor, application of these disparate optical properties overcomes problems of limited sensitivity, selectivity, and dynamic range seen in similar biosensors. We fabricated uniform periodic nanopore lattice AAO templates by two-step anodizing and assessed their suitability for application in biosensors by characterizing the change in optical response on addition of biomolecules to the AAO template. To determine the suitability of such structures for biosensing applications, we immobilized a layer of C-reactive protein (CRP) antibody on a gold coating atop an AAO template. We then applied a CRP antigen (Ag) atop the immobilized antibody (Ab) layer. The shift in reflectance is interpreted as being caused by the change in refractive index with membrane thickness. Our results confirm that our proposed AAO-based biosensor is highly selective toward detection of CRP antigen, and can measure a change in CRP antigen concentration of 1 fg/ml. This method can provide a simple, fast, and sensitive analysis for protein detection in real-time.
Nanoporous Pirani sensor based on anodic aluminum oxide
Jeon, Gwang-Jae; Kim, Woo Young; Shim, Hyun Bin; Lee, Hee Chul
2016-09-01
A nanoporous Pirani sensor based on anodic aluminum oxide (AAO) is proposed, and the quantitative relationship between the performance of the sensor and the porosity of the AAO membrane is characterized with a theoretical model. The proposed Pirani sensor is composed of a metallic resistor on a suspended nanoporous membrane, which simultaneously serves as the sensing area and the supporting structure. The AAO membrane has numerous vertically-tufted nanopores, resulting in a lower measurable pressure limit due to both the increased effective sensing area and the decreased effective thermal loss through the supporting structure. Additionally, the suspended AAO membrane structure, with its outer periphery anchored to the substrate, known as a closed-type design, is demonstrated using nanopores of AAO as an etch hole without a bulk micromachining process used on the substrate. In a CMOS-compatible process, a 200 μm × 200 μm nanoporous Pirani sensor with porosity of 25% was capable of measuring the pressure from 0.1 mTorr to 760 Torr. With adjustment of the porosity of the AAO, the measurable range could be extended toward lower pressures of more than one decade compared to a non-porous membrane with an identical footprint.
Chen, Shih-Yung; Chang, Hsuan-Hao; Lai, Ming-Yu; Liu, Chih-Yi; Wang, Yuh-Lin
2011-09-01
Porous anodic aluminum oxide (AAO) membranes have been widely used as templates for growing nanomaterials because of their ordered nanochannel arrays with high aspect ratio and uniform pore diameter. However, the intrinsic growth behavior of an individual AAO nanochannel has never been carefully studied for the lack of a means to fabricate a single isolated anodic alumina nanochannel (SIAAN). In this study, we develop a lithographic method for fabricating a SIAAN, which grows into a porous hemispherical structure with its pores exhibiting fascinating morphological evolution during anodization. We also discover that the mechanical stress affects the growth rate and pore morphology of AAO porous structures. This study helps reveal the growth mechanism of arrayed AAO nanochannels grown on a flat aluminum surface and provides insights to help pave the way to altering the geometry of nanochannels on AAO templates for the fabrication of advanced nanocomposite materials.
International Nuclear Information System (INIS)
Chen, Shih-Yung; Wang, Yuh-Lin; Chang, Hsuan-Hao; Lai, Ming-Yu; Liu, Chih-Yi
2011-01-01
Porous anodic aluminum oxide (AAO) membranes have been widely used as templates for growing nanomaterials because of their ordered nanochannel arrays with high aspect ratio and uniform pore diameter. However, the intrinsic growth behavior of an individual AAO nanochannel has never been carefully studied for the lack of a means to fabricate a single isolated anodic alumina nanochannel (SIAAN). In this study, we develop a lithographic method for fabricating a SIAAN, which grows into a porous hemispherical structure with its pores exhibiting fascinating morphological evolution during anodization. We also discover that the mechanical stress affects the growth rate and pore morphology of AAO porous structures. This study helps reveal the growth mechanism of arrayed AAO nanochannels grown on a flat aluminum surface and provides insights to help pave the way to altering the geometry of nanochannels on AAO templates for the fabrication of advanced nanocomposite materials.
Controlling the anodizing conditions in preparation of an nanoporous anodic aluminium oxide template
Nazemi, Azadeh; Abolfazl, Seyed; Sadjadi, Seyed
2014-12-01
Porous anodic aluminium oxide (AAO) template is commonly used in the synthesis of one-dimensional nanostructures, such as nanowires and nanorods, due to its simple fabrication process. Controlling the anodizing conditions is important because of their direct influence on the size of AAO template pores; it affects the size of nanostructures that are fabricated in AAO template. In present study, several alumina templates were fabricated by a two-step electrochemical anodization in different conditions, such as the time of first process, its voltage, and electrolyte concentration. The effect of these factors on pore diameters of AAO templates was investigated using scanning electron microscopy (SEM).
Contact angle studies on anodic porous alumina.
Redón, Rocío; Vázquez-Olmos, A; Mata-Zamora, M E; Ordóñez-Medrano, A; Rivera-Torres, F; Saniger, J M
2005-07-15
The preparation of nanostructures using porous anodic aluminum oxide (AAO) as templates involves the introduction of dissolved materials into the pores of the membranes; one way to determine which materials are preferred to fill the pores involves the measurement of the contact angles (theta) of different solvents or test liquids on the AAOs. Thus, we present measurements of contact angles of nine solvents on four different AAO sheets by tensiometric and goniometric methods. From the solvents tested, we found dimethyl sulfoxide (DMSO) and N,N(')-dimethylformamide (DMF) to interact with the AAOs, the polarity of the solvents and the surfaces being the driving force.
Energy Technology Data Exchange (ETDEWEB)
Vaish, Amit, E-mail: anv@udel.edu; Krueger, Susan; Dimitriou, Michael; Majkrzak, Charles [National Institute of Standards and Technology (NIST) Center for Neutron Research, Gaithersburg, MD 20899-8313 (United States); Vanderah, David J. [Institute for Bioscience and Biotechnology Research, NIST, Rockville, Maryland 20850 (United States); Chen, Lei, E-mail: lei.chen@nist.gov [NIST Center for Nanoscale Science and Technology, Gaithersburg, Maryland 20899-8313 (United States); Gawrisch, Klaus [Laboratory of Membrane Biochemistry and Biophysics, National Institute on Alcohol Abuse and Alcoholism, National Institutes of Health, Bethesda, Maryland 20892 (United States)
2015-01-15
Nanoporous platinum membranes can be straightforwardly fabricated by forming a Pt coating inside the nanopores of anodic alumina membranes (AAO) using atomic layer deposition (ALD). However, the high-aspect-ratio of AAO makes Pt ALD very challenging. By tuning the process deposition temperature and precursor exposure time, enhanced infiltration depth along with conformal coating was achieved for Pt ALD inside the AAO templates. Cross-sectional scanning electron microscopy/energy dispersive x-ray spectroscopy and small angle neutron scattering were employed to analyze the Pt coverage and thickness inside the AAO nanopores. Additionally, one application of platinum-coated membrane was demonstrated by creating a high-density protein-functionalized interface.
Fabrication of diameter-modulated and ultrathin porous nanowires in anodic aluminum oxide templates
Energy Technology Data Exchange (ETDEWEB)
Sulka, Grzegorz D., E-mail: Sulka@chemia.uj.edu.pl [Max Planck Institute of Microstructure Physics, Weinberg 2, 06120 Halle (Germany); Department of Physical Chemistry and Electrochemistry, Jagiellonian University, Ingardena 3, 30060 Krakow (Poland); Brzozka, Agnieszka [AGH University of Science and Technology, Faculty of Non-Ferrous Metals, Al. Mickiewicza 30, Krakow 30-059 (Poland); Liu, Lifeng [Max Planck Institute of Microstructure Physics, Weinberg 2, 06120 Halle (Germany)
2011-05-30
Graphical abstract: Display Omitted Highlights: > AAO templates with modulated pore diameter were fabricated by pulse anodization. > HA pulse duration tunes the shape of pores and the structure of AAO channels. > Au, Ag, Ni and Ag-Au diameter-modulated nanowires were synthetized. > Porous ultrathin Au nanowires were obtained by dealloying Ag-Au nanowires. - Abstract: Anodic aluminum oxide (AAO) membranes with modulated pore diameter were synthesized by pulse anodization in 0.3 M sulfuric acid at 1 deg. C. For AAO growth, a typical combination of alternating mild anodizing (MA) and hard anodizing (HA) pulses with applied potential pulses of 25 V and 35 V was applied. The control of the duration of HA pulses will provide an interesting way to tune the shape of pores and the structure of AAO channels. It was found that a non-uniform length of HA segments in cross section of AAO is usually observed when the HA pulse duration is shorter than 1.2 s. The pulse anodization performed with longer HA pulses leads to the formation of AAO templates with periodically modulated pore diameter and nearly uniform length of segments. Various diameter-modulated metallic nanowires (Au, Ag, Ni and Ag-Au) were fabricated by electrodeposition in the pores of anodic alumina membranes. A typical average nanowire diameter was about 30 nm and 48 nm for MA and HA nanowire segments, respectively. After a successful dealloying silver from Ag-Au nanowires, porous ultrathin Au nanowires were obtained.
Fabrication of diameter-modulated and ultrathin porous nanowires in anodic aluminum oxide templates
International Nuclear Information System (INIS)
Sulka, Grzegorz D.; Brzozka, Agnieszka; Liu, Lifeng
2011-01-01
Graphical abstract: Display Omitted Highlights: → AAO templates with modulated pore diameter were fabricated by pulse anodization. → HA pulse duration tunes the shape of pores and the structure of AAO channels. → Au, Ag, Ni and Ag-Au diameter-modulated nanowires were synthetized. → Porous ultrathin Au nanowires were obtained by dealloying Ag-Au nanowires. - Abstract: Anodic aluminum oxide (AAO) membranes with modulated pore diameter were synthesized by pulse anodization in 0.3 M sulfuric acid at 1 deg. C. For AAO growth, a typical combination of alternating mild anodizing (MA) and hard anodizing (HA) pulses with applied potential pulses of 25 V and 35 V was applied. The control of the duration of HA pulses will provide an interesting way to tune the shape of pores and the structure of AAO channels. It was found that a non-uniform length of HA segments in cross section of AAO is usually observed when the HA pulse duration is shorter than 1.2 s. The pulse anodization performed with longer HA pulses leads to the formation of AAO templates with periodically modulated pore diameter and nearly uniform length of segments. Various diameter-modulated metallic nanowires (Au, Ag, Ni and Ag-Au) were fabricated by electrodeposition in the pores of anodic alumina membranes. A typical average nanowire diameter was about 30 nm and 48 nm for MA and HA nanowire segments, respectively. After a successful dealloying silver from Ag-Au nanowires, porous ultrathin Au nanowires were obtained.
Directory of Open Access Journals (Sweden)
Jens H. Kuhn
2014-09-01
Full Text Available Sequence determination of complete or coding-complete genomes of viruses is becoming common practice for supporting the work of epidemiologists, ecologists, virologists, and taxonomists. Sequencing duration and costs are rapidly decreasing, sequencing hardware is under modification for use by non-experts, and software is constantly being improved to simplify sequence data management and analysis. Thus, analysis of virus disease outbreaks on the molecular level is now feasible, including characterization of the evolution of individual virus populations in single patients over time. The increasing accumulation of sequencing data creates a management problem for the curators of commonly used sequence databases and an entry retrieval problem for end users. Therefore, utilizing the data to their fullest potential will require setting nomenclature and annotation standards for virus isolates and associated genomic sequences. The National Center for Biotechnology Information’s (NCBI’s RefSeq is a non-redundant, curated database for reference (or type nucleotide sequence records that supplies source data to numerous other databases. Building on recently proposed templates for filovirus variant naming [
Pore diameter control of anodic aluminum oxide with ordered array of nanopores
Energy Technology Data Exchange (ETDEWEB)
Bai, Allen; Yang, Yong-Feng [Department of Chemical Engineering, National Tsing Hua University, Hsin-Chu, 30013 (China); Hu, Chi-Chang [Department of Chemical Engineering, National Tsing Hua University, Hsin-Chu 401 (China); Department of Chemical Engineering, National Chung Cheng University, Chia-Yi 621 (China); Lin, Chi-Cheng [Department of Chemical Engineering, National Chung Cheng University, Chia-Yi 621 (China)
2008-01-01
Highly uniform, self-ordered anodic aluminum oxide (AAO) with an ordered nanoporous array can be effectively formed from industrially pure (99.5%) aluminum sheets through an anodizing program in a mixture solution of sulfuric and oxalic acids. The influences of anodizing variables, such as applied voltage, solution temperature, oxalic acid concentration, agitation rate, and sulfuric acid concentration, on the average pore diameter of AAO were systematically investigated using fractional factorial design (FFD). The applied voltage, and sulfuric acid concentration were found to be the key factors affecting the pore diameter of AAO films in the FFD study. The pore diameter of AAO is regularly increased from ca. 50 to 150 nm when the applied voltage and the concentration of sulfuric acid are gradually increased from 53 to 80 V and from 3.5 to 8 M, respectively. Fine tuning of the pore diameter for AAO films with an ordered, nanoporous, arrayed structure from industrially pure aluminum sheets can be achieved. (author)
Research progress in formation mechanism of anodizing aluminum oxide
Lv, Yudong
2017-12-01
The self-ordering porous anodizing aluminum oxide (AAO) has attracted much attention because of its potential value of application. Valve metals (Al, Ti, Zr etc.) anodic studies have been conducted for more than 80 years, but the mechanism of the formation of hexagonal prismatic cell structure has so far been different. In this paper, the research results of AAO film formation mechanism are reviewed, and the growth models of several AAO films are summarized, including the field-assisted dissolution (FAD), the viscous flow model, the critical current density effect model, the bulk expansion stress model and the steady-state pore growth model and so on. It analyzed the principle of each model and its rationality. This paper will be of great help to reveal the nature of pore formation and self-ordering, and with the hope that through the study of AAO film formation mechanism, the specific effects of various oxidation parameters on AAO film morphology can be obtained.
Enhancing gas sensing properties of graphene by using a nanoporous substrate
International Nuclear Information System (INIS)
Yang, Cheol-Soo; Park, Serin; Choi, Won Jin; Lee, Jeong-O; Mahmood, Ather; Doudin, Bernard; Kim, Bongseock; Shin, Kyusoon; Jeon, Do Hyun; Han, Jin Kyu; Bu, Sang Don
2016-01-01
Substrate engineering is shown to be a viable approach for improving the use of graphene thin films for gas sensor applications. The performance of two-terminal devices fabricated on smooth SiO 2 and nanoporous anodized aluminum oxide (AAO) substrates are compared. Raman studies indicated that both types of samples exhibit similarly low point-defect densities, but the mobility values of the SiO 2 -supported films were found to be three times larger than those on porous AAO substrates. However, the AAO-supported graphene devices exhibit a 3-fold enhanced sensitivity to both NO 2 and NH 3 gases when compared to the devices supported on SiO 2 . We attribute this sensitivity enhancement to the inhomogeneous electrostatic potential landscape that results from the porous nature of the AAO substrate, as well as extended defects made of wrinkles or folds originated from AAO. This substrate design strategy could be extended to other semiconductor-based sensor devices. (letter)
Isaac Vossius’ Sylloge of Greek Technopaegnia
Directory of Open Access Journals (Sweden)
Guillermo Galán-Vioque
2012-05-01
Full Text Available Tracing the sources that Vossius (1618–1689 used in compiling his anthology of Greek technopaegnia (Leiden ms. Vossius misc. 13 illuminates both his research methods and the evolution of his dispute with Salmasius.
Dewetting behavior of Au films on porous substrates
International Nuclear Information System (INIS)
Zhao Xiaowei; Lee, Ung-Ju; Lee, Kun-Hong
2010-01-01
Understanding the stability of thin films and their spontaneous pattern formation upon dewetting is essential to a host of physical phenomena. In this paper, we study the dewetting phenomena of Au thin films deposited on anodic aluminum oxide (AAO) membranes to analyze the stability of the metal film on porous substrates. AAO membranes, as-sputtered and dewetted Au films are all characterized by scanning electronic microscopy and X-ray diffraction. We found that both the roughness of AAO surface and modification of AAO pores exhibit remarkable influences on the dewetting behavior of Au films. The observed dewetting phenomena are explained from an energetic point of view since dewetting is a process of minimization of the system free energy.
Tian, Mingliang; Xu, Shengyong; Wang, Jinguo; Kumar, Nitesh; Wertz, Eric; Li, Qi; Campbell, Paul M; Chan, Moses H W; Mallouk, Thomas E
2005-04-01
A simple method for penetrating the barrier layer of an anodic aluminum oxide (AAO) film and for detaching the AAO film from residual Al foil was developed by reversing the bias voltage in situ after the anodization process is completed. With this technique, we have been able to obtain large pieces of free-standing AAO membranes with regular pore sizes of sub-10 nm. By combining Ar ion milling and wetting enhancement processes, Au nanowires were grown in the sub-10 nm pores of the AAO films. Further scaling down of the pore size and extension to the deposition of nanowires and nanotubes of materials other than Au should be possible by further optimizing this procedure.
Gaudin, Amelie C M; McClymont, Sarah A; Soliman, Sameh S M; Raizada, Manish N
2014-02-14
There was ancient human selection on the wild progenitor of modern maize, Balsas teosinte, for decreased shoot branching (tillering), in order to allow more nutrients to be diverted to grain. Mechanistically, the decline in shoot tillering has been associated with selection for increased expression of the major domestication gene Teosinte Branched 1 (Tb1) in shoot primordia. Therefore, TB1 has been defined as a repressor of shoot branching. It is known that plants respond to changes in shoot size by compensatory changes in root growth and architecture. However, it has not been reported whether altered TB1 expression affects any plant traits below ground. Previously, changes in dosage of a well-studied mutant allele of Tb1 in modern maize, called tb1-ref, from one to two copies, was shown to increase tillering. As a result, plants with two copies of the tb1-ref allele have a larger shoot biomass than heterozygotes. Here we used aeroponics to phenotype the effects of tb1-ref copy number on maize roots at macro-, meso- and micro scales of development. An increase in the tb1-ref copy number from one to two copies resulted in: (1) an increase in crown root number due to the cumulative initiation of crown roots from successive tillers; (2) higher density of first and second order lateral roots; and (3) reduced average lateral root length. The resulting increase in root system biomass in homozygous tb1-ref mutants balanced the increase in shoot biomass caused by enhanced tillering. These changes caused homozygous tb1-ref mutants of modern maize to more closely resemble its ancestor Balsas teosinte below ground. We conclude that a decrease in TB1 function in maize results in a larger root system, due to an increase in the number of crown roots and lateral roots. Given that decreased TB1 expression results in a more highly branched and larger shoot, the impact of TB1 below ground may be direct or indirect. We discuss the potential implications of these findings for whole
Md. Poostforush; H. Azizi
2014-01-01
The properties of novel thermoconductive and optically transparent nanocomposites have been reported. The composites were prepared by the impregnation of thermoset resin into crystallized anodic aluminum oxide (AAO). Crystallized AAO synthesized by annealing amorphous AAO membrane at 1200°C. Although through-plane thermal conductivity of nanocomposites improved up to 1.13 W•m–1•K–1 (39 vol% alumina) but their transparency was preserved (Tλ550 nm ~ 72%). Integrated annealed alumina phase, low ...
76 FR 64803 - Rules of Adjudication and Enforcement
2011-10-19
... INTERNATIONAL TRADE COMMISSION 19 CFR Part 210 [Docket No. MISC-032] Rules of Adjudication and Enforcement AGENCY: International Trade Commission ACTION: Final rule. SUMMARY: The United States International Trade Commission (``Commission'') amends its Rules of Practice and Procedure concerning rules of...
Directory of Open Access Journals (Sweden)
I MADE SUDARMA
2015-06-01
Full Text Available A total of 119 different actinomycete isolate were recovered from banana crop habitats with and without Fusarium wilt disease symptom. These were than assessed for their antagonist ability against Fusarium oxysporum £sp. cubense (Foe in vitro. Results indicated that four of all actinomycete isolate active against Foe. The four of actinomycete isolates were Streptomyces sp. l (AAo4, Streptomyces sp.2 (AAo32 , Streptomyces sp.3 (AAo33 and Streptomyces sp. 4 (AAo35. It was can inhibit the Foe mycelium growth, 79,63%, 72,22%, 78,89% and 72,22% respectively. After tested with the 3 times replication, the four Streptomyces spp. isolate effective to control the Foe that attack Bali banana cultivars, such as Susu, Saba, Raja and Ketip.
ORDERED POROUS ANODIC ALUMINUM OXIDE FILMS MADE BY TWO-STEP ANODIZATION
HANSONG XUE; HUAJI LI; YU YI; HUIFANG HU
2007-01-01
Porous Anodic Aluminum Oxide (AAO) films were prepared by two-step anodizing in sulfuric and oxalic acid solutions and observed by transmission electron microscope (TEM) and X-ray diffraction. The results show that the form of AAO film is affected by the varieties and concentrations of electrolyte, anodizing voltage, and the anodizing time; the formation and evolution processes of the AAO film are relative with the anodizing voltage severely, and the appropriate voltage is helpful to the orde...
Photoconductivity of Germanium Nanowire Arrays Incorporated in Anodic Aluminum Oxide
International Nuclear Information System (INIS)
Polyakov, B; Prikulis, J; Grigorjeva, L; Millers, D; Daly, B; Holmes, J D; Erts, D
2007-01-01
Photoconductivity of germanium nanowire arrays of 50 and 100 nm diameter incorporated into Anodic Aluminum Oxide (AAO) membranes illuminated with visible light is investigated. Photocurrent response to excitation radiation with time constants faster than 10 -4 s were governed by absorption of incident light by nanowires, while photokinetics with time constants of the order of 10 -3 s originates from the photoluminescence of the AAO matrix. Possible applications of nanowire arrays inside AAO as photoresistors are discussed
Template synthesis of indium nanowires using anodic aluminum oxide membranes.
Chen, Feng; Kitai, Adrian H
2008-09-01
Indium nanowires with diameters approximately 300 nm have been synthesized by a hydraulic pressure technique using anodic aluminum oxide (AAO) templates. The indium melt is injected into the AAO template and solidified to form nanostructures. The nanowires are dense, continuous and uniformly run through the entire approximately 60 microm thickness of the AAO template. X-ray diffraction (XRD) reveals that the nanowires are polycrystalline with a preferred orientation. SEM is performed to characterize the morphology of the nanowires.
Energy Technology Data Exchange (ETDEWEB)
Kim, Woo-Hee; Park, Sang-Joon; Son, Jong-Yeog; Kim, Hyungjun [Department of Material Science and Engineering, POSTECH Pohang University of Science and Technology, San 31, Hyoja-Dong, Nam-Gu, Pohang 790-784 (Korea, Republic of)
2008-01-30
We fabricated metallic nanostructures directly on Si substrates through a hybrid nanoprocess combining atomic layer deposition (ALD) and a self-assembled anodic aluminum oxide (AAO) nanotemplate. ALD Ru films with Ru(DMPD)(EtCp) as a precursor and O{sub 2} as a reactant exhibited high purity and low resistivity with negligible nucleation delay and low roughness. These good growth characteristics resulted in the excellent conformality for nanometer-scale vias and trenches. Additionally, AAO nanotemplates were fabricated directly on Si and Ti/Si substrates through a multiple anodization process. AAO nanotemplates with various hole sizes (30-100 nm) and aspect ratios (2:1-20:1) were fabricated by controlling the anodizing process parameters. The barrier layers between AAO nanotemplates and Si substrates were completely removed by reactive ion etching (RIE) using BCl{sub 3} plasma. By combining the ALD Ru and the AAO nanotemplate, Ru nanostructures with controllable sizes and shapes were prepared on Si and Ti/Si substrates. The Ru nanowire array devices as a platform for sensor devices exhibited befitting properties of good ohmic contact and high surface/volume ratio.
Effects of anodic aluminum oxide membrane on performance of nanostructured solar cells
Dang, Hongmei; Singh, Vijay
2015-05-01
Three nanowire solar cell device configurations have been fabricated to demonstrate the effects of the host anodized aluminum oxide (AAO) membrane on device performance. The three configurations show similar transmittance spectra, indicating that AAO membrane has negligible optical absorption. Power conversion efficiency (PCE) of the device is studied as a function of the carrier transport and collection in cell structures with and without AAO membrane. Free standing nanowire solar cells exhibit PCE of 9.9%. Through inclusion of AAO in solar cell structure, interface defects and traps caused by humidity and oxygen are reduced, and direct contact of CdTe tentacles with SnO2 and formation of micro shunt shorts are prevented; hence PCE is improved to 11.1%-11.3%. Partially embedded nanowire solar cells further reduce influence of non-ideal and non-uniform nanowire growth and generate a large amount of carriers in axial direction and also a small quantity of carriers in lateral direction, thus becoming a promising solar cell structure. Thus, including AAO membrane in solar cell structure provides favorable electro-optical properties as well as mechanical advantages.
The motivational interviewing skill code : Reliability and a critical appraisal
de Jonge, JM; Schippers, GM; Schaap, CPDR
The Motivational Interviewing Skill Code (MISC) is a coding system developed to measure adherence to motivational interviewing (MI). MI is an effective clinical style used in different treatment situations. Counsellors practising MI have to follow general principles and avoid certain traps. In the
Tailoring thermal conductivity via three-dimensional porous alumina.
Abad, Begoña; Maiz, Jon; Ruiz-Clavijo, Alejandra; Caballero-Calero, Olga; Martin-Gonzalez, Marisol
2016-12-09
Three-dimensional anodic alumina templates (3D-AAO) are an astonishing framework with open highly ordered three-dimensional skeleton structures. Since these templates are architecturally different from conventional solids or porous templates, they teem with opportunities for engineering thermal properties. By establishing the mechanisms of heat transfer in these frameworks, we aim to create materials with tailored thermal properties. The effective thermal conductivity of an empty 3D-AAO membrane was measured. As the effective medium theory was not valid to extract the skeletal thermal conductivity of 3D-AAO, a simple 3D thermal conduction model was developed, based on a mixed series and parallel thermal resistor circuit, giving a skeletal thermal conductivity value of approximately 1.25 W·m -1 ·K -1 , which matches the value of the ordinary AAO membranes prepared from the same acid solution. The effect of different filler materials as well as the variation of the number of transversal nanochannels and the length of the 3D-AAO membrane in the effective thermal conductivity of the composite was studied. Finally, the thermal conductivity of two 3D-AAO membranes filled with cobalt and bismuth telluride was also measured, which was in good agreement with the thermal model predictions. Therefore, this work proved this structure as a powerful approach to tailor thermal properties.
Tailoring thermal conductivity via three-dimensional porous alumina
Abad, Begoña; Maiz, Jon; Ruiz-Clavijo, Alejandra; Caballero-Calero, Olga; Martin-Gonzalez, Marisol
2016-01-01
Three-dimensional anodic alumina templates (3D-AAO) are an astonishing framework with open highly ordered three-dimensional skeleton structures. Since these templates are architecturally different from conventional solids or porous templates, they teem with opportunities for engineering thermal properties. By establishing the mechanisms of heat transfer in these frameworks, we aim to create materials with tailored thermal properties. The effective thermal conductivity of an empty 3D-AAO membrane was measured. As the effective medium theory was not valid to extract the skeletal thermal conductivity of 3D-AAO, a simple 3D thermal conduction model was developed, based on a mixed series and parallel thermal resistor circuit, giving a skeletal thermal conductivity value of approximately 1.25 W·m−1·K−1, which matches the value of the ordinary AAO membranes prepared from the same acid solution. The effect of different filler materials as well as the variation of the number of transversal nanochannels and the length of the 3D-AAO membrane in the effective thermal conductivity of the composite was studied. Finally, the thermal conductivity of two 3D-AAO membranes filled with cobalt and bismuth telluride was also measured, which was in good agreement with the thermal model predictions. Therefore, this work proved this structure as a powerful approach to tailor thermal properties. PMID:27934930
Thoracic aorta 3D hemodynamics in pediatric and young adult patients with bicuspid aortic valve.
Allen, Bradley D; van Ooij, Pim; Barker, Alex J; Carr, Maria; Gabbour, Maya; Schnell, Susanne; Jarvis, Kelly B; Carr, James C; Markl, Michael; Rigsby, Cynthia; Robinson, Joshua D
2015-10-01
To evaluate the 3D hemodynamics in the thoracic aorta of pediatric and young adult bicuspid aortic valve (BAV) patients. 4D flow MRI was performed in 30 pediatric and young adult BAV patients (age: 13.9 ± 4.4 (range: [3.4, 20.7]) years old, M:F = 17:13) as part of this Institutional Review Board-approved study. Nomogram-based aortic root Z-scores were calculated to assess aortic dilatation and degree of aortic stenosis (AS) severity was assessed on MRI. Data analysis included calculation of time-averaged systolic 3D wall shear stress (WSSsys ) along the entire aorta wall, and regional quantification of maximum and mean WSSsys and peak systolic velocity (velsys ) in the ascending aorta (AAo), arch, and descending aorta (DAo). The 4D flow MRI AAo velsys was also compared with echocardiography peak velocity measurements. There was a positive correlation with both mean and max AAo WSSsys and peak AAo velsys (mean: r = 0.84, P max: r = 0.94, P max: rS = 0.70, P < 0.001). AAo peak velocity was significantly higher when measured with echo compared with 4D flow MRI (2.1 ± 0.98 m/s versus 1.27 ± 0.49 m/s, P < 0.001). In pediatric and young adult patients with BAV, AS and peak ascending aorta velocity are associated with increased AAo WSS, while aortic dilation, age, and body surface area do not significantly impact AAo hemodynamics. Prospective studies are required to establish the role of WSS as a risk-stratification tool in these patients. © 2015 Wiley Periodicals, Inc.
Anodic aluminium oxide membranes used for the growth of carbon nanotubes.
López, Vicente; Morant, Carmen; Márquez, Francisco; Zamora, Félix; Elizalde, Eduardo
2009-11-01
The suitability of anodic aluminum oxide (AAO) membranes as template supported on Si substrates for obtaining organized iron catalyst for carbon nanotube (CNT) growth has been investigated. The iron catalyst was confined in the holes of the AAO membrane. CVD synthesis with ethylene as carbon source led to a variety of carbon structures (nanotubes, helices, bamboo-like, etc). In absence of AAO membrane the catalyst was homogeneously distributed on the Si surface producing a high density of micron-length CNTs.
Finding an Eye Care Professional
... article rating hospitals in the United States. Website: http://health.usnews.com/best-hospitals For More Information ... ophthalmologists in the United States and abroad. Website: https://secure.aao.org/aao/find-ophthalmologist The American ...
Kwon, Chang-Woo; Lee, Jae-Il; Kim, Ki-Bum; Lee, Hae-Weon; Lee, Jong-Ho; Son, Ji-Won
2012-07-01
The thermomechanical stability of micro-solid oxide fuel cells (micro-SOFCs) fabricated on an anodized aluminum oxide (AAO) membrane template is investigated. The full structure consists of the following layers: AAO membrane (600 nm)/Pt anode/YSZ electrolyte (900 nm)/porous Pt cathode. The utilization of a 600-nm-thick AAO membrane significantly improves the thermomechanical stability due to its well-known honeycomb-shaped nanopore structure. Moreover, the Pt anode layer deposited in between the AAO membrane and the YSZ electrolyte preserves its integrity in terms of maintaining the triple-phase boundary (TPB) and electrical conductivity during high-temperature operation. Both of these results guarantee thermomechanical stability of the micro-SOFC and extend the cell lifetime, which is one of the most critical issues in the fabrication of freestanding membrane-type micro-SOFCs.
ZZ MCNPDATA, Standard Neutron, Photon and Electron Data Libraries for MCNP-4C and MCB1C
International Nuclear Information System (INIS)
2002-01-01
of data: A wide variety of continuous-energy, discrete, multigroup, thermal and dosimetry neutron data libraries are available in this release. The continuous-energy neutron data libraries available include: ENDF60, RMCCS, RMCCSA, ENDF5U, ENDF5P, NEWXS, ENDF5MT*, MISC5XS**, ENDL85, KIDMAN, 100XS, URES***, ENDF6DN***, ENDF62MT***, and ENDL92***. The discrete neutron data libraries include: NEWXSD, DRMCCS, and DRE5. The multigroup neutron data library is MGXSNP, and the thermal S(alpha, beta) libraries are TMCCS and THERXS. The neutron dosimetry libraries are 531DOS, 532DOS, and LLLDOS. The photon transport libraries are MCPLIB and MCPLIB02, and the electron libraries are EL and EL03***. The photon and electron data libraries contain data for elements having Z<95. The data libraries, as distributed, are in ASCII, or type 1, format. - The data library ENDF5MT contains data previously available in the library EPRIXS, along with the U600K data library. - The data library MISC5XS contains corrected data for ENDF/B-V based Zr as described below, and the libraries previously known as IRNAT, MISCXS, ARKRC, TM169, GDT2GP, and T2DDC. The ENDF/B-V Zr data has been corrected for five ZAID's from the libraries RMCCS, DRMCCS, ENDF5P, DRE5, and EPRIXS. Below is a summary of the changes that have been made for Zr (Previous → Corrected): RMCCS 40000.51c → 40000.57c MISC5XS 300K; DRMCCS 40000.51d → 40000.57d MISC5XS 300K; ENDF5P 40000.50c → 40000.56c MISC5XS 300K; DRE5 40000.50d → 40000.56d MISC5X 300K; EPRIXS 40000.53c → 40000.58c MISC5XS 600K. - These five data libraries (URES, ENDF6DN, ENDF62MT, ENDL92, and EL03) are newly released in DLC-200. In the February 2001 update, URES was replaced with URESA. Please consult the README file and the more detailed documentation provided for descriptions of these libraries
Mechanical and frictional behaviour of nano-porous anodised aluminium
Energy Technology Data Exchange (ETDEWEB)
Tsyntsaru, N., E-mail: tintaru@phys.asm.md [Institute of Applied Physics of ASM, 5 Academy str., Chisinau, MD 2028 (Moldova, Republic of); Kavas, B., E-mail: bkavas@ford.com.tr [Istanbul Technical University, Department of Metallurgical and Materials Engineering, 34469 Maslak (Turkey); Ford Otomotiv San A.S., Istanbul (Turkey); Sort, J., E-mail: jordi.sort@uab.cat [Institució Catalana de Recerca i Estudis Avançats (ICREA) and Departament de Física, Universitat Autònoma de Barcelona, E-08193 Bellaterra (Spain); Urgen, M., E-mail: urgen@itu.edu.tr [Istanbul Technical University, Department of Metallurgical and Materials Engineering, 34469 Maslak (Turkey); Celis, J.-P., E-mail: jean-pierre.celis@mtm.kuleuven.be [KU Leuven, Dept. MTM, Kasteelpark Arenberg 44, B-3001 (Belgium)
2014-12-15
The porous structure of anodic aluminium oxide (AAO) can be used in versatile applications such as a lubricant reservoir in self-lubricating systems. Such systems are subjected to biaxial loading, which can induce crack formation and propagation, ultimately leading to catastrophic mechanical failure. In this study, the mechanical and tribological behaviour of AAO, prepared from two different types of electrolytes (sulphuric and oxalic acids), are studied in detail. The electrolytic conditions are adjusted to render highly tuneable average pore diameters (between 16 and 75 nm), with porosity levels ranging from 9% to 65%. Well-ordered porous AAO are produced by two-step anodization at rather low temperatures. Mechanical properties, mainly hardness and Young's modulus, are investigated using nanoindentation. Both the porosity degree and the composition of the electrolytic baths used to prepare the AAO have an influence on the mechanical properties. Ball-on-flat configuration was used to estimate the tribological behaviour under dry conditions. No major cracks were observed by scanning electron microscopy, neither after indentation or fretting tests. In the running-in period of tribology experiments the pores were filled with debris. This was followed by the formation of a highly adherent tribolayer – a third body consisting of fine worn particles originated from both the sample and the counterbody. Pore diameter and porosity percentage are found to strongly affect hardness and Young's modulus, but they do not have a major effect on the frictional behaviour. - Highlights: • Well-ordered porous AAO with pore diameters between 16 and 75 nm were produced. • Porosity and composition of electrolytic baths influence the mechanical properties. • Ball-on-flat configuration was used in tribological testing under dry conditions. • Adherent tribolayer consisting of fine worn particles prevents AAO from cracking. • Testing parameters are moreover essential
Eltorai, Adam E M; Sharma, Pranav; Wang, Jing; Daniels, Alan H
2015-04-01
Advancing health literacy has the potential to improve patient outcomes. The American Academy of Orthopaedic Surgeons' (AAOS) online patient education materials serve as a tool to improve health literacy for orthopaedic patients; however, it is unknown whether the materials currently meet the National Institutes of Health/American Medical Association's recommended sixth grade readability guidelines for health information or the mean US adult reading level of eighth grade. The purposes of this study were (1) to evaluate the mean grade level readability of online AAOS patient education materials; and (2) to determine what proportion of the online materials exceeded recommended (sixth grade) and mean US (eighth grade) reading level. Reading grade levels for 99.6% (260 of 261) of the online patient education entries from the AAOS were analyzed using the Flesch-Kincaid formula built into Microsoft Word software. Mean grade level readability of the AAOS patient education materials was 9.2 (SD ± 1.6). Two hundred fifty-one of the 260 articles (97%) had a readability score above the sixth grade level. The readability of the AAOS articles exceeded the sixth grade level by an average of 3.2 grade levels. Of the 260 articles, 210 (81%) had a readability score above the eighth grade level, which is the average reading level of US adults. Most of the online patient education materials from the AAOS had readability levels that are far too advanced for many patients to comprehend. Efforts to adjust the readability of online education materials to the needs of the audience may improve the health literacy of orthopaedic patients. Patient education materials can be made more comprehensible through use of simpler terms, shorter sentences, and the addition of pictures. More broadly, all health websites, not just those of the AAOS, should aspire to be comprehensible to the typical reader.
Formation of Self-assembled Nanostructure on Noble Metal Islands Based on Anodized Aluminum Oxide
International Nuclear Information System (INIS)
Park, Jong Bae; Kim, Young Sic; Kim, Seong Kyu; Lee, Hae Seong
2004-01-01
We have developed the methodology to produce nanoscale gold rods using an AAO template. Each gold rod was generated in every AAO pore. This nanoislands array of gold formed over the AAO pores can be used as corner stones for building nanostructures. We demonstrated this by forming a nanostructure on the Au/AAO by binding a self-assembly class of molecules onto the metal islands. Anodized aluminum oxide (AAO) has been considered an attractive template for simple fabrication of highly-ordered nanostructures. It provides a 2-dimensional array of hexagonal cells with pores of uniform diameter and inter-pore distance that are adjustable in the range of a few tens to hundreds of nanometers. It can be easily grown on an aluminum sheet with high purity by a sequence of several electrochemical steps; electro-polishing, the 1st anodization, etching, and the 2nd anodization. The pores are grown vertically with respect to the AAO surface. The regularity of the pore structure is usually limited by the inherent grain domain in the aluminum sheet to a few micrometers, but can be improved to cover many millimeters of monodomain by pre-indenting the aluminum sheet with SiC 7 or Si 3 N 4 molds. Although fabrication of such molds requires elaborate and costly processes with e-beam nanolithography, such potentially superb regularity can be practically applied to fabrication of nanoscale devices in electronics, optics, biosensors, etc
Antagonism of Trichoderma harzianum ETS 323 on Botrytis cinerea mycelium in culture conditions.
Cheng, Chi-Hua; Yang, Chia-Ann; Peng, Kou-Cheng
2012-11-01
ABSTRACT Previous studies have shown that the extracellular proteins of Trichoderma harzianum ETS 323 grown in the presence of deactivated Botrytis cinerea in culture include a putative l-amino acid oxidase and have suggested the involvement of this enzyme in the antagonistic mechanism. Here, we hypothesized that the mycoparasitic process of Trichoderma spp. against B. cinerea involves two steps; that is, an initial hyphal coiling stage and a subsequent hyphal coiling stage, with different coiling rates. The two-step antagonism of T. harzianum ETS 323 against B. cinerea during the mycoparasitic process in culture was evaluated using a biexponential equation. In addition, an l-amino acid oxidase (Th-l-AAO) was identified from T. harzianum ETS 323. The secretion of Th-l-AAO was increased when T. harzianum ETS 323 was grown with deactivated hyphae of B. cinerea. Moreover, in vitro assays indicated that Th-l-AAO effectively inhibited B. cinerea hyphal growth, caused cytosolic vacuolization in the hyphae, and led to hyphal lysis. Th-l-AAO also showed disease control against the development of B. cinerea on postharvest apple fruit and tobacco leaves. Furthermore, an apoptosis-like response, including the generation of reactive oxygen species, was observed in B. cinerea after treatment with Th-l-AAO, suggesting that Th-l-AAO triggers programmed cell death in B. cinerea. This may be associated with the two-step antagonism of T. harzianum ETS 323 against B. cinerea.
Effects of anodic aluminum oxide membrane on performance of nanostructured solar cells
International Nuclear Information System (INIS)
Dang, Hongmei; Singh, Vijay
2015-01-01
Three nanowire solar cell device configurations have been fabricated to demonstrate the effects of the host anodized aluminum oxide (AAO) membrane on device performance. The three configurations show similar transmittance spectra, indicating that AAO membrane has negligible optical absorption. Power conversion efficiency (PCE) of the device is studied as a function of the carrier transport and collection in cell structures with and without AAO membrane. Free standing nanowire solar cells exhibit PCE of 9.9%. Through inclusion of AAO in solar cell structure, interface defects and traps caused by humidity and oxygen are reduced, and direct contact of CdTe tentacles with SnO 2 and formation of micro shunt shorts are prevented; hence PCE is improved to 11.1%–11.3%. Partially embedded nanowire solar cells further reduce influence of non-ideal and non-uniform nanowire growth and generate a large amount of carriers in axial direction and also a small quantity of carriers in lateral direction, thus becoming a promising solar cell structure. Thus, including AAO membrane in solar cell structure provides favorable electro-optical properties as well as mechanical advantages. (paper)
Nanostructured sapphire optical fiber for sensing in harsh environments
Chen, Hui; Liu, Kai; Ma, Yiwei; Tian, Fei; Du, Henry
2017-05-01
We describe an innovative and scalable strategy of transforming a commercial unclad sapphire optical fiber to an allalumina nanostructured sapphire optical fiber (NSOF) that overcomes decades-long challenges faced in the field of sapphire fiber optics. The strategy entails fiber coating with metal Al followed by subsequent anodization to form anodized alumina oxide (AAO) cladding of highly organized pore channel structure. We show that Ag nanoparticles entrapped in AAO show excellent structural and morphological stability and less susceptibility to oxidation for potential high-temperature surface-enhanced Raman Scattering (SERS). We reveal, with aid of numerical simulations, that the AAO cladding greatly increases the evanescent-field overlap both in power and extent and that lower porosity of AAO results in higher evanescent-field overlap. This work has opened the door to new sapphire fiber-based sensor design and sensor architecture.
Apodaca, Timothy R; Jackson, Kristina M; Borsari, Brian; Magill, Molly; Longabaugh, Richard; Mastroleo, Nadine R; Barnett, Nancy P
2016-02-01
To identify individual therapist behaviors which elicit client change talk or sustain talk in motivational interviewing sessions. Motivational interviewing sessions from a single-session alcohol intervention delivered to college students were audio-taped, transcribed, and coded using the Motivational Interviewing Skill Code (MISC), a therapy process coding system. Participants included 92 college students and eight therapists who provided their treatment. The MISC was used to code 17 therapist behaviors related to the use of motivational interviewing, and client language reflecting movement toward behavior change (change talk), away from behavior change (sustain talk), or unrelated to the target behavior (follow/neutral). Client change talk was significantly more likely to immediately follow individual therapist behaviors [affirm (p=.013), open question (pmotivational interviewing can either elicit both client change talk and sustain talk or suppress both types of client language. Affirm was the only therapist behavior that both increased change talk and also reduced sustain talk. Copyright © 2015 Elsevier Inc. All rights reserved.
Bruns, M.A.; Stephen, J.R.; Kowalchuk, G.A.; Prosser, J.I.; Paul, E.A.
1999-01-01
Autotrophic ammonia oxidizer (AAO) populations in soils from native, tilled, and successional treatments at the Kellogg Biological Station Long-Term Ecological Research site in southwestern Michigan were compared to assess effects of disturbance on these bacteria. N fertilization effects on AAO
Energy Technology Data Exchange (ETDEWEB)
Schneider, Lilli; Kuepper, Karsten [Physics Department, University of Osnabrueck (Germany); Rinkel, Thorben; Haase, Markus [Institute of Chemistry, University of Osnabrueck (Germany); Chrobak, Artur [Institute of Physics, University of Silesia (Poland)
2014-07-01
Rare earth (RE) based nanoparticles of type NaREF{sub 4} have attracted lot of attention in the last few years due to their upconverting luminescence. Here, we want to concentrate on electronic and magnetic properties of NaREF{sub 4}/NaGdF{sub 4} nanocrystals, since the magnetic behaviour of these fluorescent nanoparticles are of utmost importance from fundamental and applicative point of view as well. Hexagonal β-phase nanocrystals (3-22 nm) were prepared and characterized by X-ray powder diffraction (XRD) and transmission electron microscopy (TEM). A detailed study of the electronic structure and magnetic coupling phenomena of the different core-shell nanoparticles is performed using X-ray photoelectron spectroscopy (XPS), magnetometry (SQUID) and X-ray magnetic circular dichroism (XMCD). First SQUID measurements of NaEuF{sub 4}/NaGdF{sub 4} core-shell nanoparticles show butterfly shaped hysteresis loops at low temperature (2 K) in contrast to superparamagnetic behaviour observed for the corresponding ''pure'' NaEuF{sub 4} and NaGdF{sub 4} nanoparticles.
1996-05-01
Systems 17 Motion Bases Upgraded Aero Misc > Contact Info • AMC, Lt Col Letica , Phone (618) 256-5696 L8 Upgrade Flow Plan Advance Planning Briefing...Projected Schedule: FY 05 > Requirement Document: AMMP >• Projected Program Size: ? < $40M > Funding Status/Stability: > POCs: • AMC, Lt Col Letica
RGB-D Segmentation of Poultry Entrails
DEFF Research Database (Denmark)
Philipsen, Mark Philip; Jørgensen, Anders; Guerrero, Sergio Escalera
2016-01-01
and passed to a Random Forest classifier, which classifies the supervoxels as either belonging to heart, lung, liver or misc. The dataset consists of 150 individual entrails, with 30 of these being reserved for evaluation. Segmentation performance is evaluated on a voxel-by-voxel basis, achieving an average...
Highly ordered porous alumina with tailor-made pore structures fabricated by pulse anodization
International Nuclear Information System (INIS)
Lee, Woo; Kim, Jae-Cheon
2010-01-01
A new anodization method for the preparation of nanoporous anodic aluminum oxide (AAO) with pattern-addressed pore structure was developed. The approach is based on pulse anodization of aluminum employing a series of potential waves that consist of two or more different pulses with designated periods and amplitudes, and provides unique tailoring capability of the internal pore structure of anodic alumina. Pores of the resulting AAOs exhibit a high degree of directional coherency along the pore axes without branching, and thus are suitable for fabricating novel nanowires or nanotubes, whose diameter modulation patterns are predefined by the internal pore geometry of AAO. It is found from microscopic analysis on pulse anodized AAOs that the effective electric field strength at the pore base is a key controlling parameter, governing not only the size of pores, but also the detailed geometry of the barrier oxide layer.
Effect of processing on structural features of anodic aluminum oxides
Erdogan, Pembe; Birol, Yucel
2012-09-01
Morphological features of the anodic aluminum oxide (AAO) templates fabricated by electrochemical oxidation under different processing conditions were investigated. The selection of the polishing parameters does not appear to be critical as long as the aluminum substrate is polished adequately prior to the anodization process. AAO layers with a highly ordered pore distribution are obtained after anodizing in 0.6 M oxalic acid at 20 °C under 40 V for 5 minutes suggesting that the desired pore features are attained once an oxide layer develops on the surface. While the pore features are not affected much, the thickness of the AAO template increases with increasing anodization treatment time. Pore features are better and the AAO growth rate is higher at 20 °C than at 5 °C; higher under 45 V than under 40 V; higher with 0.6 M than with 0.3 M oxalic acid.
Suchitra, S. M.; Udayashankar, N. K.
2018-01-01
Porous anodic aluminium oxide (AAO) membranes with a highly ordered pore arrangement are typically used as ideal templates for the synthesis of numerous nanostructured materials. Highly ordered templates gained significant attraction due to the fact that they are readily fabricated through self-organised simple anodization process. In this paper, the effect of different pore-widening treatments on the quality of the pores of the AAO templates prepared with different electrolytes were inspected. Results confirmed that, without altering the interpore distance different pore dimensions and diameters of the AAO templates can be easily achieved by chemical pore widening process at room temperature. Also, graphitic carbon nitride nanorods of different dimension have been fabricated from AAO template after porewidening process. These nanostructures are widely used in case of metal free visible light driven photo catalysis, photo degradation of organic pollutants, photo electric conversion and water splitting applications.
Liao, M. W.; Chung, C. K.
2014-08-01
The porous anodic aluminum oxide (AAO) with high-aspect-ratio pore channels is widely used as a template for fabricating nanowires or other one-dimensional (1D) nanostructures. The high specific surface area of AAO can also be applied to the super capacitor and the supporting substrate for catalysis. The rough surface could be helpful to enhance specific surface area but it generally results in electrical field concentration even to ruin AAO. In this article, the aluminum (Al) films with the varied 2D-3D morphology on Si substrates were prepared using magnetron sputtering at a power of 50 W-185 W for 1 h at a working pressure of 2.5 × 10-1 Pa. Then, AAO was fabricated from the different Al films by means of one-step hybrid pulse anodizing (HPA) between the positive 40 V and the negative -2 V (1 s:1 s) for 3 min in 0.3 M oxalic acid at a room temperature. The microstructure and morphology of Al films were characterized by X-ray diffraction, scanning electron microscope and atomic force microscope, respectively. Some hillocks formed at the high target power could be attributed to the grain texture growth in the normal orientation of Al(1 1 1). The 3D porous AAO structure which is different from the conventional 2D planar one has been successfully demonstrated using HPA on the film with greatly rough hillock-surface formed at the highest power of 185 W. It offers a potential application of the new 3D AAO to high specific surface area devices.
Yi, Paul H; Ganta, Abhishek; Hussein, Khalil I; Frank, Rachel M; Jawa, Andrew
2013-06-01
We sought to assess the readability levels of arthroscopy-related patient education materials available on the Web sites of the American Academy of Orthopaedic Surgeons (AAOS) and the Arthroscopy Association of North America (AANA). We identified all articles related to arthroscopy available in 2012 from the online patient education libraries of AAOS and AANA. After performing follow-up editing, we assessed each article with the Flesch-Kincaid (FK) readability test. Mean readability levels of the articles from the AAOS Web site and the AANA Web site were compared. We also determined the number of articles with readability levels at or below the eighth-grade level (the average reading ability of the US adult population) and sixth-grade level (the widely recommended level for patient education materials). Intraobserver reliability and interobserver reliability of FK grade assessment were evaluated. A total of 62 articles were reviewed (43 from AAOS and 19 from AANA). The mean overall FK grade level was 10.2 (range, 5.2 to 12). The AAOS articles had a mean FK grade level of 9.6 (range, 5.2 to 12), whereas the AANA articles had a mean FK grade level of 11.4 (range, 8.7 to 12); the difference was significant (P Online patient education materials related to arthroscopy from AAOS and AANA may be written at a level too difficult for a large portion of the patient population to comprehend. Copyright © 2013 Arthroscopy Association of North America. Published by Elsevier Inc. All rights reserved.
Synthesis of copper telluride nanowires using template-based ...
Indian Academy of Sciences (India)
Anodized alu- minum oxide foil (AAO) acts as template and electrodeposi- tion is conducted in a ... the nanopores were perpendicular to the AAO membrane sur- face and were uniform in ... Aluminium oxide 0·02–0·2. 13, 21, 47. 60. 105. –.
Fabrication of high quality ordered porous anodic aluminum oxide templates
International Nuclear Information System (INIS)
Liu Kai; Du Kai; Chen Jing; Zhou Lan; Zhang Lin; Fang Yu
2010-01-01
The preparation of porous anodic aluminum oxide (AAO) templates has been studied with oxalic acid as electrolyte. The morphology of the as-prepared templates has been characterized by field-emission scanning electron microscope (FE-SEM). The pores distributed orderly and uniformly with the diameter ranging from 40 nm to 70 nm. The experimental results indicate that electrolyte concentration, oxidation voltage, oxidation temperature and oxidation time affect the structure of AAO templates. Ordered porous AAO templates can be derived without annealing and finishing. X-ray diffraction (XRD) analysis indicates that the aluminum oxide film is mainly composed of amorphous Al 2 O 3 . (authors)
Patterned FePt nanostructures using ultrathin self-organized templates
Deng, Chen Hua; Zhang, Min; Wang, Fang; Xu, Xiao Hong
2018-02-01
Patterned magnetic thin films are both scientifically interesting and technologically useful. Ultrathin self-organized anodic aluminum oxide (AAO) template can be used to fabricate large area nanodot and antidot arrays. The magnetic properties of these nanostructures may be tuned by the morphology of the AAO template, which in turn can be controlled by synthetic parameters. In this work, ultrathin AAO templates were used as etching masks for the fabrication of both FePt nanodot and antidot arrays with high areal density. The perpendicular magnetic anisotropy of L10 FePt thin films are preserved in the nanostructures.
Anodic Aluminum Oxide Templates for Nano wires Array Fabrication
International Nuclear Information System (INIS)
Nur Ubaidah Saidin; Kok, K.Y.; Ng, I.K.
2011-01-01
This paper reports on the process developed to fabricate anodic aluminium oxide (AAO) templates suitable for the fabrication of nano wire arrays. Anodization process has been used to fabricate the AAO templates with pore diameters ranging from 15 nm to 30 nm. Electrodeposition of parallel arrays of high aspect ratio nickel nano wires were demonstrated using these fabricated AAO templates. The nano wires produced were characterized using X-ray diffraction (XRD) and scanning electron microscopy (SEM). It was found that the orientations of the electrodeposited nickel nano wires were governed by the deposition current and electrolyte conditions. (author)
Sato, Akihiro; Pennec, Yan; Shingne, Nitin; Thurn-Albrecht, Thomas; Knoll, Wolfgang; Steinhart, Martin; Djafari-Rouhani, Bahram; Fytas, George
2010-06-22
Anodic aluminum oxide (AAO) containing arrays of aligned cylindrical nanopores infiltrated with polymers is a well-defined model system for the study of hypersound propagation in polymer nanocomposites. Hypersonic phononic properties of AAO/polymer nanocomposites such as phonon localization and anisotropic sound propagation can be tailored by adjusting elastic contrast and density contrast between the components. Changes in density and elastic properties of the component located in the nanopores induced by phase transitions allow reversible modification of the phononic band structure and mode switching. As example in case, the crystallization and melting of poly(vinylidene difluoride) inside AAO was investigated.
The TiO2 Refraction Film for CsI Scintillator
C. C. Chen; C. W. Hun; C. J. Wang; C. Y. Chen; J. S. Lin; K. J. Huang
2015-01-01
Cesium iodide (CsI) melt was injected into anodic aluminum oxide (AAO) template and was solidified to CsI column. The controllable AAO channel size (10~500 nm) can makes CsI column size from 10 to 500 nm in diameter. In order to have a shorter light irradiate from each singe CsI column top to bottom the AAO template was coated a TiO2 nano-film. The TiO2 film acts a refraction film and makes X-ray has a shorter irradiation path in the CsI crystal making a stronger the photo-electron signal. Wh...
Ganta, Abhishek; Yi, Paul H; Hussein, Khalil; Frank, Rachel M
2014-04-01
Although studies have revealed high readability levels of orthopedic patient education materials, no study has evaluated sports medicine-related patient education materials. We conducted a study to assess the readability of sports medicine-related patient education materials from the American Academy of Orthopaedic Surgeons (AAOS) and the American Orthopaedic Society for Sports Medicine (AOSSM). All sports medicine patient education articles available online in 2012 from the AAOS and the AOSSM, including the Stop Sports Injuries Campaign (STOP), were identified, and their readability was assessed with the Flesch-Kinkaid (FK) readability test. Mean overall FK grade level of the 170 articles reviewed (104 from AAOS, 36 from AOSSM, 30 from STOP) was 10.2. Mean FK levels for the 3 sources were 9.5 (AAOS), 11.0 (AOSSM), and 11.5 (STOP) (P = .16). Fifteen (8.8%) of the 170 articles had a readability level at or below eighth grade (average reading level of US adults); only 2 (1.2%) of the 170 articles were at or below the recommended sixth-grade level. The majority of sports medicine-related patient education materials from AAOS and AOSSM had reading levels higher than recommended, indicating that the majority of the patient population may find it difficult to comprehend these articles.
Park, Eun-Mi; Lim, Seung-Kyu; Ra, Senug-Hyun; Suh, Su-Jung
2013-11-01
Aluminum anodizing can alter pore diameter, density distribution, periodicity and layer thickness in a controlled way. Because of this property, porous type anodic aluminum oxide (AAO) was used as a template for nano-structure fabrication. The alumina layer generated at a constant voltage increased the pore size from 120 nm to 205 nm according to an increasing process time from 60 min to 150 min. The resulting fabricated AAO templates had pore diameters at or less than 200 nm. Ni was sputtered as a conductive layer onto this AAO template and electroplated using DC and pulse power. Comparing these Ni stamps, those generated from electroplating using on/reverse/off pulsing had an ordered pillar array and maintained the AAO template morphology. This stamp was used for nano-imprinting on UV curable resin coated glass wafer. Surface observations via electron microscopy showed that the nano-imprinted patterned had the same shape as the AAO template. A soft mold was subsequently fabricated and nano-imprinted to form a moth-eye structure on the glass wafer. An analysis of the substrate transmittance using UV-VIS/NIR spectroscopy showed that the transmittance of the substrate with the moth-eye structure was 5% greater that the non-patterned substrate.
Directory of Open Access Journals (Sweden)
Jae-Sung Lee
2015-01-01
Full Text Available We propose a nanobiosensor to evaluate a lung cancer-specific biomarker. The nanobiosensor is based on an anodic aluminum oxide (AAO chip and functions on the principles of localized surface plasmon resonance (LSPR and interferometry. The pore-depth of the fabricated nanoporous AAO chip was 1 µm and was obtained using a two-step electrochemical anodization process. The sensor chip is sensitive to the refractive index (RI changes of the surrounding medium and also provides simple and label-free detection when specific antibodies are immobilized on the gold-deposited surface of the AAO chip. In order to confirm the effectiveness of the sensor, the antibodies were immobilized on the surface of the AAO chip, and the lung cancer-specific biomarker was applied atop of the immobilized-antibody layer using the self-assembled monolayer method. The nanoporous AAO chip was used as a sensor system to detect serum amyloid A1, which is a lung cancer-specific biomarker. The specific reaction of the antigen-antibody contributes to the change in the RI. This in turn causes a shift in the resonance spectrum in the refractive interference pattern. The limit of detection (LOD was found to be 100 ag/mL and the biosensor had high sensitivity over a wide concentration range.
Bylanské sídliště na polykulturní lokalitě v Praze 9 - Černém Mostě
Czech Academy of Sciences Publication Activity Database
Mácalová, Michaela; Frolík, Jan
Misc. 2, - (2011), s. 137-156 ISSN 1211-5169. [Doba popelnicových polí a doba halštatská /11./. Příbram, 07.09.2010-10.09.2010] Institutional research plan: CEZ:AV0Z80020508 Keywords : Bylany culture * Prague * prehistory Subject RIV: AC - Archeology, Anthropology, Ethnology
Koppers, A. A.; Staudigel, H.; Mills, H.; Keller, M.; Wallace, A.; Bachman, N.; Helly, J.; Helly, M.; Miller, S. P.; Massell Symons, C.
2004-12-01
To bridge the gap between Earth science teachers, librarians, scientists and data archive managers, we have started the ERESE project that will create, archive and make available "Enduring Resources in Earth Science Education" through information technology (IT) portals. In the first phase of this National Science Digital Library (NSDL) project, we are focusing on the development of these ERESE resources for middle and high school teachers to be used in lesson plans with "plate tectonics" and "magnetics" as their main theme. In this presentation, we will show how these new ERESE resources are being generated, how they can be uploaded via online web wizards, how they are archived, how we make them available via the EarthRef.org Digital Archive (ERDA) and Reference Database (ERR), and how they relate to the SIOExplorer database containing data objects for all seagoing cruises carried out by the Scripps Institution of Oceanography. The EarthRef.org web resource uses the vision of a "general description" of the Earth as a geological system to provide an IT infrastructure for the Earth sciences. This emphasizes the marriage of the "scientific process" (and its results) with an educational cyber-infrastructure for teaching Earth sciences, on any level, from middle school to college and graduate levels. Eight different databases reside under EarthRef.org from which ERDA holds any digital object that has been uploaded by other scientists, teachers and students for free, while the ERR holds more than 80,000 publications. For more than 1,500 of these publications, this latter database makes available for downloading JPG/PDF images of the abstracts, data tables, methods and appendices, together with their digitized contents in Microsoft Word and Excel format. Both holdings are being used to store the ERESE objects that are being generated by a group of undergraduate students majoring in Environmental Systems (ESYS) program at the UCSD with an emphasis on the Earth Sciences
Broadband THz pulse emission and transmission properties of nanostructured Pt thin films
Energy Technology Data Exchange (ETDEWEB)
Hu, Mingzhe [Department of Physics and Electronics, Liupanshui Normal University, Liupanshui, Guizhou 553004 (China); College of Electronics and Information, Guizhou University, Huaxi 550025, Guiyang, Guizhou (China); Mu, Kaijun; Zhang, Cunlin [Department of Physics, Capital Normal University, Yuquan Road 100082, Beijing (China); Gu, Haoshuang, E-mail: guhs@hubu.edu.cn [Department of Electronic Sci& Tech, Hubei University, Xueyuan Road 430062, Wuhan, Hubei (China); Ding, Zhao [College of Electronics and Information, Guizhou University, Huaxi 550025, Guiyang, Guizhou (China)
2015-10-01
The THz transmission and emitting properties of a composite metallic nanostructure, composed of Ag nanowires electrodeposited in an anodic aluminum oxide (AAO) template and a Pt thin film, were investigated by using a femtosecond pulse laser irradiation. The microstructure of the above sub-wavelength nanostructure was investigated by XRD, SEM, AFM and TEM. The results indicated that the thickness of the Pt thin film was about 200 nm and the Ag nanowire array had a sparse and random distribution inside the AAO template, with a length distribution in the range of 10–25 μm. The THz radiation properties of above sub-wavelength nanostructure indicated that the generated THz fluence from the Pt film was a magnitude of μW scale with a broadband frequency range and its subsequent transmission could be significantly improved by the better impedance matching property of the Ag nanowire embedded AAO film compared with that of the empty AAO film.
Kim, Taegyu
2015-08-01
In the present study, nano-porous anodized aluminum oxide (AAO) was used as a support of the Pd membrane. The AAO fabrication process consists of an electrochemical polishing, first/second anodizing, barrier layer dissolving and pores widening. The Pd membrane was deposited on the AAO support using an electroless plating with ethylenediaminetetraacetic acid (EDTA) as a plating agent. The AAO had the regular pore structure with the maximum pore diameter of ~100 nm so it had a large opening area but a small free standing area. The 2 µm-thick Pd layer was obtained by the electroless plating for 3 hours. The Pd layer thickness increased with increasing the plating time. However, the thickness was limited to ~5 µm in maximum. The H2 permeation flux was 0.454 mol/m2-s when the pressure difference of 66.36 kPa0.5 was applied at the Pd membrane under 400 °C.
Water droplet evaporation from sticky superhydrophobic surfaces
Lee, Moonchan; Kim, Wuseok; Lee, Sanghee; Baek, Seunghyeon; Yong, Kijung; Jeon, Sangmin
2017-07-01
The evaporation dynamics of water from sticky superhydrophobic surfaces was investigated using a quartz crystal microresonator and an optical microscope. Anodic aluminum oxide (AAO) layers with different pore sizes were directly fabricated onto quartz crystal substrates and hydrophobized via chemical modification. The resulting AAO layers exhibited hydrophobic or superhydrophobic characteristics with strong adhesion to water due to the presence of sealed air pockets inside the nanopores. After placing a water droplet on the AAO membranes, variations in the resonance frequency and Q-factor were measured throughout the evaporation process, which were related to changes in mass and viscous damping, respectively. It was found that droplet evaporation from a sticky superhydrophobic surface followed a constant contact radius (CCR) mode in the early stage of evaporation and a combination of CCR and constant contact angle modes without a Cassie-Wenzel transition in the final stage. Furthermore, AAO membranes with larger pore sizes exhibited longer evaporation times, which were attributed to evaporative cooling at the droplet interface.
Fabrication of orderly nanostructured PLGA scaffolds using anodic aluminum oxide templates.
Wang, Gou-Jen; Lin, Yan-Cheng; Li, Ching-Wen; Hsueh, Cheng-Chih; Hsu, Shan-Hui; Hung, Huey-Shan
2009-08-01
In this research, two simple fabrication methods to fabricate orderly nanostructured PLGA scaffolds using anodic aluminum oxide (AAO) template were conducted. In the vacuum air-extraction approach, the PLGA solution was cast on an AAO template first. The vacuum air-extraction process was then applied to suck the semi-congealed PLGA into the nanopores of the AAO template to form a bamboo sprouts array of PLGA. The surface roughness of the nanostructured scaffolds, ranging from 20 nm to 76 nm, can be controlled by the sucking time of the vacuum air-extraction process. In the replica molding approach, the PLGA solution was cast on the orderly scraggy barrier-layer surface of an AAO membrane to fabricate a PLGA scaffold of concave nanostructure. Cell culture experiments using the bovine endothelial cells (BEC) demonstrated that the nanostructured PLGA membrane can increase the cell growing rate, especially for the bamboo sprouts array scaffolds with smaller surface roughness.
Fe nanodot system fabricated by non-lithographic method and its structural properties
International Nuclear Information System (INIS)
Chu Van Chiem; Nguyen Thi Thu Ha; Ngo Thi Thanh Tam; Nguyen Van Chuc; Phan Ngoc Minh; Li Huying; Seo Jae Muyng
2009-01-01
In this work, we study the magnetic structure and morphology of the Fe nanodot system fabricated by the non-lithographic method, using anodic aluminum oxide (AAO) membrane as a template. By the two-steps aluminum anodization, the AAO patterns with the hexagonal pore arrangement have been achieved. Using AAO pattern as a template, under suitable conditions we successfully deposited the iron metal in the pores by the thermal vacuum evaporation. By the exposure of the deposited system from the bottom of the AAO membrane, the hexagonal ordered Fe nanodot system has been obtained. The morphologies of the nanodot system were imaged by the Atomic Force Microscopy (AFM) and Field Emission Scanning Microscopy (FESEM) methods. The magnetic structures were investigated by the Energy Dispersive X-Ray Fluorescence Spectroscopy (EDS) and Magnetic Force Microscopy (MFM) methods. Experimental results confirmed that the MFM image of the fabricated Fe nanodot system is similar to their AFM image.
Growth of aragonite calcium carbonate nanorods in the biomimetic anodic aluminum oxide template
Lee, Inho; Han, Haksoo; Lee, Sang-Yup
2010-04-01
In this study, a biomimetic template was prepared and applied for growing calcium carbonate (CaCO 3) nanorods whose shape and polymorphism were controlled. A biomimetic template was prepared by adsorbing catalytic dipeptides into the pores of an anodic aluminum oxide (AAO) membrane. Using this peptide-adsorbed template, mineralization and aggregation of CaCO 3 was carried out to form large nanorods in the pores. The nanorods were aragonite and had a structure similar to nanoneedle assembly. This aragonite nanorod formation was driven by both the AAO template and catalytic function of dipeptides. The AAO membrane pores promoted generation of aragonite polymorph and guided nanorod formation by guiding the nanorod growth. The catalytic dipeptides promoted the aggregation and further dehydration of calcium species to form large nanorods. Functions of the AAO template and catalytic dipeptides were verified through several control experiments. This biomimetic approach makes possible the production of functional inorganic materials with controlled shapes and crystalline structures.
Bankova, A.; Videkov, V.; Tzaneva, B.; Mitov, M.
2018-03-01
We report studies on the mechanical response and deformation behavior of heat-treated nanoporous anodic alumina using a micro-balance test and experimental test equipment especially designed for this purpose. AAO samples were characterized mechanically by a three-point bending test using a micro-analytical balance. The deformation behavior was studied by repetitive mechanical bending of the AAO membranes using an electronically controlled system. The nanoporous AAO structures were prepared electrochemically from Al sheet substrates using a two-step anodizing technique in oxalic acid followed by heat treatment at 700 °C in air. The morphological study of the aluminum oxide layer after the mechanical tests and mechanical deformation was conducted using scanning electron and optical microscopy, respectively. The experimental results showed that the techniques proposed are simple and accurate; they could, therefore, be combined to constitute a method for mechanical stability assessment of nanostructured AAO films, which are important structural components in the design of MEMS devices and sensors.
Fe nanodot system fabricated by non-lithographic method and its structural properties
Energy Technology Data Exchange (ETDEWEB)
Chiem, Chu Van; Thu Ha, Nguyen Thi; Thanh Tam, Ngo Thi; Chuc, Nguyen Van; Minh, Phan Ngoc [Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay Distr., Hanoi (Viet Nam); Huying, Li; Seo Jae Muyng [Physics department, Chonbuk National University (Korea, Republic of)], E-mail: chucnv@ims.vast.ac.vn
2009-09-01
In this work, we study the magnetic structure and morphology of the Fe nanodot system fabricated by the non-lithographic method, using anodic aluminum oxide (AAO) membrane as a template. By the two-steps aluminum anodization, the AAO patterns with the hexagonal pore arrangement have been achieved. Using AAO pattern as a template, under suitable conditions we successfully deposited the iron metal in the pores by the thermal vacuum evaporation. By the exposure of the deposited system from the bottom of the AAO membrane, the hexagonal ordered Fe nanodot system has been obtained. The morphologies of the nanodot system were imaged by the Atomic Force Microscopy (AFM) and Field Emission Scanning Microscopy (FESEM) methods. The magnetic structures were investigated by the Energy Dispersive X-Ray Fluorescence Spectroscopy (EDS) and Magnetic Force Microscopy (MFM) methods. Experimental results confirmed that the MFM image of the fabricated Fe nanodot system is similar to their AFM image.
Munyaka, Ann Wambui; Makule, Edna Edward; Oey, Indrawati; Van Loey, Ann; Hendrickx, Marc
2010-05-01
The thermal stability of vitamin C (including l-ascorbic acid [l-AA] and dehydroascorbic acid [DHAA]) in crushed broccoli was evaluated in the temperature range of 30 to 90 degrees C whereas that of ascorbic acid oxidase (AAO) was evaluated in the temperature range of 20 to 95 degrees C. Thermal treatments (for 15 min) of crushed broccoli at 30 to 60 degrees C resulted in conversion of l-AA to DHAA whereas treatments at 70 to 90 degrees C retained vitamin C as l-AA. These observations indicated that enzymes (for example, AAO) could play a major role in the initial phase (that is, oxidation of l-AA to DHAA) of vitamin C degradation in broccoli. Consequently, a study to evaluate the temperature-time conditions that could result in AAO inactivation in broccoli was carried out. In this study, higher AAO activity was observed in broccoli florets than stalks. During thermal treatments for 10 min, AAO in broccoli florets and stalks was stable until around 50 degrees C. A 10-min thermal treatment at 80 degrees C almost completely inactivated AAO in broccoli. AAO inactivation followed 1st order kinetics in the temperature range of 55 to 65 degrees C. Based on this study, a thermal treatment above 70 degrees C is recommended for crushed vegetable products to prevent oxidation of l-AA to DHAA, the onset of vitamin C degradation. The results reported in this study are applicable for both domestic and industrial processing of vegetables into products such as juices, soups, and purees. In this report, we have demonstrated that processing crushed broccoli in a temperature range of 30 to 60 degrees C could result in the conversion of l-ascorbic acid to dehydroascorbic (DHAA), a very important reaction in regard to vitamin C degradation because DHAA could be easily converted to other compounds that do not have the biological activity of vitamin C.
Energy Technology Data Exchange (ETDEWEB)
Liao, M.W.; Chung, C.K., E-mail: ckchung@mail.ncku.edu.tw
2014-08-01
The porous anodic aluminum oxide (AAO) with high-aspect-ratio pore channels is widely used as a template for fabricating nanowires or other one-dimensional (1D) nanostructures. The high specific surface area of AAO can also be applied to the super capacitor and the supporting substrate for catalysis. The rough surface could be helpful to enhance specific surface area but it generally results in electrical field concentration even to ruin AAO. In this article, the aluminum (Al) films with the varied 2D–3D morphology on Si substrates were prepared using magnetron sputtering at a power of 50 W–185 W for 1 h at a working pressure of 2.5 × 10⁻¹ Pa. Then, AAO was fabricated from the different Al films by means of one-step hybrid pulse anodizing (HPA) between the positive 40 V and the negative -2 V (1 s:1 s) for 3 min in 0.3 M oxalic acid at a room temperature. The microstructure and morphology of Al films were characterized by X-ray diffraction, scanning electron microscope and atomic force microscope, respectively. Some hillocks formed at the high target power could be attributed to the grain texture growth in the normal orientation of Al(1 1 1). The 3D porous AAO structure which is different from the conventional 2D planar one has been successfully demonstrated using HPA on the film with greatly rough hillock-surface formed at the highest power of 185 W. It offers a potential application of the new 3D AAO to high specific surface area devices.
Directory of Open Access Journals (Sweden)
Sônia Weidner Maluf
2004-12-01
Full Text Available Este artigo, apresentado originalmente no Encontro da REDEFEM em outubro de 2002, discute os Dossiês publicados desde o surgimento da Revista Estudos Feministas até o presente momento, fazendo um levantamento e uma breve descrição de cada um deles. Os Dossiês constituem uma seção da REF e se dedicam à abertura de um espaço de diálogo entre a produção acadêmica e intelectual e a militância, o ativismo e as políticas feministas. Os textos podem assumir diversos formatos além de artigos ou de ensaios acadêmicos. No final deste artigo, é feita uma breve análise do lugar dos dossiês nas fricções entre academia e militância, buscando ir além das dicotomias entre ação e reflexão ou teoria e prática.This article analyzes the Dossiers of Revista Estudos Feministas. This section is published since the appearance of the journal on 1992. We describe each one of the 24 dossiers published until now and analyze it main characteristics. The main objective of the Dossiers is to establish a dialogue between the feminist academic discussions and the feminist activism and politics. They are open to different styles of text beyond the academic paper. In the end of the article we analyze the place of the dossiers in the discussions about the tensions between academy and activism, trying to go beyond the dichotomies between action and reflection or between theory and practice.
Missihoun, Tagnon D; Kotchoni, Simeon O; Bartels, Dorothea
2016-01-01
Plant aldehyde dehydrogenases (ALDHs) play important roles in cell wall biosynthesis, growth, development, and tolerance to biotic and abiotic stresses. The Reduced Epidermal Fluorescence1 is encoded by the subfamily 2C of ALDHs and was shown to oxidise coniferaldehyde and sinapaldehyde to ferulic acid and sinapic acid in the phenylpropanoid pathway, respectively. This knowledge has been gained from works in the dicotyledon model species Arabidopsis thaliana then used to functionally annotate ALDH2C isoforms in other species, based on the orthology principle. However, the extent to which the ALDH isoforms differ between monocotyledons and dicotyledons has rarely been accessed side-by-side. In this study, we used a phylogenetic approach to address this question. We have analysed the ALDH genes in Brachypodium distachyon, alongside those of other sequenced monocotyledon and dicotyledon species to examine traits supporting either a convergent or divergent evolution of the ALDH2C/REF1-type proteins. We found that B. distachyon, like other grasses, contains more ALDH2C/REF1 isoforms than A. thaliana and other dicotyledon species. Some amino acid residues in ALDH2C/REF1 isoforms were found as being conserved in dicotyledons but substituted by non-equivalent residues in monocotyledons. One example of those substitutions concerns a conserved phenylalanine and a conserved tyrosine in monocotyledons and dicotyledons, respectively. Protein structure modelling suggests that the presence of tyrosine would widen the substrate-binding pocket in the dicotyledons, and thereby influence substrate specificity. We discussed the importance of these findings as new hints to investigate why ferulic acid contents and cell wall digestibility differ between the dicotyledon and monocotyledon species.
Directory of Open Access Journals (Sweden)
Tagnon D Missihoun
Full Text Available Plant aldehyde dehydrogenases (ALDHs play important roles in cell wall biosynthesis, growth, development, and tolerance to biotic and abiotic stresses. The Reduced Epidermal Fluorescence1 is encoded by the subfamily 2C of ALDHs and was shown to oxidise coniferaldehyde and sinapaldehyde to ferulic acid and sinapic acid in the phenylpropanoid pathway, respectively. This knowledge has been gained from works in the dicotyledon model species Arabidopsis thaliana then used to functionally annotate ALDH2C isoforms in other species, based on the orthology principle. However, the extent to which the ALDH isoforms differ between monocotyledons and dicotyledons has rarely been accessed side-by-side. In this study, we used a phylogenetic approach to address this question. We have analysed the ALDH genes in Brachypodium distachyon, alongside those of other sequenced monocotyledon and dicotyledon species to examine traits supporting either a convergent or divergent evolution of the ALDH2C/REF1-type proteins. We found that B. distachyon, like other grasses, contains more ALDH2C/REF1 isoforms than A. thaliana and other dicotyledon species. Some amino acid residues in ALDH2C/REF1 isoforms were found as being conserved in dicotyledons but substituted by non-equivalent residues in monocotyledons. One example of those substitutions concerns a conserved phenylalanine and a conserved tyrosine in monocotyledons and dicotyledons, respectively. Protein structure modelling suggests that the presence of tyrosine would widen the substrate-binding pocket in the dicotyledons, and thereby influence substrate specificity. We discussed the importance of these findings as new hints to investigate why ferulic acid contents and cell wall digestibility differ between the dicotyledon and monocotyledon species.
Field emission properties of low-density carbon nanotubes prepared on anodic aluminum-oxide template
Energy Technology Data Exchange (ETDEWEB)
Jeong, Soo-Hwan [Samsung Advanced Institute of Technology, Suwon (Korea, Republic of); Lee, Kun-Hong [Pohang University of Science and Technology, Pohang (Korea, Republic of)
2004-08-15
Anodic aluminum-oxide (AAO) templates were fabricated by two-step anodizing an Al film. After the Co catalyst had been electrochemically deposited onto the bottom of the AAO template, carbon nanotubes (CNTs) were grown by using catalytic pyrolysis of C{sub 2}H{sub 2} and H{sub 2} at 650 .deg. C. Overgrowth of CNTs with low density on the AAO templates was observed. The field-emission measurements on the samples showed a turn-on field of 2.17 V/mum and a field enhancement factor of 5700. The emission pattern on a phosphor screen was quite homogeneous over the area at a relatively low electric field.
Did the American Academy of Orthopaedic Surgeons osteoarthritis guidelines miss the mark?
Bannuru, Raveendhara R; Vaysbrot, Elizaveta E; McIntyre, Louis F
2014-01-01
The American Academy of Orthopaedic Surgeons (AAOS) 2013 guidelines for knee osteoarthritis recommended against the use of viscosupplementation for failing to meet the criterion of minimum clinically important improvement (MCII). However, the AAOS's methodology contained numerous flaws in obtaining, displaying, and interpreting MCII-based results. The current state of research on MCII allows it to be used only as a supplementary instrument, not a basis for clinical decision making. The AAOS guidelines should reflect this consideration in their recommendations to avoid condemning potentially viable treatments in the context of limited available alternatives. Copyright © 2014 Arthroscopy Association of North America. Published by Elsevier Inc. All rights reserved.
Pathak, Anshuma; Bora, Achyut; Braunschweig, Björn; Meltzer, Christian; Yan, Hongdan; Lemmens, Peter; Daum, Winfried; Schwartz, Jeffrey; Tornow, Marc
2017-05-18
We report the impact of geometrical constraint on intramolecular interactions in self-assembled monolayers (SAMs) of alkylphosphonates grown on anodically oxidized aluminum (AAO). Molecular order in these films was determined by sum frequency generation (SFG) spectroscopy, a more sensitive measure of order than infrared absorption spectroscopy. Using SFG we show that films grown on AAO are, within detection limits, nearly perfectly ordered in an all-trans alkyl chain configuration. In marked contrast, films formed on planar, plasma-oxidized aluminum oxide or α-Al 2 O 3 (0001) are replete with gauche defects. We attribute these differences to the nanocylindrical structure of AAO, which enforces molecular confinement.
Surawathanawises, Krissada; Cheng, Xuanhong
2014-01-01
Nanoporous anodic aluminum oxide (AAO) has been explored for various applications due to its regular cell arrangement and relatively easy fabrication processes. However, conventional two-step anodization based on self-organization only allows the fabrication of a few discrete cell sizes and formation of small domains of hexagonally packed pores. Recent efforts to pre-pattern aluminum followed with anodization significantly improve the regularity and available pore geometries in AAO, while systematic study of the anodization condition, especially the impact of acid composition on pore formation guided by nanoindentation is still lacking. In this work, we pre-patterned aluminium thin films using ordered monolayers of silica beads and formed porous AAO in a single-step anodization in phosphoric acid. Controllable cell sizes ranging from 280 nm to 760 nm were obtained, matching the diameters of the silica nanobead molds used. This range of cell size is significantly greater than what has been reported for AAO formed in phosphoric acid in the literature. In addition, the relationships between the acid concentration, cell size, pore size, anodization voltage and film growth rate were studied quantitatively. The results are consistent with the theory of oxide formation through an electrochemical reaction. Not only does this study provide useful operational conditions of nanoindentation induced anodization in phosphoric acid, it also generates significant information for fundamental understanding of AAO formation. PMID:24535886
Energy Technology Data Exchange (ETDEWEB)
Kwon, Chang-Woo; Kim, Hyun-Mi; Kim, Ki-Bum [WCUHybrid Materials Program, Department of Materials Science and Engineering, Seoul National University, 599 Gwanak-ro, Gwanak-gu, Seoul, 151-742 (Korea, Republic of); Son, Ji-Won; Lee, Jong-Ho; Lee, Hae-Weon [High Temperature Energy Materials Center, Korea Institute of Science and Technology, 39-1, Hawolgok-dong, Seongbuk-gu, Seoul, 136-791 (Korea, Republic of)
2011-03-22
Micro-solid oxide fuel cells ({mu}-SOFCs) are fabricated on nanoporous anodic aluminum oxide (AAO) templates with a cell structure composed of a 600-nm-thick AAO free-standing membrane embedded on a Si substrate, sputter-deposited Pt electrodes (cathode and anode) and an yttria-stabilized zirconia (YSZ) electrolyte deposited by pulsed laser deposition (PLD). Initially, the open circuit voltages (OCVs) of the AAO-supported {mu}-SOFCs are in the range of 0.05 V to 0.78 V, which is much lower than the ideal value, depending on the average pore size of the AAO template and the thickness of the YSZ electrolyte. Transmission electron microscopy (TEM) analysis reveals the formation of pinholes in the electrolyte layer that originate from the porous nature of the underlying AAO membrane. In order to clog these pinholes, a 20-nm thick Al{sub 2}O{sub 3} layer is deposited by atomic layer deposition (ALD) on top of the 300-nm thick YSZ layer and another 600-nm thick YSZ layer is deposited after removing the top intermittent Al{sub 2}O{sub 3} layer. Fuel cell devices fabricated in this way manifest OCVs of 1.02 V, and a maximum power density of 350 mW cm{sup -2} at 500 C. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Fabrication and characterization of conductive anodic aluminum oxide substrates
Altuntas, Sevde; Buyukserin, Fatih
2014-11-01
Biomaterials that allow the utilization of electrical, chemical and topographic cues for improved neuron-material interaction and neural regeneration hold great promise for nerve tissue engineering applications. The nature of anodic aluminum oxide (AAO) membranes intrinsically provides delicate control over topographic and chemical cues for enhanced cell interaction; however their use in nerve regeneration is still very limited. Herein, we report the fabrication and characterization of conductive AAO (CAAO) surfaces for the ultimate goal of integrating electrical cues for improved nerve tissue behavior on the nanoporous substrate material. Parafilm was used as a protecting polymer film, for the first time, in order to obtain large area (50 cm2) free-standing AAO membranes. Carbon (C) was then deposited on the AAO surface via sputtering. Morphological characterization of the CAAO surfaces revealed that the pores remain open after the deposition process. The presence of C on the material surface and inside the nanopores was confirmed by XPS and EDX studies. Furthermore, I-V curves of the surface were used to extract surface resistance values and conductive AFM demonstrated that current signals can only be achieved where conductive C layer is present. Finally, novel nanoporous C films with controllable pore diameters and one dimensional (1-D) C nanostructures were obtained by the dissolution of the template AAO substrate.
Robinson, William P; Patel, Rupal K; Columbo, Jesse A; Flahive, Julie; Aiello, Francesco A; Baril, Donald T; Schanzer, Andres; Messina, Louis M
2016-07-01
Most existing series of acute aortic occlusion (AAO) predate the changes in surgical and endovascular therapy of the last 2 decades. We examined the contemporary management and outcomes of AAO. We reviewed consecutive patients with AAO at a tertiary referral center from 2004 to 2012. Outcomes were stratified and compared according to etiology and procedure performed. AAO in 29 patients was due to in situ thrombosis in 21 (72%) and embolism in 8 (28%) patients. Vascular patients with embolism were on average older (77 ± 7 vs. 66 ± 12 years, P = 0.02) and had higher rates of atrial fibrillation (100% vs. 20%, P = 0.0002) and congestive heart failure (75% vs. 0%, P = 0.0001) in comparison with those with in situ thrombosis. Neurologic deficit was present in 16 (55%) patients. Six patients (21%) presented with bilateral paresis/paralysis secondary to spinal cord or lumbosacral plexus ischemia, and primary neurologic etiology was investigated before vascular consultation was obtained in 4 of these 6 patients. Of the 29 patients, 28 (97%) underwent revascularization including transfemoral embolectomy (n = 6), transperitoneal aortoiliac thrombectomy (n = 2), axillobifemoral bypass (n = 10), aortobifemoral bypass (n = 6), and endovascular therapy including thrombolysis, angioplasty ± stenting (n = 4). In-hospital mortality was 31% and did not vary significantly according to etiology (embolism 38% vs. in situ thrombosis 29%, P = 0.67). In-hospital mortality varied widely according to procedure (transfemoral embolectomy 50%, aortoiliac thrombectomy 100%, axillobifemoral bypass 30%, aortobifemoral bypass 0%, and endovascular therapy 25%, P = 0.08). Major morbidity (59%), length of stay (8.6 ± 8.0 days), and discharge to a rehabilitation facility (50%) did not vary by etiology or procedure. At a media follow-up of 361 ± 460 days (range 3-2014), overall survival was 42%. There were no amputations among 20 survivors of initial
40 CFR 63.99 - Delegated Federal authorities.
2010-07-01
... Leather Tanning & Finishing TTTT X 67 Cellulose Ethers Prod. Misc. Viscose Processes UUUU X 68 Boat... (coating) RRRR X 65 Metal Coil (coating) SSSS X 66 Leather Tanning & Finishing TTTT X 67 Cellulose Ethers... QQQQ X 64 Metal Furniture (coating) RRRR X 65 Metal Coil (coating) S S S S X 66 Leather Tanning...
2012-01-30
... Special Rule for the Polar Bear AGENCY: Fish and Wildlife Service, Interior. ACTION: Final rule. SUMMARY... order in regard to Misc. No. 08- 764 (EGS) MDL Docket No. 1993 IN RE: POLAR BEAR ENDANGERED SPECIES ACT... December 16, 2008, final special rule for the polar bear (73 FR 76249). The Court further ordered that in...
Structural enzymology using X-ray free electron lasers
Directory of Open Access Journals (Sweden)
Christopher Kupitz
2017-07-01
Full Text Available Mix-and-inject serial crystallography (MISC is a technique designed to image enzyme catalyzed reactions in which small protein crystals are mixed with a substrate just prior to being probed by an X-ray pulse. This approach offers several advantages over flow cell studies. It provides (i room temperature structures at near atomic resolution, (ii time resolution ranging from microseconds to seconds, and (iii convenient reaction initiation. It outruns radiation damage by using femtosecond X-ray pulses allowing damage and chemistry to be separated. Here, we demonstrate that MISC is feasible at an X-ray free electron laser by studying the reaction of M. tuberculosis ß-lactamase microcrystals with ceftriaxone antibiotic solution. Electron density maps of the apo-ß-lactamase and of the ceftriaxone bound form were obtained at 2.8 Å and 2.4 Å resolution, respectively. These results pave the way to study cyclic and non-cyclic reactions and represent a new field of time-resolved structural dynamics for numerous substrate-triggered biological reactions.
Cruchaga, Carlos; Graff, Caroline; Chiang, Huei-Hsin; Wang, Jun; Hinrichs, Anthony L; Spiegel, Noah; Bertelsen, Sarah; Mayo, Kevin; Norton, Joanne B; Morris, John C; Goate, Alison
2011-05-01
To test whether rs1990622 (TMEM106B) is associated with age at onset (AAO) in granulin (GRN) mutation carriers and with plasma GRN levels in mutation carriers and healthy, elderly individuals. Rs1990622 (TMEM106B) was identified as a risk factor for frontotemporal lobar degeneration with TAR DNA-binding protein inclusions (FTLD-TDP) in a recent genome-wide association. Rs1990622 was genotyped in GRN mutation carriers and tested for association with AAO using the Kaplan-Meier method and a Cox proportional hazards model. Alzheimer's Disease Research Center. Subjects We analyzed 50 affected and unaffected GRN mutation carriers from 4 previously reported FTLD-TDP families (HDDD1, FD1, HDDD2, and the Karolinska family). The GRN plasma levels were also measured in 73 healthy, elderly individuals. Age at onset and GRN plasma levels. The risk allele of rs1990622 was associated with a mean decrease of the AAO of 13 years (P = 9.9 × 10(-7)) and with lower plasma GRN levels in both healthy older adults (P = 4 × 10(-4)) and GRN mutation carriers (P = .0027). Analysis of the HapMap database identified a nonsynonymous single-nucleotide polymorphism rs3173615 (T185S) in perfect linkage disequilibrium with rs1990622. The association of rs1990622 with AAO explains, in part, the wide range in the AAO of disease among GRN mutation carriers. We hypothesize that rs1990622 or another variant in linkage disequilibrium could act in a manner similar to APOE in Alzheimer disease, increasing risk for disease in the general population and modifying AAO in mutation carriers. Our results also suggest that genetic variation in TMEM106B may influence risk for FTLD-TDP by modulating secreted levels of GRN.
Macromolecular shape and interactions in layer-by-layer assemblies within cylindrical nanopores.
Lazzara, Thomas D; Lau, K H Aaron; Knoll, Wolfgang; Janshoff, Andreas; Steinem, Claudia
2012-01-01
Layer-by-layer (LbL) deposition of polyelectrolytes and proteins within the cylindrical nanopores of anodic aluminum oxide (AAO) membranes was studied by optical waveguide spectroscopy (OWS). AAO has aligned cylindrical, nonintersecting pores with a defined pore diameter d(0) and functions as a planar optical waveguide so as to monitor, in situ, the LbL process by OWS. The LbL deposition of globular proteins, i.e., avidin and biotinylated bovine serum albumin was compared with that of linear polyelectrolytes (linear-PEs), both species being of similar molecular weight. LbL deposition within the cylindrical AAO geometry for different pore diameters (d(0) = 25-80 nm) for the various macromolecular species, showed that the multilayer film growth was inhibited at different maximum numbers of LbL steps (n(max)). The value of n(max) was greatest for linear-PEs, while proteins had a lower value. The cylindrical pore geometry imposes a physical limit to LbL growth such that n(max) is strongly dependent on the overall internal structure of the LbL film. For all macromolecular species, deposition was inhibited in native AAO, having pores of d(0) = 25-30 nm. Both, OWS and scanning electron microscopy showed that LbL growth in larger AAO pores (d(0) > 25-30 nm) became inhibited when approaching a pore diameter of d(eff,n_max) = 25-35 nm, a similar size to that of native AAO pores, with d(0) = 25-30 nm. For a reasonable estimation of d(eff,n_max), the actual volume occupied by a macromolecular assembly must be taken into consideration. The results clearly show that electrostatic LbL allowed for compact macromolecular layers, whereas proteins formed loosely packed multilayers.
Porous and mesh alumina formed by anodization of high purity aluminum films at low anodizing voltage
International Nuclear Information System (INIS)
Abd-Elnaiem, Alaa M.; Mebed, A.M.; El-Said, Waleed Ahmed; Abdel-Rahim, M.A.
2014-01-01
Electrochemical oxidation of high-purity aluminum (Al) films under low anodizing voltages (1–10) V has been conducted to obtain anodic aluminum oxide (AAO) with ultra-small pore size and inter-pore distance. Different structures of AAO have been obtained e.g. nanoporous and mesh structures. Highly regular pore arrays with small pore size and inter-pore distance have been formed in oxalic or sulfuric acids at different temperatures (22–50 °C). It is found that the pore diameter, inter-pore distance and the barrier layer thickness are independent of the anodizing parameters, which is very different from the rules of general AAO fabrication. The brand formation mechanism has been revealed by the scanning electron microscope study. Regular nanopores are formed under 10 V at the beginning of the anodization and then serve as a template layer dominating the formation of ultra-small nanopores. Anodization that is performed at voltages less than 5 V leads to mesh structured alumina. In addition, we have introduced a simple one-pot synthesis method to develop thin walls of oxide containing lithium (Li) ions that could be used for battery application based on anodization of Al films in a supersaturated mixture of lithium phosphate and phosphoric acid as matrix for Li-composite electrolyte. - Highlights: • We develop anodic aluminum oxide (AAO) with small pore size and inter-pore distance. • Applying low anodizing voltages onto aluminum film leads to form mesh structures. • The value of anodizing voltage (1–10 V) has no effect on pore size or inter-pore distance. • Applying anodizing voltage less than 5 V leads to mesh structured AAO. • AAO can be used as a matrix for Li-composite electrolytes
Porous and mesh alumina formed by anodization of high purity aluminum films at low anodizing voltage
Energy Technology Data Exchange (ETDEWEB)
Abd-Elnaiem, Alaa M., E-mail: alaa.abd-elnaiem@science.au.edu.eg [KACST-Intel Consortium Center of Excellence in Nano-manufacturing Applications (CENA), Riyadh (Saudi Arabia); Physics Department, Faculty of Science, Assiut University, Assiut 71516 (Egypt); Mebed, A.M. [Physics Department, Faculty of Science, Assiut University, Assiut 71516 (Egypt); Department of Physics, Faculty of Science, Al-Jouf University, Sakaka 2014 (Saudi Arabia); El-Said, Waleed Ahmed [Department of Chemistry, Faculty of Science, Assiut University, Assiut 71516 (Egypt); Abdel-Rahim, M.A. [Physics Department, Faculty of Science, Assiut University, Assiut 71516 (Egypt)
2014-11-03
Electrochemical oxidation of high-purity aluminum (Al) films under low anodizing voltages (1–10) V has been conducted to obtain anodic aluminum oxide (AAO) with ultra-small pore size and inter-pore distance. Different structures of AAO have been obtained e.g. nanoporous and mesh structures. Highly regular pore arrays with small pore size and inter-pore distance have been formed in oxalic or sulfuric acids at different temperatures (22–50 °C). It is found that the pore diameter, inter-pore distance and the barrier layer thickness are independent of the anodizing parameters, which is very different from the rules of general AAO fabrication. The brand formation mechanism has been revealed by the scanning electron microscope study. Regular nanopores are formed under 10 V at the beginning of the anodization and then serve as a template layer dominating the formation of ultra-small nanopores. Anodization that is performed at voltages less than 5 V leads to mesh structured alumina. In addition, we have introduced a simple one-pot synthesis method to develop thin walls of oxide containing lithium (Li) ions that could be used for battery application based on anodization of Al films in a supersaturated mixture of lithium phosphate and phosphoric acid as matrix for Li-composite electrolyte. - Highlights: • We develop anodic aluminum oxide (AAO) with small pore size and inter-pore distance. • Applying low anodizing voltages onto aluminum film leads to form mesh structures. • The value of anodizing voltage (1–10 V) has no effect on pore size or inter-pore distance. • Applying anodizing voltage less than 5 V leads to mesh structured AAO. • AAO can be used as a matrix for Li-composite electrolytes.
Synthesis and magnetic properties of multilayer Ni/Cu and NiFe/Cu ...
Indian Academy of Sciences (India)
have been fabricated by pulsed electrodeposition into nanoporous alumina membrane. The diameter of wires can be ... First silver of 5000 Å thickness was thermally evaporated onto one side of AAO to serve as back ... ter the nanowires were formed, the silver electrode was removed by 6 M HNO3, and then the AAO was ...
Energy Technology Data Exchange (ETDEWEB)
Lim, S.K. [School of Advanced Science and Engineering, Sungkyunkwan University, Suwon, Gyeonggi-do 440-746 (Korea, Republic of); Jeong, G.H. [School of Advanced Science and Engineering, Sungkyunkwan University, Suwon, Gyeonggi-do 440-746 (Korea, Republic of); Park, I.S. [School of Advanced Science and Engineering, Sungkyunkwan University, Suwon, Gyeonggi-do 440-746 (Korea, Republic of); Na, S.M. [Advanced Materials and Process Research for IT, Sungkyunkwan University, Suwon, Gyeonggi-do 440-746 (Korea, Republic of)]. E-mail: nsmv2k@skku.edu; Suh, S.J. [School of Advanced Science and Engineering, Sungkyunkwan University, Suwon, Gyeonggi-do 440-746 (Korea, Republic of); Advanced Materials and Process Research for IT, Sungkyunkwan University, Suwon, Gyeonggi-do 440-746 (Korea, Republic of)
2007-03-15
An anodic aluminum oxide (AAO) template, which is filled with the Co-Pt alloys, is a promising material for high-density magnetic recording media due to its high magnetic anisotropy and high coercivity. The porous AAO templates were fabricated by the two-step anodizing of 1-{mu}m-thick Al thin film evaporated on top of the titanium layer with the thickness of 250 nm. The AAO template with pore size of approximately 60 nm and aspect ratio of 10 was obtained at voltage of 40 V, temperature of 5 deg. C, oxalic acid of 0.3 M and widening time of 55 min. Then the thickness of barrier is less than 20 nm. The Co-Pt alloy electrodeposited at pulsed current density, pH of 4 and room temperature was successfully filled in the AAO template with pore size of 80 nm and aspect ratio of 3. Then the Co-Pt alloy with Pt concentration of 45 at% was uniformly filled in the template and the coercivity of 1100 Oe was observed by VSM.
Pardo-Planas, Oscar; Atiyeh, Hasan K; Prade, Rolf A; Müller, Michael; Wilkins, Mark R
2018-05-01
An A. nidulans strain with a pyridoxine marker was used for continuous production of aryl alcohol oxidase (AAO) in a trickle bed reactor (TBR). Modified medium with reduced zinc, no copper, and 5 g/L ascorbic acid that reduced melanin production and increased AAO productivity under growth limited conditions was used. Two air flow rates, 0.11 L/min (0.1 vvm) and 1.1 L/min (1.0 vvm) were tested. More melanin formation and reduced protein productivity were observed with air flow rate of 1.1 L/min. Three random packings were used as support for the fungus inside the TBR column, two of which were hydrophobic and one which was hydrophilic, and three different dilution rates were tested. The use of GEA BCN 030 hydrophobic packing resulted in greater AAO yield and productivity than the other packings. Increasing dilution rates favored melanin formation and citric, lactic and succinic acid accumulation, which decreased AAO yield and productivity. Copyright © 2018 Elsevier Ltd. All rights reserved.
Lim, S. K.; Jeong, G. H.; Park, I. S.; Na, S. M.; Suh, S. J.
An anodic aluminum oxide (AAO) template, which is filled with the Co-Pt alloys, is a promising material for high-density magnetic recording media due to its high magnetic anisotropy and high coercivity. The porous AAO templates were fabricated by the two-step anodizing of 1-μm-thick Al thin film evaporated on top of the titanium layer with the thickness of 250 nm. The AAO template with pore size of approximately 60 nm and aspect ratio of 10 was obtained at voltage of 40 V, temperature of 5 °C, oxalic acid of 0.3 M and widening time of 55 min. Then the thickness of barrier is less than 20 nm. The Co-Pt alloy electrodeposited at pulsed current density, pH of 4 and room temperature was successfully filled in the AAO template with pore size of 80 nm and aspect ratio of 3. Then the Co-Pt alloy with Pt concentration of 45 at% was uniformly filled in the template and the coercivity of 1100 Oe was observed by VSM.
International Nuclear Information System (INIS)
Lim, S.K.; Jeong, G.H.; Park, I.S.; Na, S.M.; Suh, S.J.
2007-01-01
An anodic aluminum oxide (AAO) template, which is filled with the Co-Pt alloys, is a promising material for high-density magnetic recording media due to its high magnetic anisotropy and high coercivity. The porous AAO templates were fabricated by the two-step anodizing of 1-μm-thick Al thin film evaporated on top of the titanium layer with the thickness of 250 nm. The AAO template with pore size of approximately 60 nm and aspect ratio of 10 was obtained at voltage of 40 V, temperature of 5 deg. C, oxalic acid of 0.3 M and widening time of 55 min. Then the thickness of barrier is less than 20 nm. The Co-Pt alloy electrodeposited at pulsed current density, pH of 4 and room temperature was successfully filled in the AAO template with pore size of 80 nm and aspect ratio of 3. Then the Co-Pt alloy with Pt concentration of 45 at% was uniformly filled in the template and the coercivity of 1100 Oe was observed by VSM
Lin, Yuanjing; Lin, Qingfeng; Liu, Xue; Gao, Yuan; He, Jin; Wang, Wenli; Fan, Zhiyong
2015-12-01
Due to the broad applications of porous alumina nanostructures, research on fabrication of anodized aluminum oxide (AAO) with nanoporous structure has triggered enormous attention. While fabrication of highly ordered nanoporous AAO with tunable geometric features has been widely reported, it is known that its growth rate can be easily affected by the fluctuation of process conditions such as acid concentration and temperature during electrochemical anodization process. To fabricate AAO with various geometric parameters, particularly, to realize precise control over pore depth for scientific research and commercial applications, a controllable fabrication process is essential. In this work, we revealed a linear correlation between the integrated electric charge flow throughout the circuit in the stable anodization process and the growth thickness of AAO membranes. With this understanding, we developed a facile approach to precisely control the growth process of the membranes. It was found that this approach is applicable in a large voltage range, and it may be extended to anodization of other metal materials such as Ti as well.
Fabrication of Well-Ordered, Anodic Aluminum Oxide Membrane Using Hybrid Anodization.
Kim, Jungyoon; Ganorkar, Shraddha; Choi, Jinnil; Kim, Young-Hwan; Kim, Seong-II
2017-01-01
Anodic Aluminum Oxide (AAO) is one of the most favorable candidates for fabrication of nano-meshed membrane for various applications due to its controllable pore size and self-ordered structure. The mechanism of AAO membrane is a simple and has been studied by many research groups, however the actual fabrication of membrane has several difficulties owing to its sensitivity of ordering, long anodizing time and unclearness of the pore. In this work, we have demonstrated enhanced process of fabrication symmetric AAO membrane by using “hybrid anodizing” (Hyb-A) method which include mild anodization (MA) followed by hard anodization (HA). This Hyb-A process can give highly ordered membrane with more vivid pore than two-step anodizing process. HA was implemented on the Al plate which has been already textured by MA for more ordered structure and HA plays a key role for formation of more obvious pore in Hyb-A. Our experimental results indicate that Hyb-A with proper process sequence would be one of the fast and useful fabrication methods for the AAO membrane.
Effect of age at onset on cortical thickness and cognition in posterior cortical atrophy
Suárez-González, Aida; Lehmann, Manja; Shakespeare, Timothy J.; Yong, Keir X.X.; Paterson, Ross W.; Slattery, Catherine F.; Foulkes, Alexander J.M.; Rabinovici, Gil D.; Gil-Néciga, Eulogio; Roldán-Lora, Florinda; Schott, Jonathan M.; Fox, Nick C.; Crutch, Sebastian J.
2016-01-01
Age at onset (AAO) has been shown to influence the phenotype of Alzheimer’s disease (AD), but how it affects atypical presentations of AD remains unknown. Posterior cortical atrophy (PCA) is the most common form of atypical AD. In this study, we aimed to investigate the effect of AAO on cortical thickness and cognitive function in 98 PCA patients. We used Freesurfer (v5.3.0) to compare cortical thickness with AAO both as a continuous variable, and by dichotomizing the groups based on median age (58 years). In both the continuous and dichotomized analyses, we found a pattern suggestive of thinner cortex in precuneus and parietal areas in earlier-onset PCA, and lower cortical thickness in anterior cingulate and prefrontal cortex in later-onset PCA. These cortical thickness differences between PCA subgroups were consistent with earlier-onset PCA patients performing worse on cognitive tests involving parietal functions. Our results provide a suggestion that AAO may not only affect the clinico-anatomical characteristics in AD but may also affect atrophy patterns and cognition within atypical AD phenotypes. PMID:27318138
Directory of Open Access Journals (Sweden)
Md. Poostforush
2014-04-01
Full Text Available The properties of novel thermoconductive and optically transparent nanocomposites have been reported. The composites were prepared by the impregnation of thermoset resin into crystallized anodic aluminum oxide (AAO. Crystallized AAO synthesized by annealing amorphous AAO membrane at 1200°C. Although through-plane thermal conductivity of nanocomposites improved up to 1.13 W•m–1•K–1 (39 vol% alumina but their transparency was preserved (Tλ550 nm ~ 72%. Integrated annealed alumina phase, low refractive index mismatch between resin and alumina and formation of nano-optical fibers through the membrane resulted in such marvel combination. This report shows a great potential of these types of nanocomposites in ‘heat management’ of lightening devices.
Preparation and characterization of CuO nanowire arrays
International Nuclear Information System (INIS)
Yu Dongliang; Ge Chuannan; Du Youwei
2009-01-01
CuO nanowire arrays were prepared by oxidation of copper nanowires embedded in anodic aluminum oxide (AAO) membranes. The AAO was fabricated in an oxalic acid at a constant voltage. Copper nanowires were formed in the nanopores of the AAO membranes in an electrochemical deposition process. The oxidized copper nanowires at different temperatures were studied. X-ray diffraction patterns confirmed the formation of a CuO phase after calcining at 500 0 C in air for 30 h. A transmission electron microscopy was used to characterize the nanowire morphologies. Raman spectra were performed to study the CuO nanowire arrays. After measuring, we found that the current-voltage curve of the CuO nanowires is nonlinear.
Variable Reporting by Authors Presenting Arthroplasty Research at Multiple Annual Conferences.
Choo, Kevin J; Yi, Paul H; Burns, Robert; Mohan, Rohith; Wong, Kevin
2017-01-01
Prior studies have demonstrated discrepancies in financial conflict of interest (COI) disclosure among authors presenting research at multiple spine and sports medicine conferences. The purpose of this study was to quantify the variability of self-reported financial disclosures of individual authors presenting at multiple arthroplasty conferences during the same year. The author disclosure information published for the 2012 annual meetings of the American Academy of Orthopaedic Surgeons (AAOS), American Association of Hip and Knee Surgeons, the Hip Society, and the Knee Society were compiled. We tabulated the author disclosures, the number of companies/entities represented, and the types of disclosures reported. The disclosures made by authors presenting at more than one meeting were then compared for discrepancies. Of the 209 authors who presented at both the AAOS and American Association of Hip and Knee Surgeons meetings, 79 (37.79%) demonstrated discrepancies in their disclosures with 7 (8.8%) reporting no disclosures to the AAOS. Of the 84 authors who presented at both the AAOS and Hip Society meetings, 1 (1.19%) had discrepancies in their disclosures. Of the 52 authors who presented at both the AAOS and Knee Society meetings, 2 (3.84%) had discrepancies in their disclosures. There is variability in reported financial COIs by authors presenting at multiple arthroplasty conferences within the same year. Further work is warranted to improve transparency of COI disclosures among arthroplasty surgeons presenting research at national meetings. Copyright © 2016 Elsevier Inc. All rights reserved.
Electrochemical behavior of anodized AA6063-T6 alloys affected by matrix structures
International Nuclear Information System (INIS)
Huang, Yung-Sen; Shih, Teng-Shih; Wu, Chen-En
2013-01-01
Highlights: ► Deformation after solution treatment introduced Al matrix to have deformation bands and few Si particles. ► Dislocations remained in the matrix lift up field potential and produce AlOOH oxide in the AAO film. ► The silicon-containing particles were found to trap in the AAO film. ► The silicon particles and the Al(OOH) oxide is significantly to influence the electrochemical behavior of AAO films. - Abstract: AA 6063 alloys were cold-rolled (CR) either before or after solution treatment (S) and then different samples were artificially aged (T6) to obtain different samples (CRST6 and SCRT6). The highest dislocation density was observed in the SCRT6 sample which also showed the lowest particle count among the three samples; ST6, CRST6 and SCRT6. Subsequently, all samples were anodized in a 15 wt% sulfuric acid solution for different time spans to obtain anodic aluminum oxide (AAO) films. The anodized samples were further analyzed with X-ray Photoelectron Spectroscopy (XPS) analysis. We determined that the constituent phases in the AAO film were composed of hydrated amorphous alumina, hydrated oxide (Al(OH) 3 ) and oxyhydroxide (AlOOH) phases together with some silicon-containing particles trapped in the films on all samples. In the electrochemical test, the silicon-containing particles and hydrated Al(OH) 3 oxide that existed at the electrolyte/film (e/f) interface were found to inversely influence the corrosion resistance of the anodized samples.
Gilani, Neda; Towfighi, Jafar; Rashidi, Alimorad; Mohammadi, Toraj; Omidkhah, Mohammad Reza; Sadeghian, Ahmad
2013-04-01
Separation of H2S from binary mixtures of H2S/CH4 using vertically aligned carbon nanotube membranes fabricated in anodic aluminum oxide (AAO) template was studied experimentally. Carbon nanotubes (CNTs) were grown in five AAO templates with different pore diameters using chemical vapor deposition, and CNT/AAO membranes with tubular carbon nanotube structure and open caps were selected for separation of H2S. For this, two tubular CNT/AAO membranes were fabricated with the CNT inner diameters of 23 and 8 nm. It was found that permeability and selectivity of the membrane with inner diameter of 23 nm for CNT were independent of upstream feed pressure and H2S feed concentration unlike that of CNT having an inner diameter of 8 nm. Selectivity of these membranes for separation of H2S was obtained in the ranges of 1.36-1.58 and 2.11-2.86, for CNTs with internal diameters of 23 and 8 nm, respectively. In order to enhance the separation of H2S from H2S/CH4 mixtures, dodecylamine was used to functionalize the CNT/AAO membrane with higher selectivity. The results showed that for amido-functionalized membrane, both upstream feed pressure and H2S partial pressure in the feed significantly increased H2S permeability, and selectivity for H2S being in the range of 3.0-5.57 respectively.
Hudson, John
2016-01-01
In 2014 over 52,000 academics submitted >155,500 journal articles in 36 different disciplines for assessment in the UK?s four-year Research Evaluation Framework (the REF). In this paper the characteristics of the titles of these papers are assessed. Although these varied considerably between the disciplines, the main findings were that: (i) the lengths of the titles increased with the number of authors in almost all disciplines, (ii) the use of colons and question marks tended to decline with...
Fleuriet, A
1981-02-01
It has been shown previously that a polymorphism for two alleles of the ref(2)P locus is a regular feature of French natural populations of Drosophila melanogaster and that this is maintained in laboratory populations raised in cages. In this paper, an experimental population and egg-collection experiments are reported. Differential survival of the three genotypes would be the main factor leading to the equilibrium frequencies, working only in drastic conditions of larval competition.
Esfandi, F.; Saramad, S.
2015-07-01
In this work, a new generation of scintillator based X-ray imagers based on ZnO nanowires in Anodized Aluminum Oxide (AAO) nanoporous template is characterized. The optical response of ordered ZnO nanowire arrays in porous AAO template under low energy X-ray illumination is simulated by the Geant4 Monte Carlo code and compared with experimental results. The results show that for 10 keV X-ray photons, by considering the light guiding properties of zinc oxide inside the AAO template and suitable selection of detector thickness and pore diameter, the spatial resolution less than one micrometer and the detector detection efficiency of 66% are accessible. This novel nano scintillator detector can have many advantages for medical applications in the future.
Miranda, Luis Diego
This dissertation presents the development of novel nano-composite membranes as introduction systems for mass spectrometers. These nano-composite membranes incorporate anodic aluminum oxide (AAO) membranes as templates that can be used by themselves or modified by a variety of chemical deposition processes. Two types of nano-composite membranes are presented. The first nano-composite membrane has carbon deposited within the pores of an AAO membrane. The second nano-composite membrane is made by coating an AAO membrane with a thin polymer film. The following chapters describe the transmission properties these nano-composite membranes and compare them to conventional mass spectrometry introduction systems. The nano- composite membranes were finally coupled to the inlet system of an underwater mass spectrometer revealing their utility in field deployments.
International Nuclear Information System (INIS)
Esfandi, F.; Saramad, S.
2015-01-01
In this work, a new generation of scintillator based X-ray imagers based on ZnO nanowires in Anodized Aluminum Oxide (AAO) nanoporous template is characterized. The optical response of ordered ZnO nanowire arrays in porous AAO template under low energy X-ray illumination is simulated by the Geant4 Monte Carlo code and compared with experimental results. The results show that for 10 keV X-ray photons, by considering the light guiding properties of zinc oxide inside the AAO template and suitable selection of detector thickness and pore diameter, the spatial resolution less than one micrometer and the detector detection efficiency of 66% are accessible. This novel nano scintillator detector can have many advantages for medical applications in the future
Energy Technology Data Exchange (ETDEWEB)
McDonald, J.E.
1964-05-12
This document is divided into: byproduct horizontal control rod system (5 reactors); high-speed scanning-effluent temperature monitoring system (KE reactor); improved reactor gas system (100-KE & KW); safety circuit system modifications (5 reactors); alternate process hot die sizing, 313 Building 300 Area; button line equipment (234-5 Building); in-tank waste solidification (3rd unit); and misc. minor equipment projects.
1985-09-01
FILL. MOVE ALPHA-RESPONSE TO RESPONSE. 221C-RUN-TASKS-EXIT. EXIT. 2220-DISPLAY-TASK-MENU. PERFORM 5000- OETER -NISC-TASK-VALS. MOVE 1 TO ANSWER-FILE-KEY...INDEX-FIELD-2 ELSE MOVE 4 TO ANSWER-FILE-KEY SUBTRACT 200 FROM INDEX-FIELD-2. 5000- OETER -MISC-TASK-VALS. IF AREA-NUMBER a ŕ" MOVE 1 TO TASK-FILE-REC-NUM
Effect of age at onset on cortical thickness and cognition in posterior cortical atrophy.
Suárez-González, Aida; Lehmann, Manja; Shakespeare, Timothy J; Yong, Keir X X; Paterson, Ross W; Slattery, Catherine F; Foulkes, Alexander J M; Rabinovici, Gil D; Gil-Néciga, Eulogio; Roldán-Lora, Florinda; Schott, Jonathan M; Fox, Nick C; Crutch, Sebastian J
2016-08-01
Age at onset (AAO) has been shown to influence the phenotype of Alzheimer's disease (AD), but how it affects atypical presentations of AD remains unknown. Posterior cortical atrophy (PCA) is the most common form of atypical AD. In this study, we aimed to investigate the effect of AAO on cortical thickness and cognitive function in 98 PCA patients. We used Freesurfer (v5.3.0) to compare cortical thickness with AAO both as a continuous variable, and by dichotomizing the groups based on median age (58 years). In both the continuous and dichotomized analyses, we found a pattern suggestive of thinner cortex in precuneus and parietal areas in earlier-onset PCA, and lower cortical thickness in anterior cingulate and prefrontal cortex in later-onset PCA. These cortical thickness differences between PCA subgroups were consistent with earlier-onset PCA patients performing worse on cognitive tests involving parietal functions. Our results provide a suggestion that AAO may not only affect the clinico-anatomical characteristics in AD but may also affect atrophy patterns and cognition within atypical AD phenotypes. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.
Fabrication of free-standing copper foils covered with highly-ordered copper nanowire arrays
Zaraska, Leszek; Sulka, Grzegorz D.; Jaskuła, Marian
2012-07-01
The through-hole nanoporous anodic aluminum oxide (AAO) membranes with relatively large surface area (ca. 2 cm2) were employed for fabrication of free-standing and mechanically stable copper foils covered with close-packed and highly-ordered copper nanowire arrays. The home-made AAO membranes with different pore diameters and interpore distances were fabricated via a two-step self-organized anodization of aluminum performed in sulfuric acid, oxalic acid and phosphoric acid followed by the pore opening/widening procedure. The direct current (DC) electrodeposition of copper was performed efficiently on both sides of AAO templates. The bottom side of the AAO templates was not insulated and consequently Cu nanowire arrays on thick Cu layers were obtained. The proposed template-assisted fabrication of free-standing copper nanowire array electrodes is a promising method for synthesis of nanostructured current collectors. The composition of Cu nanowires was confirmed by energy dispersive X-Ray spectroscopy (EDS) and X-ray diffraction (XRD) analyses. The structural features of nanowires were evaluated from field emission scanning electron microscopy (FE-SEM) images and compared with the characteristic parameters of anodic alumina membranes.
Functional reconstitution of rhodopsin into tubular lipid bilayers supported by nanoporous media.
Soubias, Olivier; Polozov, Ivan V; Teague, Walter E; Yeliseev, Alexei A; Gawrisch, Klaus
2006-12-26
We report on a novel reconstitution method for G-protein-coupled receptors (GPCRs) that yields detergent-free, single, tubular membranes in porous anodic aluminum oxide (AAO) filters at concentrations sufficient for structural studies by solid-state NMR. The tubular membranes line the inner surface of pores that traverse the filters, permitting easy removal of detergents during sample preparation as well as delivery of ligands for functional studies. Reconstitution of bovine rhodopsin into AAO filters did not interfere with rhodopsin function. Photoactivation of rhodopsin in AAO pores, monitored by UV-vis spectrophotometry, was indistinguishable from rhodopsin in unsupported unilamellar liposomes. The rhodopsin in AAO pores is G-protein binding competent as shown by a [35S]GTPgammaS binding assay. The lipid-rhodopsin interaction was investigated by 2H NMR on sn-1- or sn-2-chain perdeuterated 1-stearoyl-2-docosahexaenoyl-sn-glycero-3-phospholine as a matrix lipid. Rhodopsin incorporation increased mosaic spread of bilayer orientations and contributed to spectral density of motions with correlation times in the range of nano- to microseconds, detected as a significant reduction in spin-spin relaxation times. The change in lipid chain order parameters due to interaction with rhodopsin was insignificant.
Porous Anodic Aluminum Oxide with Serrated Nanochannels
Li, Dongdong; Zhao, Liang; Lu, Jia G.
2010-03-01
Self-assembled nanoporous anodic aluminum oxide (AAO) membrane with straight channels has long been an important tool in synthesizing highly ordered and vertically aligned quasi-1D nanostructures for various applications. Recently shape-selective nanomaterials have been achieved using AAO as a template. It is envisioned that nanowires with multi-branches will significantly increase the active functional sites for applications as sensors, catalysts, chemical cells, etc. Here AAO membranes with serrated nanochannels have been successfully fabricated via a two-step annodization method. The serrated channels with periodic intervals are aligned at an angle of ˜25^circ along the stem channels. The formation of the serrated channels is attributed to the evolution of oxygen gas bubbles and the resulted plastic deformation in oxide membrane. In order to reveal the inside channel structure, Platinum are electrodeposited into the AAO template. The as-synthesized serrated Pt nanowires demonstrate a superior electrocatalytic activity. This is attributed to the enhanced electric field strength around serrated tips as shown in the electric field simulation by COMOSL. Moreover, hierarchical serrated/straight hybrid structures can be constructed using this simple and novel self assembly technique.
Fabrication of free-standing copper foils covered with highly-ordered copper nanowire arrays
International Nuclear Information System (INIS)
Zaraska, Leszek; Sulka, Grzegorz D.; Jaskuła, Marian
2012-01-01
The through-hole nanoporous anodic aluminum oxide (AAO) membranes with relatively large surface area (ca. 2 cm 2 ) were employed for fabrication of free-standing and mechanically stable copper foils covered with close-packed and highly-ordered copper nanowire arrays. The home-made AAO membranes with different pore diameters and interpore distances were fabricated via a two-step self-organized anodization of aluminum performed in sulfuric acid, oxalic acid and phosphoric acid followed by the pore opening/widening procedure. The direct current (DC) electrodeposition of copper was performed efficiently on both sides of AAO templates. The bottom side of the AAO templates was not insulated and consequently Cu nanowire arrays on thick Cu layers were obtained. The proposed template-assisted fabrication of free-standing copper nanowire array electrodes is a promising method for synthesis of nanostructured current collectors. The composition of Cu nanowires was confirmed by energy dispersive X-Ray spectroscopy (EDS) and X-ray diffraction (XRD) analyses. The structural features of nanowires were evaluated from field emission scanning electron microscopy (FE-SEM) images and compared with the characteristic parameters of anodic alumina membranes.
Chekmenev, Eduard Y; Hu, Jun; Gor'kov, Peter L; Brey, William W; Cross, Timothy A; Ruuge, Andres; Smirnov, Alex I
2005-04-01
This communication reports the first example of a high resolution solid-state 15N 2D PISEMA NMR spectrum of a transmembrane peptide aligned using hydrated cylindrical lipid bilayers formed inside nanoporous anodic aluminum oxide (AAO) substrates. The transmembrane domain SSDPLVVA(A-15N)SIIGILHLILWILDRL of M2 protein from influenza A virus was reconstituted in hydrated 1,2-dimyristoyl-sn-glycero-3-phosphatidylcholine bilayers that were macroscopically aligned by a conventional micro slide glass support or by the AAO nanoporous substrate. 15N and 31P NMR spectra demonstrate that both the phospholipids and the protein transmembrane domain are uniformly aligned in the nanopores. Importantly, nanoporous AAO substrates may offer several advantages for membrane protein alignment in solid-state NMR studies compared to conventional methods. Specifically, higher thermal conductivity of aluminum oxide is expected to suppress thermal gradients associated with inhomogeneous radio frequency heating. Another important advantage of the nanoporous AAO substrate is its excellent accessibility to the bilayer surface for exposure to solute molecules. Such high accessibility achieved through the substrate nanochannel network could facilitate a wide range of structure-function studies of membrane proteins by solid-state NMR.
Polyrhodanine modified anodic aluminum oxide membrane for heavy metal ions removal.
Song, Jooyoung; Oh, Hyuntaek; Kong, Hyeyoung; Jang, Jyongsik
2011-03-15
Polyrhodanine was immobilized onto the inner surface of anodic aluminum oxide (AAO) membrane via vapor deposition polymerization method. The polyrhodanine modified membrane was applied to remove heavy metal ions from aqueous solution because polyrhodanine could be coordinated with specific metal ions. Several parameters such as initial metal concentration, contact time and metal species were evaluated systematically for uptake efficiencies of the fabricated membrane under continuous flow condition. Adsorption isotherms of Hg(II) ion on the AAO-polyrhodanine membrane were analyzed with Langmuir and Freundlich isotherm models. The adsorption rate of Hg(II) ion on the membrane was obeyed by a pseudo-second order equation, indicating the chemical adsorption. The maximum removal capacity of Hg(II) ion onto the fabricated membrane was measured to be 4.2 mmol/g polymer. The AAO-polyrhodanine membrane had also remarkable uptake performance toward Ag(I) and Pb(II) ions. Furthermore, the polyrhodanine modified membrane could be recycled after recovery process. These results demonstrated that the polyrhodanine modified AAO membrane provided potential applications for removing the hazardous heavy metal ions from wastewater. Copyright © 2011 Elsevier B.V. All rights reserved.
Giallongo, G.; Durante, C.; Pilot, R.; Garoli, D.; Bozio, R.; Romanato, F.; Gennaro, A.; Rizzi, G. A.; Granozzi, G.
2012-08-01
Ag nanostructures are grown by AC electrodeposition on anodic alumina oxide (AAO) connected membranes acting as templates. Depending on the thickness of the template and on the voltage applied during the growth process, different Ag nanostructures with different optical properties are obtained. When AAO membranes about 1 μm thick are used, the Ag nanostructures consist in Ag nanorods, at the bottom of the pores, and Ag nanotubes departing from the nanorods and filling the pores almost for the whole length. When AAO membranes about 3 μm thick are used, the nanostructures are Ag spheroids, at the bottom of the pores, and Ag nanowires that do not reach the upper part of the alumina pores. The samples are characterized by angle resolved x-ray photoelectron spectroscopy, scanning electron microscopy and UV-vis and Raman spectroscopies. A simple NaOH etching procedure, followed by sonication in ethanol, allows one to obtain an exposed ordered array of Ag nanorods, suitable for surface-enhanced Raman spectroscopy, while in the other case (3 μm thick AAO membranes) the sample can be used in localized surface plasmon resonance sensing.
International Nuclear Information System (INIS)
Giallongo, G; Durante, C; Pilot, R; Bozio, R; Gennaro, A; Rizzi, G A; Granozzi, G; Garoli, D; Romanato, F
2012-01-01
Ag nanostructures are grown by AC electrodeposition on anodic alumina oxide (AAO) connected membranes acting as templates. Depending on the thickness of the template and on the voltage applied during the growth process, different Ag nanostructures with different optical properties are obtained. When AAO membranes about 1 μm thick are used, the Ag nanostructures consist in Ag nanorods, at the bottom of the pores, and Ag nanotubes departing from the nanorods and filling the pores almost for the whole length. When AAO membranes about 3 μm thick are used, the nanostructures are Ag spheroids, at the bottom of the pores, and Ag nanowires that do not reach the upper part of the alumina pores. The samples are characterized by angle resolved x-ray photoelectron spectroscopy, scanning electron microscopy and UV–vis and Raman spectroscopies. A simple NaOH etching procedure, followed by sonication in ethanol, allows one to obtain an exposed ordered array of Ag nanorods, suitable for surface-enhanced Raman spectroscopy, while in the other case (3 μm thick AAO membranes) the sample can be used in localized surface plasmon resonance sensing. (paper)
Critical Appraisal of Clinical Practice Guidelines for Age-Related Macular Degeneration
Directory of Open Access Journals (Sweden)
Annie M. Wu
2015-01-01
Full Text Available Purpose. To evaluate the methodological quality of age-related macular degeneration (AMD clinical practice guidelines (CPGs. Methods. AMD CPGs published by the American Academy of Ophthalmology (AAO and Royal College of Ophthalmologists (RCO were appraised by independent reviewers using the Appraisal of Guidelines for Research and Evaluation (AGREE II instrument, which comprises six domains (Scope and Purpose, Stakeholder Involvement, Rigor of Development, Clarity of Presentation, Applicability, and Editorial Independence, and an Overall Assessment score summarizing methodological quality across all domains. Results. Average domain scores ranged from 35% to 83% for the AAO CPG and from 17% to 83% for the RCO CPG. Intraclass correlation coefficients for the reliability of mean scores for the AAO and RCO CPGs were 0.74 and 0.88, respectively. The strongest domains were Scope and Purpose and Clarity of Presentation. The weakest were Stakeholder Involvement (AAO and Editorial Independence (RCO. Conclusions. Future AMD CPGs can be improved by involving all relevant stakeholders in guideline development, ensuring transparency of guideline development and review methodology, improving guideline applicability with respect to economic considerations, and addressing potential conflict of interests within the development group.
Beutel, Bryan G; Danna, Natalie R; Melamed, Eitan; Capo, John T
2015-12-01
There is growing concern that the readability of online orthopaedic patient education materials are too difficult for the general public to fully understand. It is recommended that this information be at the sixth grade reading level or lower. This study compared the readability of shoulder and elbow education articles from the American Academy of Orthopaedic Surgeons (AAOS) and American Society for Surgery of the Hand (ASSH) websites. Seventy-six patient education articles from the AAOS and ASSH concerning shoulder and elbow disorders were evaluated. Each article was assessed for the number of years since its last update, word count, percentage of passive sentences, Flesch Reading Ease score, Flesch-Kincaid grade level, Simple Measure of Gobbledygook (SMOG) grade, and New Dale-Chall grade level. Only one article was at or below the sixth grade reading level. The AAOS and ASSH articles had the following respective scores: a mean Flesch Reading Ease score of 54.3 and 51.8, Flesch-Kincaid grade level of 9.4 and 10.3, SMOG grade of 8.5 and 9.4, and New Dale-Chall grade of 10.4 and 11.0. Articles from the AAOS were longer (p education materials regarding the shoulder and elbow on the AAOS and ASSH websites have readability scores above the recommended reading level. These may be too challenging for the majority of patients to read and consequently serve as a barrier to proper patient education. Reducing the percentage of passive sentences may serve as a novel target for improving readability.
Separation of methane-nitrogen mixtures using synthesis vertically aligned carbon nanotube membranes
Gilani, Neda; Daryan, Jafar Towfighi; Rashidi, Alimorad; Omidkhah, Mohammad Reza
2012-03-01
In this paper, capabilities of carbon nanotube (CNT) membranes fabricated in cylindrical pores of anodic aluminum oxide (AAO) substrate to separate the binary mixtures of CH4/N2 are studied experimentally. For this purpose, the permeability and selectivity of three CNT/AAO membranes with different growth time as 6 h, 12 h and 18 h are investigated. CNTs are grown vertically through holes of AAO with average pore diameter of 45 nm by chemical vapor deposition (CVD) of acetylene gas. CNT/AAO membranes with the same CNTs' outer diameters and different inner diameters are synthesized. The AAO are characterized by SEM analysis. In addition, SEM, TEM, BET N2 adsorption analysis and Raman spectroscopy are employed to characterize aligned CNTs. Study on permeability and selectivity of membranes for three binary mixtures of CH4/N2 showed that when the CNT inner diameters are 34 nm and 24 nm, viscous flow is the governing mechanism and insignificant selectivities of 1.2-1.24 are achieved. However, the membrane with CNT inner diameter and wall thickness of 8 nm and 16 nm respectively is considerably selective for CH4 over N2. It was also found that CH4 mole fraction in the feed and upstream feed pressure have major effect on permeability and selectivity. The membrane with 18 h synthesis time showed the selectivity is in the range of 1.8-3.85. The enhancement factor for N2 single gas diffusivity was also found to be about three times larger than that predicted by Knudsen diffusion model.
Energy Technology Data Exchange (ETDEWEB)
Guan, Wei [NanoLAB, Department of Materials Science and Engineering, University of Sheffield, Sheffield S1 3JD (United Kingdom); School of Physics and Astronomy, University of Edinburgh, Mayfield Road, Edinburgh EH9 3JZ (United Kingdom); Peng, Nianhua, E-mail: n.peng@surrey.ac.uk [Surrey Ion Beam Centre, Surrey University, Guildford GU2 7XH (United Kingdom); Jeynes, Christopher [Surrey Ion Beam Centre, Surrey University, Guildford GU2 7XH (United Kingdom); Ghatak, Jay [NanoLAB, Department of Materials Science and Engineering, University of Sheffield, Sheffield S1 3JD (United Kingdom); Peng, Yong [NanoLAB, Department of Materials Science and Engineering, University of Sheffield, Sheffield S1 3JD (United Kingdom); School of Physical Science and Technology, Lanzhou University, 222 Tianshui Road, Lanzhou 730000 (China); Ross, Ian M. [Department of Electronic and Electric Engineering, University of Sheffield, Sheffield S1 3JD (United Kingdom); Bhatta, Umananda M.; Inkson, Beverley J.; Möbus, Günter [NanoLAB, Department of Materials Science and Engineering, University of Sheffield, Sheffield S1 3JD (United Kingdom)
2013-07-15
Lateral ordered Co, Pt and Co/Pt nanostructures were fabricated in SiO{sub 2} and Si{sub 3}N{sub 4} substrates by high fluence metal ion implantation through periodic nanochannel membrane masks based on anodic aluminium oxides (AAO). The quality of nanopatterning transfer defined by various AAO masks in different substrates was examined by transmission electron microscopy (TEM) in both imaging and spectroscopy modes.
2008-06-01
on anodized aluminum oxide ( AAO ) templates[1,2] with further tailored nano-magnet configurations will also be discussed. For evaluation of ultra...North Carolina State University, Raleigh, North Carolina. Unlike other nanoporous membranes , nanoporous alumina (also known as anodized aluminum oxide ... oxide ( AAO ) membrane is used as the template with gallium indium (Gain) as a seed layer. After fabrication, the nanowires are removed from the template
Selective Functionalization of Arbitrary Nanowires
2006-11-02
3-mercaptopropyl)- trimethoxysilane (MPTMS). The wires were grown electrochemically in anodic aluminum oxide ( AAO ) templates. Selective deposition...In the past, templates composed of polycarbonate track-etched membranes or anodic aluminum oxide materials have been used for the construction of...modifier MPTMS was used to function- alize the AAO template because it can form covalent bonds with silanes and metal oxide surfaces21 and because of
International Nuclear Information System (INIS)
Li Xueming; Dong Kun; Tang Libin; Wu, Yongjun; Yang Peizhi; Zhang Pengxiang
2010-01-01
Vertical-aligned Ag nanoflake arrays are fabricated on the surface of an anodic aluminum oxide (AAO) template under a hydrothermal condition for the first time. The porous surface of AAO templates and the precursor solution may play key roles in the process of fabricating Ag nanoflakes. The rim of pores can provide many active sites for nucleation and growth, and then nanoflake arrays gradually form through self-assembly of Ag on the surface of AAO membranes. The product is characterized by X-ray diffraction (XRD) and scanning electron microscopy (SEM), and a growth mechanism of nanoflake is deduced. This work demonstrates that it is possible to make ordered nanoarrays without dissolving templates using the hydrothermal method, and this interesting Ag nanoflake arrays may provide a wider range of nanoscale applications.
Flexible anodized aluminum oxide membranes with customizable back contact materials.
Nadimpally, B; Jarro, C A; Mangu, R; Rajaputra, S; Singh, V P
2016-12-16
Anodized aluminum oxide (AAO) membranes were fabricated using flexible substrate/carrier material. This method facilitates the use of AAO templates with many different materials as substrates that are otherwise incompatible with most anodization techniques. Thin titanium (Ti) and tungsten (W) layers were employed as interlayer materials. Titanium enhances adhesion. Tungsten not only helps eliminate the barrier layer but also plays a critical role in enabling the use of flexible substrates. The resulting flexible templates provide new, exciting opportunities in photovoltaic and other device applications. CuInSe 2 nanowires were electrochemically deposited into porous AAO templates with molybdenum (Mo) as the back contact material. The feasibility of using any material to form a contact with semiconductor nanowires has been demonstrated for the first time enabling new avenues in photovoltaic applications.
Li, Xueming; Dong, Kun; Tang, Libin; Wu, Yongjun; Yang, Peizhi; Zhang, Pengxiang
2010-02-01
Vertical-aligned Ag nanoflake arrays are fabricated on the surface of an anodic aluminum oxide (AAO) template under a hydrothermal condition for the first time. The porous surface of AAO templates and the precursor solution may play key roles in the process of fabricating Ag nanoflakes. The rim of pores can provide many active sites for nucleation and growth, and then nanoflake arrays gradually form through self-assembly of Ag on the surface of AAO membranes. The product is characterized by X-ray diffraction (XRD) and scanning electron microscopy (SEM), and a growth mechanism of nanoflake is deduced. This work demonstrates that it is possible to make ordered nanoarrays without dissolving templates using the hydrothermal method, and this interesting Ag nanoflake arrays may provide a wider range of nanoscale applications.
Ryu, Seong Ho; Gim, Min-Jun; Lee, Wonsuk; Choi, Suk-Won; Yoon, Dong Ki
2017-01-25
Photonic crystals (PCs) have recently attracted considerable attention, with much effort devoted to photonic bandgap (PBG) control for varying the reflected color. Here, fabrication of a modulated one-dimensional (1D) anodic aluminum oxide (AAO) PC with a periodic porous structure is reported. The PBG of the fabricated PC can be reversibly changed by switching the ultraviolet (UV) light on/off. The AAO nanopores contain a mixture of photoresponsive liquid crystals (LCs) with irradiation-activated cis/trans photoisomerizable azobenzene. The resultant mixture of LCs in the porous AAO film exhibits a reversible PBG, depending on the cis/trans configuration of azobenzene molecules. The PBG switching is reliable over many cycles, suggesting that the fabricated device can be used in optical and photonic applications such as light modulators, smart windows, and sensors.
Flexible anodized aluminum oxide membranes with customizable back contact materials
Nadimpally, B.; Jarro, C. A.; Mangu, R.; Rajaputra, S.; Singh, V. P.
2016-12-01
Anodized aluminum oxide (AAO) membranes were fabricated using flexible substrate/carrier material. This method facilitates the use of AAO templates with many different materials as substrates that are otherwise incompatible with most anodization techniques. Thin titanium (Ti) and tungsten (W) layers were employed as interlayer materials. Titanium enhances adhesion. Tungsten not only helps eliminate the barrier layer but also plays a critical role in enabling the use of flexible substrates. The resulting flexible templates provide new, exciting opportunities in photovoltaic and other device applications. CuInSe2 nanowires were electrochemically deposited into porous AAO templates with molybdenum (Mo) as the back contact material. The feasibility of using any material to form a contact with semiconductor nanowires has been demonstrated for the first time enabling new avenues in photovoltaic applications.
Enhancing Space Situational Awareness using a 3U CubeSat with Optical Imager
2010-12-01
53 viii THIS PAGE INTENTIONALLY LEFT BLANK ix LIST OF FIGURES Figure 1. Miniature Imaging Spacecraft, Pumpkin Inc.(From [1...for the payload, the Miniature Imaging Spacecraft (MISC) from Pumpkin , Inc. Figure 1. Miniature Imaging Spacecraft, Pumpkin Inc.(From [1]) In...component of relative velocity is calculated by taking the dot product of the relative velocity and 12R [19], as shown in Equation 1. The
2013-03-01
Congressional Research Service, U.S. International Borders: Brief Facts, Janice Cheryl Beaver , RS21729 (Washington, DC: Government Printing Office, November 9...and the opportunity to utilize the breadth of smuggling options for transportation. The commercial prevalence of radiological material and the...Janice Cheryl Beaver . RS21729. Washington, DC: Government Printing Office November 9, 2006. http://www.fas.org/sgp/crs/misc/RS21729.pdf (accessed
Ultrafast excited state deactivation of doped porous anodic alumina membranes
International Nuclear Information System (INIS)
Makhal, Abhinandan; Sarkar, Soumik; Pal, Samir Kumar; Yan, Hongdan; Wulferding, Dirk; Cetin, Fatih; Lemmens, Peter
2012-01-01
Free-standing, bi-directionally permeable and ultra-thin anodic aluminum oxide (AAO) membranes establish attractive templates (host) for the synthesis of nano-dots and rods of various materials (guest). This is due to their chemical and structural integrity and high periodicity on length scales of 5–150 nm which are often used to host photoactive nano-materials for various device applications including dye-sensitized solar cells. In the present study, AAO membranes are synthesized by using electrochemical methods and a detailed structural characterization using FEG-SEM, XRD and TGA confirms the porosity and purity of the material. Defect-mediated photoluminescence quenching of the porous AAO membrane in the presence of an electron accepting guest organic molecule (benzoquinone) is studied by means of steady-state and picosecond/femtosecond-resolved luminescence measurements. Using time-resolved luminescence transients, we have also revealed light harvesting of complexes of porous alumina impregnated with inorganic quantum dots (Maple Red) or gold nanowires. Both the Förster resonance energy transfer and the nano-surface energy transfer techniques are employed to examine the observed quenching behavior as a function of the characteristic donor–acceptor distances. The experimental results will find their relevance in light harvesting devices based on AAOs combined with other materials involving a decisive energy/charge transfer dynamics. (paper)
Fabrication of Nano-Micro Hybrid Structures by Replication and Surface Treatment of Nanowires
Directory of Open Access Journals (Sweden)
Yeonho Jeong
2017-07-01
Full Text Available Nanowire structures have attracted attention in various fields, since new characteristics could be acquired in minute regions. Especially, Anodic Aluminum Oxide (AAO is widely used in the fabrication of nanostructures, which has many nanosized pores and well-organized nano pattern. Using AAO as a template for replication, nanowires with a very high aspect ratio can be fabricated. Herein, we propose a facile method to fabricate a nano-micro hybrid structure using nanowires replicated from AAO, and surface treatment. A polymer resin was coated between Polyethylene terephthalate (PET and the AAO filter, roller pressed, and UV-cured. After the removal of aluminum by using NaOH solution, the nanowires aggregated to form a micropattern. The resulting structure was subjected to various surface treatments to investigate the surface behavior and wettability. As opposed to reported data, UV-ozone treatment can enhance surface hydrophobicity because the UV energy affects the nanowire surface, thus altering the shape of the aggregated nanowires. The hydrophobicity of the surface could be further improved by octadecyltrichlorosilane (OTS coating immediately after UV-ozone treatment. We thus demonstrated that the nano-micro hybrid structure could be formed in the middle of nanowire replication, and then, the shape and surface characteristics could be controlled by surface treatment.
Ultrafast excited state deactivation of doped porous anodic alumina membranes
Makhal, Abhinandan; Sarkar, Soumik; Pal, Samir Kumar; Yan, Hongdan; Wulferding, Dirk; Cetin, Fatih; Lemmens, Peter
2012-08-01
Free-standing, bi-directionally permeable and ultra-thin anodic aluminum oxide (AAO) membranes establish attractive templates (host) for the synthesis of nano-dots and rods of various materials (guest). This is due to their chemical and structural integrity and high periodicity on length scales of 5-150 nm which are often used to host photoactive nano-materials for various device applications including dye-sensitized solar cells. In the present study, AAO membranes are synthesized by using electrochemical methods and a detailed structural characterization using FEG-SEM, XRD and TGA confirms the porosity and purity of the material. Defect-mediated photoluminescence quenching of the porous AAO membrane in the presence of an electron accepting guest organic molecule (benzoquinone) is studied by means of steady-state and picosecond/femtosecond-resolved luminescence measurements. Using time-resolved luminescence transients, we have also revealed light harvesting of complexes of porous alumina impregnated with inorganic quantum dots (Maple Red) or gold nanowires. Both the Förster resonance energy transfer and the nano-surface energy transfer techniques are employed to examine the observed quenching behavior as a function of the characteristic donor-acceptor distances. The experimental results will find their relevance in light harvesting devices based on AAOs combined with other materials involving a decisive energy/charge transfer dynamics.
Li, Shou-Yi; Wang, Jian; Li, Yan
2017-06-01
Highly ordered anodic aluminum oxide (AAO) membranes are fabricated electrochemically in an electrolyte mixture with various concentrations of C2H2O4 or NH4F. Photoluminescence (PL) properties of AAO membranes have been investigated before and after annealing in the range from 300°C to 650°C. X-ray diffraction reveals the amorphous nature of AAO membranes. Energy dispersive spectroscopy indicates the presence of fluorine species incorporated in oxide membranes during the anodizing. PL measurements show a strong PL band in the wavelength range of 350 to 550 nm. With the increase of the concentration of the NH4F or C2H2O4 in the electrolyte mixture, the peak positions of the PL bands have a blueshift or redshift and the intensities have a maximum value. As indicated by the PL excitation spectra, there are two excitation peaks of 285 and 330 nm, which can account for the PL emission band. We have proposed that the PL originates from optical transitions in two kinds of centers that are related to oxygen vacancies, F+ (285 nm) and F (330 nm). This work is not only beneficial to further understanding of the light-emitting property of AAO membranes but also enlarges the application scope.
Ultrafast excited state deactivation of doped porous anodic alumina membranes
Energy Technology Data Exchange (ETDEWEB)
Makhal, Abhinandan; Sarkar, Soumik; Pal, Samir Kumar [Department of Chemical, Biological and Macromolecular Sciences, S N Bose National Centre for Basic Sciences, Block JD, Sector III, Salt Lake, Kolkata 700 098 (India); Yan, Hongdan; Wulferding, Dirk; Cetin, Fatih; Lemmens, Peter [Institute for Condensed Matter Physics, TU Braunschweig, Mendelssohnstrasse 3, 38106 Braunschweig (Germany)
2012-08-03
Free-standing, bi-directionally permeable and ultra-thin anodic aluminum oxide (AAO) membranes establish attractive templates (host) for the synthesis of nano-dots and rods of various materials (guest). This is due to their chemical and structural integrity and high periodicity on length scales of 5-150 nm which are often used to host photoactive nano-materials for various device applications including dye-sensitized solar cells. In the present study, AAO membranes are synthesized by using electrochemical methods and a detailed structural characterization using FEG-SEM, XRD and TGA confirms the porosity and purity of the material. Defect-mediated photoluminescence quenching of the porous AAO membrane in the presence of an electron accepting guest organic molecule (benzoquinone) is studied by means of steady-state and picosecond/femtosecond-resolved luminescence measurements. Using time-resolved luminescence transients, we have also revealed light harvesting of complexes of porous alumina impregnated with inorganic quantum dots (Maple Red) or gold nanowires. Both the Foerster resonance energy transfer and the nano-surface energy transfer techniques are employed to examine the observed quenching behavior as a function of the characteristic donor-acceptor distances. The experimental results will find their relevance in light harvesting devices based on AAOs combined with other materials involving a decisive energy/charge transfer dynamics. (paper)
A Macroporous TiO2 Oxygen Sensor Fabricated Using Anodic Aluminium Oxide as an Etching Mask
Directory of Open Access Journals (Sweden)
Sheng-Po Wu
2010-01-01
Full Text Available An innovative fabrication method to produce a macroporous Si surface by employing an anodic aluminium oxide (AAO nanopore array layer as an etching template is presented. Combining AAO with a reactive ion etching (RIE processes, a homogeneous and macroporous silicon surface can be effectively configured by modulating AAO process parameters and alumina film thickness, thus hopefully replacing conventional photolithography and electrochemical etch methods. The hybrid process integration is considered fully CMOS compatible thanks to the low-temperature AAO and CMOS processes. The gas-sensing characteristics of 50 nm TiO2 nanofilms deposited on the macroporous surface are compared with those of conventional plain (or non-porous nanofilms to verify reduced response noise and improved sensitivity as a result of their macroporosity. Our experimental results reveal that macroporous geometry of the TiO2 chemoresistive gas sensor demonstrates 2-fold higher (~33% improved sensitivity than a non-porous sensor at different levels of oxygen exposure. In addition, the macroporous device exhibits excellent discrimination capability and significantly lessened response noise at 500 °C. Experimental results indicate that the hybrid process of such miniature and macroporous devices are compatible as well as applicable to integrated next generation bio-chemical sensors.
Yang, Fuzhong; Li, Yihan; Xie, Dong; Shao, Chunhong; Ren, Jianer; Wu, Wenyuan; Zhang, Ning; Zhang, Zhen; Zou, Ying; Zhang, Jiulong; Qiao, Dongdong; Gao, Chengge; Li, Youhui; Hu, Jian; Deng, Hong; Wang, Gang; Du, Bo; Wang, Xumei; Liu, Tiebang; Gan, Zhaoyu; Peng, Juyi; Wei, Bo; Pan, Jiyang; Chen, Honghui; Sun, Shufan; Jia, Hong; Liu, Ying; Chen, Qiaoling; Wang, Xueyi; Cao, Juling; Lv, Luxian; Chen, Yunchun; Ha, Baowei; Ning, Yuping; Chen, YiPing; Kendler, Kenneth S.; Flint, Jonathan; Shi, Shenxun
2011-01-01
Background Individuals with early-onset depression may be a clinically distinct group with particular symptom patterns, illness course, comorbidity and family history. This question has not been previously investigated in a Han Chinese population. Methods We examined the clinical features of 1970 Han Chinese women with DSM-IV major depressive disorder (MDD) between 30 and 60 years of age across China. Analysis of linear, logistic and multiple logistic regression models was used to determine the association between age at onset (AAO) with continuous, binary and discrete characteristic clinical features of MDD. Results Earlier AAO was associated with more suicidal ideation and attempts and higher neuroticism, but fewer sleep, appetite and weight changes. Patients with an earlier AAO were more likely to suffer a chronic course (longer illness duration, more MDD episodes and longer index episode), increased rates of MDD in their parents and a lower likelihood of marriage. They tend to have higher comorbidity with anxiety disorders (general anxiety disorder, social phobia and agoraphobia) and dysthymia. Conclusions Early AAO in MDD may be an index of a more severe, highly comorbid and familial disorder. Our findings indicate that the features of MDD in China are similar to those reported elsewhere in the world. PMID:21782247
Yang, Fuzhong; Li, Yihan; Xie, Dong; Shao, Chunhong; Ren, Jianer; Wu, Wenyuan; Zhang, Ning; Zhang, Zhen; Zou, Ying; Zhang, Jiulong; Qiao, Dongdong; Gao, Chengge; Li, Youhui; Hu, Jian; Deng, Hong; Wang, Gang; Du, Bo; Wang, Xumei; Liu, Tiebang; Gan, Zhaoyu; Peng, Juyi; Wei, Bo; Pan, Jiyang; Chen, Honghui; Sun, Shufan; Jia, Hong; Liu, Ying; Chen, Qiaoling; Wang, Xueyi; Cao, Juling; Lv, Luxian; Chen, Yunchun; Ha, Baowei; Ning, Yuping; Chen, Yiping; Kendler, Kenneth S; Flint, Jonathan; Shi, Shenxun
2011-12-01
Individuals with early-onset depression may be a clinically distinct group with particular symptom patterns, illness course, comorbidity and family history. This question has not been previously investigated in a Han Chinese population. We examined the clinical features of 1970 Han Chinese women with DSM-IV major depressive disorder (MDD) between 30 and 60 years of age across China. Analysis of linear, logistic and multiple logistic regression models was used to determine the association between age at onset (AAO) with continuous, binary and discrete characteristic clinical features of MDD. Earlier AAO was associated with more suicidal ideation and attempts and higher neuroticism, but fewer sleep, appetite and weight changes. Patients with an earlier AAO were more likely to suffer a chronic course (longer illness duration, more MDD episodes and longer index episode), increased rates of MDD in their parents and a lower likelihood of marriage. They tend to have higher comorbidity with anxiety disorders (general anxiety disorder, social phobia and agoraphobia) and dysthymia. Early AAO in MDD may be an index of a more severe, highly comorbid and familial disorder. Our findings indicate that the features of MDD in China are similar to those reported elsewhere in the world. Copyright © 2011 Elsevier B.V. All rights reserved.
A cultura musical erudita na universidade: refúgio, resistência e expectativas
Directory of Open Access Journals (Sweden)
José Eduardo Martins
1993-08-01
Full Text Available O ensino musical do Brasil Colônia à atualidade. A decadência dos conservatórios. A música na Universidade: graduação e pós-graduação; publicações; gravações. A performance musical e a pesquisa, dentro e fora da Universidade. Progressões da cultura musical erudita: aritmética (decrescente e geométrica (ascendente. Governo (voto, iniciativa privada (lucro, mídia (massa receptiva: inter-relacionamento pragmático resultando o desmonte da cultura musical erudita. Impasse da crítica musical. Eventos internacionais no Brasil e a malversação de verbas. Festivais de música: comparações. Músico brasileiro: sobreviver na concessão ou resistir na qualidade? Despreparo cultural do homem público, do empresário e do agente cultural. A Universidade como refúgio da cultura musical erudita.The musical training from Colonial Brazil to the present. The fall of the conservatory. The University: under graduate musical studies and graduate studies; publications; recordings. The musical performance research within and out of the University. Arithmetic progression (descending of the erudite musical culture and geometric progression (ascending of the mass musical culture. Government (vote, private iniciative (profit, media (mass reception : pragmatic interrelations, resulting in the dismanting of the erudite musical culture. Check of musical critique. International events in Brazil and misuse of funds. Musical festivals: comparisons. Brazilian musicians: surviving by catering to the market or insisting on quality? Cultural dispreparation of the politician: Business man and musical manager. The University as refuge of the erudite musical culture.
Self-Ordered Nanoporous Alumina Templates Formed by Anodization of Aluminum in Oxalic Acid
Vida-Simiti, Ioan; Nemes, Dorel; Jumate, Nicolaie; Thalmaier, Gyorgy; Sechel, Niculina
2012-10-01
Anodic aluminum oxide (AAO) membranes with highly ordered nanopores serve as ideal templates for the formation of various nanostructured materials. The procedure of the template preparation is based on a two-step self-organized anodization of aluminum. In the current study, AAO templates were fabricated in 0.3 M oxalic acid under the anodizing potential range of 30-60 V at an electrolyte temperature of ~5°C. The AAO templates were analyzed using scanning electron microscopy, x-ray diffraction, Fourier-transform infrared spectroscopy, and differential thermal analysis. The as obtained layers are amorphous; the mean pore size is between 40 nm and 75 nm and increases with the increase of the anodization potential. Well-defined pores across the whole aluminum template, a pore density of ~1010 pores/cm2, and a tendency to form a porous structure with hexagonal symmetry were observed.
Filtering of canted magnetic phase of SpFeMn(C2O4)3 in membrane nanopores
International Nuclear Information System (INIS)
Dmitriev, A.I.; Morgunov, R.B.
2015-01-01
Ordered arrays of nanowires of pure SpFeMn(C 2 O 4 ) 3 collinear antiferromagnet have been synthesized in pores of anodized aluminum oxide (AAO) 20 nm and 200 nm in diameter. It was found that the growth of spin-canted phase presented in the bulk samples is suppressed in nanowires. The decrease in the nanowires diameter results in magneto-crystalline anisotropy increase. - Highlights: • The method for separation of two magnetic phases of SpFeMn(C 2 O 4 ) 3 was developed. • Nanowires of collinear antiferromagnet SpFeMn(C 2 O 4 ) 3 was synthesized in pores of AAO. • Suppression of canted phase presented in the bulk samples was found in nanowires. • Magnetic anisotropy indicates monocrystallinity of nanowires grown in AAO pores. • The decrease of nanowires diameter results in magnetocrystalline anisotropy increase
Yeo, Jin-Ho; Lee, Sung-Gap; Jo, Ye-Won; Jung, Hye-Rin
2015-11-01
We fabricated electrolyte-dielectric-metal (EDM) device incorporating a high-k Al2O3 sensing membrane from a porous anodic aluminum oxide (AAO) using a two step anodizing process for pH sensors. In order to change the properties of the AAO template, the crystallizing temperature was varied from 400 degrees C to 700 degrees C over 2 hours. The structural properties were observed by field emission scanning electron microscopy (FE-SEM). The pH sensitivity increased with an increase in the crystallizing temperature from 400 degrees C to 600 degrees C. However at 700 degrees C, deformation occurred. The porous AAO sensor with a crystallizing temperature of 600 degrees C displayed the good sensitivity and long-term stability and the values were 55.7 mV/pH and 0.16 mV/h, respectively.
Dentistry's oldest specialty: orthodontics and dentofacial orthopedics.
George, Raymond
2009-01-01
The American Association of Orthodontists (AAO) has 15,500 members worldwide and is the oldest and largest of the recognized dental specialties. A strategic planning process has identified six key challenges, and this article describes the progress that is being made in the areas of (a) consumer education, (b) volunteer leadership development, (c) recruitment and retention of orthodontic educators, (d) relationships with ADA and other healthcare organizations, (e) the AAO's role in international orthodontics, and (f) advocacy. The AAO is working for freedom of choice in dental healthcare providers; fee-for-service dental care; orthodontic insurance coverage as a benefit of employment, with direct reimbursement as the preferred plan; self-referred access to specialists; private and public funding that promote quality orthodontic care; and the retention of tax deductibility of dental healthcare benefits, including orthodontic care.
Woltjer, L.
1987-06-01
En la reunion celebrada en diciembre dei ano pasado informe al Consejo de mi deseo de terminar mi contrato como Director General de la ESO una vez que fuera aprobado el proyecto dei VLT, que se espera sucedera hacia fines de este aAo. Cuando fue renovada mi designacion hace tres aAos, el Consejo conocia mi intencion de no completar los cinco aAos dei contrato debido a mi deseo de disponer de mas tiempo para otras actividades. Ahora, una vez terminada la fase preparatoria para el VLT, Y habiendose presentado el proyecto formalmente al Consejo el dia 31 de marzo, y esperando su muy probable aprobacion antes dei termino de este ano, me parece que el 10 de enero de 1988 presenta una excelente fecha para que se produzca un cambio en la administracion de la ESO.
Revisiting the description of Protein-Protein interfaces. Part II: Experimental study
Cazals , Frédéric; Proust , Flavien
2006-01-01
This paper provides a detailed experimental study of an interface model developed in the companion article F. Cazals and F. Proust, Revisiting the description of Protein-Protein interfaces. Part I: algorithms. Our experimental study is concerned with the usual database of protein-protein complexes, split into five families (Proteases, Immune system, Enzyme Complexes, Signal transduction, Misc.) Our findings, which bear some contradictions with usual statements are the following: (i)Connectivi...
Lopez-Escamez, José A; Carey, John; Chung, Won-Ho; Goebel, Joel A; Magnusson, Måns; Mandalà, Marco; Newman-Toker, David E; Strupp, Michael; Suzuki, Mamoru; Trabalzini, Franco; Bisdorff, Alexandre
2016-01-01
This paper presents diagnostic criteria for Menière's disease jointly formulated by the Classification Committee of the Bárány Society, The Japan Society for Equilibrium Research, the European Academy of Otology and Neurotology (EAONO), the Equilibrium Committee of the American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS) and the Korean Balance Society. The classification includes 2 categories: definite Menière's disease and probable Menière's disease. The diagnosis of definite Menière's disease is based on clinical criteria and requires the observation of an episodic vertigo syndrome associated with low-to medium-frequency sensorineural hearing loss and fluctuating aural symptoms (hearing, tinnitus and/or fullness) in the affected ear. Duration of vertigo episodes is limited to a period between 20 min and 12h. Probable Menière's disease is a broader concept defined by episodic vestibular symptoms (vertigo or dizziness) associated with fluctuating aural symptoms occurring in a period from 20 min to 24h. Copyright © 2015 Elsevier España, S.L.U. and Sociedad Española de Otorrinolaringología y Patología Cérvico-Facial. All rights reserved.
Ordered metal nanotube arrays fabricated by PVD.
Marquez, F; Morant, C; Campo, T; Sanz, J M; Elizalde, E
2010-02-01
In this work we report a simple method to fabricate ordered arrays of metal nanotubes. This method is based on the deposition of a metal by PVD onto an anodized aluminum oxide (AAO) template. The dimensions of the synthesized nanotubes depend both on the AAO template and on the deposited metal. In fact, it is observed that the aspect ratios of the nanotubes clearly depend significantly on the metal, ranging from 0.6 (Fe) to at least 3 (Zr).
Chen, Yung Ting; Chen, Yang Fang
2010-03-01
A new approach for developing highly sensitive PMOS photodetector based on the assistance of AAO membrane is proposed, fabricated, and characterized. It enables the photodetector with the tunability of not only the intensity but also the range of the response. Under a forward bias, the response of the PMOS photodetector with AAO membrane covers the visible as well as infrared spectrum; however, under a reverse bias, the near-infrared light around Si band edge dominates the photoresponse. Notably, the response at the optical communication wavelength of 850 nm can reach up to 0.24 A/W with an external quantum efficiency of 35%. Moreover, the response shows a large enhancement factor of 10 times at 1050 nm under a reverse bias of 0.5 V comparing with the device without AAO membrane. The underlying mechanism for the novel properties of the newly designed device has been proposed.
Kim, Hanim; Ryu, Seong Ho; Tuchband, Michael; Shin, Tae Joo; Korblova, Eva; Walba, David M; Clark, Noel A; Yoon, Dong Ki
2017-02-01
A lamellar liquid crystal (LC) phase of certain bent-core mesogenic molecules can be grown in a manner that generates a single chiral helical nanofilament in each of the cylindrical nanopores of an anodic aluminum oxide (AAO) membrane. By introducing guest molecules into the resulting composite chiral nanochannels, we explore the structures and functionality of the ordered guest/host LC complex, verifying the smectic-like positional order of the fluidic nematic LC phase, which is obtained by the combination of the LC organization and the nanoporous AAO superstructure. The guest nematic LC 4'- n -pentyl-4-cyanobiphenyl is found to form a distinctive fluid layered ordered LC complex at the nanofilament/guest interface with the host 1,3-phenylene bis[4-(4-nonyloxyphenyliminomethyl)benzoate], where this interface contacts the AAO cylinder wall. Filament growth form is strongly influenced by mixture parameters and pore dimensions.
Synthesis of Various Metal/TiO2 Core/shell Nanorod Arrays
Zhu, Wei; Wang, Guan-zhong; Hong, Xun; Shen, Xiao-shuang
2011-02-01
We present a general approach to fabricate metal/TiO2 core/shell nanorod structures by two-step electrodeposition. Firstly, TiO2 nanotubes with uniform wall thickness are prepared in anodic aluminum oxide (AAO) membranes by electrodeposition. The wall thickness of the nanotubes could be easily controlled by modulating the deposition time, and their outer diameter and length are only limited by the channel diameter and the thickness of the AAO membranes, respectively. The nanotubes' tops prepared by this method are open, while the bottoms are connected directly with the Au film at the back of the AAO membranes. Secondly, Pd, Cu, and Fe elements are filled into the TiO2 nanotubes to form core/shell structures. The core/shell nanorods prepared by this two-step process are high density and free-standing, and their length is dependent on the deposition time.
International Nuclear Information System (INIS)
Lu, Zhong; Ouyang, Zi; Grant, Nicholas; Wan, Yimao; Yan, Di; Lennon, Alison
2016-01-01
Graphical abstract: - Highlights: • Pulse anodisation was used to grow AAO layers with controllable stored charge. • Stored charge density ranging from −5.2 × 10 11 to 2.5 × 10 12 q/cm 2 was demonstrated. • Enhancement in surface passivation was demonstrated with charge management. • Annealing significantly reduces the positive stored charge and the interface defect. - Abstract: A method of fabricating anodic aluminium oxide (AAO) with the capability of manipulating its stored charge is reported. This method involves the use of a pulsed current source to anodise aluminium layers instead of the typically used constant current/voltage source, with the test structures experiencing positive and negative cycles periodically. By tuning the positive cycle percentage, it is demonstrated that the effective stored charge density can be manipulated in a range from −5.2 × 10 11 to 2.5 × 10 12 q/cm 2 when the AAO is formed over a 12 nm SiO 2 layer. An investigation of the stored charge distribution in the dielectric stacks indicates a positive fixed charge at the SiO 2 /Si interface, a negative fixed charge at the AAO/SiO 2 interface and a positive bulk charge within the AAO layer. The effective stored charge density and interface states were found to be affected by annealing conditions and it is suggested that oxygen annealing can reduce the bulk positive charge while post-metallisation anneal is most effective in reducing silicon interface defects. Charge manipulation using pulsed anodisation is shown to reduce carrier recombination on boron-diffused silicon surfaces highlighting the potential of the process to be used to tune the electrical properties of dielectric layers so that they can reduce surface recombination on silicon surfaces having different dopant polarity and concentrations.
Energy Technology Data Exchange (ETDEWEB)
Lu, Zhong, E-mail: z.lu@unsw.edu.au [School of Photovoltaic and Renewable Energy Engineering, The University of New South Wales, Sydney, NSW 2052 (Australia); Ouyang, Zi [School of Photovoltaic and Renewable Energy Engineering, The University of New South Wales, Sydney, NSW 2052 (Australia); Grant, Nicholas; Wan, Yimao; Yan, Di [Centre for Sustainable Energy Systems, Faculty of Engineering and Information Technology, The Australian National University, Canberra, ACT 0200 (Australia); Lennon, Alison [School of Photovoltaic and Renewable Energy Engineering, The University of New South Wales, Sydney, NSW 2052 (Australia)
2016-02-15
Graphical abstract: - Highlights: • Pulse anodisation was used to grow AAO layers with controllable stored charge. • Stored charge density ranging from −5.2 × 10{sup 11} to 2.5 × 10{sup 12} q/cm{sup 2} was demonstrated. • Enhancement in surface passivation was demonstrated with charge management. • Annealing significantly reduces the positive stored charge and the interface defect. - Abstract: A method of fabricating anodic aluminium oxide (AAO) with the capability of manipulating its stored charge is reported. This method involves the use of a pulsed current source to anodise aluminium layers instead of the typically used constant current/voltage source, with the test structures experiencing positive and negative cycles periodically. By tuning the positive cycle percentage, it is demonstrated that the effective stored charge density can be manipulated in a range from −5.2 × 10{sup 11} to 2.5 × 10{sup 12} q/cm{sup 2} when the AAO is formed over a 12 nm SiO{sub 2} layer. An investigation of the stored charge distribution in the dielectric stacks indicates a positive fixed charge at the SiO{sub 2}/Si interface, a negative fixed charge at the AAO/SiO{sub 2} interface and a positive bulk charge within the AAO layer. The effective stored charge density and interface states were found to be affected by annealing conditions and it is suggested that oxygen annealing can reduce the bulk positive charge while post-metallisation anneal is most effective in reducing silicon interface defects. Charge manipulation using pulsed anodisation is shown to reduce carrier recombination on boron-diffused silicon surfaces highlighting the potential of the process to be used to tune the electrical properties of dielectric layers so that they can reduce surface recombination on silicon surfaces having different dopant polarity and concentrations.
Poinern, Gérrard Eddy Jai; Shackleton, Robert; Mamun, Shariful Islam; Fawcett, Derek
2011-01-01
Tissue engineering is a multidisciplinary field that can directly benefit from the many advancements in nanotechnology and nanoscience. This article reviews a novel biocompatible anodic aluminum oxide (AAO, alumina) membrane in terms of tissue engineering. Cells respond and interact with their natural environment, the extracellular matrix, and the landscape of the substrate. The interaction with the topographical features of the landscape occurs both in the micrometer and nanoscales. If all these parameters are favorable to the cell, the cell will respond in terms of adhesion, proliferation, and migration. The role of the substrate/scaffold is crucial in soliciting a favorable response from the cell. The size and type of surface feature can directly influence the response and behavior of the cell. In the case of using an AAO membrane, the surface features and porosity of the membrane can be dictated at the nanoscale during the manufacturing stage. This is achieved by using general laboratory equipment to perform a relatively straightforward electrochemical process. During this technique, changing the operational parameters of the process directly controls the nanoscale features produced. For example, the pore size, pore density, and, hence, density can be effectively controlled during the synthesis of the AAO membrane. In addition, being able to control the pore size and porosity of a biomaterial such as AAO significantly broadens its application in tissue engineering. PMID:24198483
Self-ordering of small-diameter metal nanoparticles by dewetting on hexagonal mesh templates.
Meshot, Eric R; Zhao, Zhouzhou; Lu, Wei; Hart, A John
2014-09-07
Arrays of small-diameter nanoparticles with high spatial order are useful for chemical and biological sensors, data storage, synthesis of nanowires and nanotubes, and many other applications. We show that self-ordered metal nanoparticle arrays can be formed by dewetting of thin films on hexagonal mesh substrates made of anodic aluminum oxide (AAO). Upon heating, the metal (Fe) film dewets onto the interstitial sites (i.e., the node points) between pores on the top surface of the AAO. We investigated the particle morphology and dynamics of dewetting using a combination of atomic force microscopy (AFM), grazing-incidence small-angle X-ray scattering (GISAXS), and numerical simulations. Templated metal particles are more monodisperse and have higher local order than those formed by the same dewetting process on flat, nonporous alumina. The degree of order depends on the initial film thickness, and for the optimal thickness tested (nominally 2 nm), we achieved uniform coverage and high order of the particles, comparable to that of the AAO template itself. Computational modeling of dewetting on templates with various pore order and size shows that the order of AAO pores is primarily influential in determining particle position and spacing, while the variance in pore size is less impactful. Potential uses of these ordered nanoparticle arrays on porous materials include plasmonic sensors and spatially controlled catalysts.
The Use of Cannabis as a Predictor of Early Onset of Bipolar Disorder and Suicide Attempts
Directory of Open Access Journals (Sweden)
Rafaela Torres Portugal Leite
2015-01-01
Full Text Available Introduction. Bipolar disorder (BD implies risk of suicide. The age at onset (AAO of BD carries prognostic significance. Substance abuse may precede the onset of BD and cannabis is the most common illicit drug used. The main goal of this study is to review the association of cannabis use as a risk factor for early onset of BD and for suicide attempts. Materials and Methods. PubMed database was searched for articles using key words “bipolar disorder,” “suicide attempts,” “cannabis,” “marijuana,” “early age at onset,” and “early onset.” Results. The following percentages in bipolar patients were found: suicide attempts 3.6–42%; suicide attempts and substance use 5–60%; suicide attempts and cannabis use 15–42%. An early AAO was associated with cannabis misuse. The mean age of the first manic episode in individuals with and without BD and cannabis use disorder (CUD was 19.5 and 25.1 years, respectively. The first depressive episode was at 18.5 and 24.4 years, respectively. Individuals misusing cannabis showed increased risk of suicide. Discussion. Cannabis use is associated with increased risk of suicide attempts and with early AAO. However, the effect of cannabis at the AAO and suicide attempts is not clear.
Lazzara, Thomas D; Behn, Daniela; Kliesch, Torben-Tobias; Janshoff, Andreas; Steinem, Claudia
2012-01-15
Anodic aluminum oxide (AAO) substrates with aligned, cylindrical, non-intersecting pores with diameters of 75 nm and depths of 3.5 or 10 μm were functionalized with lipid monolayers harboring different receptor lipids. AAO was first functionalized with dodecyl-trichlorosilane, followed by fusion of small unilamellar vesicles (SUVs) forming a lipid monolayer. The SUVs' lipid composition was transferred onto the AAO surface, allowing us to control the surface receptor density. Owing to the optical transparency of the AAO, the overall vesicle spreading process and subsequent protein binding to the receptor-doped lipid monolayers could be investigated in situ by optical waveguide spectroscopy (OWS). SUV spreading occurred at the pore-rim interface, followed by lateral diffusion of lipids within the pore-interior surface until homogeneous coverage was achieved with a lipid monolayer. The functionality of the system was demonstrated through streptavidin binding onto a biotin-DOPE containing POPC membrane, showing maximum protein coverage at 10 mol% of biotin-DOPE. The system enabled us to monitor in real-time the selective extraction of two histidine-tagged proteins, PIGEA14 (14 kDa) and ezrin (70 kDa), directly from cell lysate solutions using a DOGS-NTA(Ni)/DOPC (1:9) membrane. The purification process including protein binding and elution was monitored by OWS and confirmed by SDS-PAGE. Copyright © 2011 Elsevier Inc. All rights reserved.
Lintang, H. O.; Jalani, M. A.; Yuliati, L.; Salleh, M. M.
2017-05-01
Herein we reported that by introducing a one-dimensional (1D) substrate with a porous structure such as anodic aluminum oxide (AAO) membrane, mesoporous silica/alumina hybrid nanocomposites were successfully fabricated by using amphiphilic triphenylene (TPC10TEG) as a template in sol-gel synthesis (TPC10TEG/silicahex). For the optical study of the nanocomposites, TPC10TEG/silicahex showed absorption peak at 264 nm due to the ordered and long-range π-π stacking of the disc-like aromatic triphenylene core. Moreover, the hexagonal arrangement of TPC10TEG/silicahex was proven based on their diffraction peaks of d 100 and d 200 at 2θ = 2.52° and 5.04° and images of transmission electron microscopy (TEM), respectively. For fabrication of mesoporous silica/alumina hybrid membrane, TPC10TEG/silicahex was drop-casted onto AAO membrane for penetration into the porous structure via gravity. X-ray diffraction (XRD) analysis on the resulted hybrid nanocomposites showed that the diffraction peaks of d 100 and d 200 of TPC10TEG/silicahex were still preserved, indicating that the hexagonal arrangements of mesoporous silica were maintained even on AAO substrate. The morphology study on the hybrid nanocomposites using TEM, scanning electron microscope (SEM) and field emission scanning electron microscope (FE-SEM) showed the successful filling of most AAO channels with the TPC10TEG/silicahex nanocomposites.
Poinern, Gérrard Eddy Jai; Shackleton, Robert; Mamun, Shariful Islam; Fawcett, Derek
2011-01-14
Tissue engineering is a multidisciplinary field that can directly benefit from the many advancements in nanotechnology and nanoscience. This article reviews a novel biocompatible anodic aluminum oxide (AAO, alumina) membrane in terms of tissue engineering. Cells respond and interact with their natural environment, the extracellular matrix, and the landscape of the substrate. The interaction with the topographical features of the landscape occurs both in the micrometer and nanoscales. If all these parameters are favorable to the cell, the cell will respond in terms of adhesion, proliferation, and migration. The role of the substrate/scaffold is crucial in soliciting a favorable response from the cell. The size and type of surface feature can directly influence the response and behavior of the cell. In the case of using an AAO membrane, the surface features and porosity of the membrane can be dictated at the nanoscale during the manufacturing stage. This is achieved by using general laboratory equipment to perform a relatively straightforward electrochemical process. During this technique, changing the operational parameters of the process directly controls the nanoscale features produced. For example, the pore size, pore density, and, hence, density can be effectively controlled during the synthesis of the AAO membrane. In addition, being able to control the pore size and porosity of a biomaterial such as AAO significantly broadens its application in tissue engineering.
Energy Technology Data Exchange (ETDEWEB)
Weber, Tim F. [University of Heidelberg, Department of Diagnostic and Interventional Radiology, Im Neuenheimer Feld 110, 69120 Heidelberg (Germany)], E-mail: tim.weber@med.uni-heidelberg.de; Ganten, Maria-Katharina [German Cancer Research Center, Department of Radiology, Im Neuenheimer Feld 280, 69120 Heidelberg (Germany)], E-mail: m.ganten@dkfz.de; Boeckler, Dittmar [University of Heidelberg, Department of Vascular and Endovascular Surgery, Im Neuenheimer Feld 110, 69120 Heidelberg (Germany)], E-mail: dittmar.boeckler@med.uni-heidelberg.de; Geisbuesch, Philipp [University of Heidelberg, Department of Vascular and Endovascular Surgery, Im Neuenheimer Feld 110, 69120 Heidelberg (Germany)], E-mail: philipp.geisbuesch@med.uni-heidelberg.de; Kauczor, Hans-Ulrich [University of Heidelberg, Department of Diagnostic and Interventional Radiology, Im Neuenheimer Feld 110, 69120 Heidelberg (Germany)], E-mail: hu.kauczor@med.uni-heidelberg.de; Tengg-Kobligk, Hendrik von [German Cancer Research Center, Department of Radiology, Im Neuenheimer Feld 280, 69120 Heidelberg (Germany)], E-mail: h.vontengg@dkfz.de
2009-12-15
Purpose: The purpose of this study was to characterize the heartbeat-related displacement of the thoracic aorta in patients with chronic aortic dissection type B (CADB). Materials and methods: Electrocardiogram-gated computed tomography angiography was performed during inspiratory breath-hold in 11 patients with CADB: Collimation 16 mm x 1 mm, pitch 0.2, slice thickness 1 mm, reconstruction increment 0.8 mm. Multiplanar reformations were taken for 20 equidistant time instances through both ascending (AAo) and descending aorta (true lumen, DAoT; false lumen, DAoF) and the vertex of the aortic arch (VA). In-plane vessel displacement was determined by region of interest analysis. Results: Mean displacement was 5.2 {+-} 1.7 mm (AAo), 1.6 {+-} 1.0 mm (VA), 0.9 {+-} 0.4 mm (DAoT), and 1.1 {+-} 0.4 mm (DAoF). This indicated a significant reduction of displacement from AAo to VA and DAoT (p < 0.05). The direction of displacement was anterior for AAo and cranial for VA. Conclusion: In CADB, the thoracic aorta undergoes a heartbeat-related displacement that exhibits an unbalanced distribution of magnitude and direction along the thoracic vessel course. Since consecutive traction forces on the aortic wall have to be assumed, these observations may have implications on pathogenesis of and treatment strategies for CADB.
Directory of Open Access Journals (Sweden)
Kangho Kim
2013-01-01
Full Text Available The GaAs solar cells are grown by low-pressure metalorganic chemical vapor deposition (LP-MOCVD and fabricated by photolithography, metal evaporation, annealing, and wet chemical etch processes. Anodized aluminum oxide (AAO masks are prepared from an aluminum foil by a two-step anodization method. Inductively coupled plasma dry etching is used to etch and define the nanoarray structures on top of an InGaP window layer of the GaAs solar cells. The inverted-cone-shaped nanoholes with a surface diameter of about 50 nm are formed on the top surface of the solar cells after the AAO mask removal. Photovoltaic and optical characteristics of the GaAs solar cells with and without the nanohole arrays are investigated. The reflectance of the AAO nanopatterned samples is lower than that of the planar GaAs solar cell in the measured range. The short-circuit current density increased up to 11.63% and the conversion efficiency improved from 10.53 to 11.57% under 1-sun AM 1.5 G conditions by using the nanohole arrays. Dependence of the efficiency enhancement on the etching depth of the nanohole arrays is also investigated. These results show that the nanohole arrays fabricated with an AAO technique may be employed to improve the light absorption and, in turn, the conversion efficiency of the GaAs solar cell.
Interaction of Spatially Localized LHW with Banana Particles
Czech Academy of Sciences Publication Activity Database
Krlín, Ladislav; Fuchs, Vladimír; Pánek, Radomír; Papřok, Richard; Seidl, Jakub
2014-01-01
Roč. 1, č. 3 (2014), s. 166-168 ISSN 2336-2626. [SPPT 2014 - 26th Symposium on Plasma Physics and Technology/26./. Prague, 16.06.2014-19.06.2014] R&D Projects: GA ČR GAP205/11/2341 Institutional support: RVO:61389021 Keywords : anomalous acceleration * stochasticity * lower hybrid waves * banana particles * tokamaks Subject RIV: BL - Plasma and Gas Discharge Physics http://fyzika.feld.cvut.cz/misc/ppt/articles/2014/krlin.pdf
Design and Prototyping of a Satellite Antenna Slew Testbed
2013-12-01
beers and kind advice gave me a family away from home. To my familia here in the Bay Area; their constant support, understanding and surprise...Encoder Cable Maxon 275934 2 CAB 29 EPOS Power Cable Maxon 275829 2 CAB 30 Misc Hardware** NPS 30 - - Bill of Materials 35 closely match the actual ...computed trajectory. The position and velocity results were then implemented on the testbed motors for comparison of actual versus commanded values
2009-01-01
1 Motivation for the Study...Active and Reserve components) in its inventory. Motivation for the Study Since its creation roughly 30 years ago, the IPDS pipeline system has been...26 39 52 65 78 91 Sites Terminal PS1 PS2 PS3 PS4 PS5 PS6 Bag farm 19 30 Storage 9 9 9 9 9 9 Pipeline 23 Maint 38 Misc 49 164382354 Miles 0 13 26 39
Absence of c-Aminobutyric Acid-A Receptor Potentiation in Central Hypersomnolence Disorders
Dauvilliers, Yves; Evangelista, Elisa; Lopez, Regis; Barateau, Lucie; Jaussent, Isabelle; Cens, Thierry; Rousset, Matthieu; Charnet, Pierre
2016-01-01
International audience; Objective: The pathophysiology of idiopathic hypersomnia (IH) remains unclear. Recently, cerebrospinal fluid (CSF)-induced enhancement of c-aminobutyric acid (GABA)-A receptor activity was found in patients with IH compared to controls. Methods: Fifteen unrelated patients (2 males and 13 females) affected with typical IH, 12 patients (9 males and 3 females) with narcolepsy type 1, and 15 controls (9 males and 6 females) with unspecified hypersomnolence (n 5 7) and misc...
On Dataless Hierarchical Text Classification (Author’s Manuscript)
2014-07-27
compound talk.politics.mideast politics mideast israel arab jews jewish muslim talk.politics.misc politics gay homosexual sexual alt.atheism atheism...tion in NLP tasks; it was further used in several NLP works, such as by Liang (2005), to measure words’ distributional similarity. This method...embedding trained by neural networks has been used widely in the NLP community and has become a hot trend recently. In this pa- per, we test the suitability
Improved carbon nanotube growth inside an anodic aluminum oxide template using microwave radiation
Dadras, Sedigheh; Faraji, Maryam
2018-05-01
In this study, we achieved superfast growth of carbon nanotubes (CNTs) in an anodic aluminum oxide (AAO) template by applying microwave (MW) radiation. This is a simple and direct approach for growing CNTs using a MW oven. The CNTs were synthesized using MW radiation at a frequency of 2.45 GHz and power was applied at various levels of 900, 600, and 450 W. We used graphite and ferrocene in equal portions as precursors. The optimum conditions for the growth of CNTs inside a MW oven were a time period of 5 s and power of 450 W. In order to grow uniform CNTs, an AAO template was applied with the CNTs synthesized under optimum conditions. The morphology of the synthesized CNTs was investigated by scanning electron microscopy analysis. The average diameters of the CNTs obtained without the template were 22-27 nm, whereas the diameters of the CNTs prepared inside the AAO template were about 4-6 nm.
Fabrication of porous anodic alumina films by using two-step anodization process
International Nuclear Information System (INIS)
Xu Zhan; Zhou Bin; Xu Xiang; Wang Xiaoli; Wu Di; Shen Jun
2006-01-01
This article introduces the fabrication of the porous anodic alumina films which have ordered pore arrangement by using a two-step anodization process. The films have a parallel channel structure which nanopore diameter can be 20-100 nm, and depth can reach 50 μm. The change of pore structure in the first and second anodization, moving the alumina layer, widening process was analysed. The effect of the parameters such as different electrolytes, anodization temperature and the voltage on the nanopore structure was studied. The surface and profile structure through FE-SEM (field emission scanning electron microscope), the element composition in tiny area of the anodic aluminum oxide (AAO) surface were studied. The result indicates the pore diameter of AAO which is anodized in oxalic acid solution is larger than which anodized in sulfuric acid solution. The anodization temperature and voltage can enlarge the nanopore diameter of AAO in a range. (authors)
Directory of Open Access Journals (Sweden)
Ahrum Sohn
2013-01-01
Full Text Available We investigated optical properties of three-dimensional (3D assemblies of Au nanoparticles (NPs, which were fabricated by dewetting of thin Au layers on anodic aluminum oxides (AAO. The NP assembly had hexagonal array of repeated multiparticle structures, which consisted of six trimers on the AAO surface and one large NP in the AAO pore (pore-NP. We performed finite-difference time-domain simulation to explain the optical response of the NP assemblies and compared the calculation results with experimental data. Such complementary studies clearly revealed how the plasmonic coupling between the constituent NPs influenced the spectral response of our NP assemblies. In particular, comparison of the assemblies with and without pore-NPs suggested that strong plasmonic coupling between trimers and pore-NP significantly affected the spectra and the field distribution of the NP assemblies. Plasmonic multi-NP assemblies could provide us new platforms to realize novel optoelectronic devices.
Xue, Junhui; Xu, Yizhuang; Jin, Zhaoxia
2016-03-08
Here, we demonstrated that, when the precipitation process of polyamide-6 (PA6) solution happens in cylindrical channels of an anodized aluminum oxide membrane (AAO), interface interactions between a solid surface, solvent, non-solvent, and PA6 will influence the obtained polymer nanostructures, resulting in complex morphologies, increased surface area, and crystallization changes. With the enhancing interaction of PA6 and the AAO surface, the morphology of PA6 nanostructures changes from solid nanofibers, mesoporous, to bamboo-like, while at the same time, metastable γ-phase domains increase in these PA6 nanostructures. Brunauer-Emmett-Teller (BET) surface areas of solid, bamboo-like, and mesoporous PA6 nanofibers rise from 16, 20.9, to 25 m(2)/g. This study shows that interfacial interaction in AAO template fabrication can be used in manipulating the morphology and crystallization of one-dimensional polymer nanostructures. It also provides us a simple and novel method to create porous PA6 nanofibers with a large surface area.
A general melt-injection-decomposition route to oriented metal oxide nanowire arrays
Han, Dongqiang; Zhang, Xinwei; Hua, Zhenghe; Yang, Shaoguang
2016-12-01
In this manuscript, a general melt-injection-decomposition (MID) route has been proposed and realized for the fabrication of oriented metal oxide nanowire arrays. Nitrate was used as the starting materials, which was injected into the nanopores of the anodic aluminum oxide (AAO) membrane through the capillarity action in its liquid state. At higher temperature, the nitrate decomposed into corresponding metal oxide within the nanopores of the AAO membrane. Oriented metal oxide nanowire arrays were formed within the AAO membrane as a result of the confinement of the nanopores. Four kinds of metal oxide (CuO, Mn2O3, Co3O4 and Cr2O3) nanowire arrays are presented here as examples fabricated by this newly developed process. X-ray diffraction, scanning electron microscopy and transmission electron microscopy studies showed clear evidence of the formations of the oriented metal oxide nanowire arrays. Formation mechanism of the metal oxide nanowire arrays is discussed based on the Thermogravimetry and Differential Thermal Analysis measurement results.
Highly ordered uniform single-crystal Bi nanowires: fabrication and characterization
International Nuclear Information System (INIS)
Bisrat, Y; Luo, Z P; Davis, D; Lagoudas, D
2007-01-01
A mechanical pressure injection technique has been used to fabricate uniform bismuth (Bi) nanowires in the pores of an anodic aluminum oxide (AAO) template. The AAO template was prepared from general purity aluminum by a two-step anodization followed by heat treatment to achieve highly ordered nanochannels. The nanowires were then fabricated by an injection technique whereby the molten Bi was injected into the AAO template using a hydraulic pressure method. The Bi nanowires prepared by this method were found to be dense and continuous with uniform diameter throughout the length. Electron diffraction experiments using the transmission electron microscope on cross-sectional and free-standing longitudinal Bi nanowires showed that the majority of the individual nanowires were single crystalline, with preferred orientation of growth along the [011] zone axis of the pseudo-cubic structure. The work presented here provides an inexpensive and effective way of fabricating highly ordered single-crystalline Bi nanowires, with uniform size distributions
Passmore, P.; Zimakov, L.; Rozhkov, M.
The 3rd Generation Seismic Recorder, Model 130-01, has been designed to be easier to use - more compact, lighter in weight, lower power, and requires less maintenance than other recorders. Not only is the hardware optimized for field deployments, soft- ware tools as well have been specially developed to support both field and base station operation. The 130's case is a clamshell design, inherently waterproof, with easy access to all user features on the top of the unit. The 130 has 6 input/output connectors, an LCD display, and a removable lid on top of the case. There are two Channel input connectors on a 6-channel unit (only one on a 3-channel unit), a Terminal connector for setup and control, a Net connector combining Ethernet and Serial PPP for network access, a 12 VDC Power connector, and a GPS receiver connector. The LCD display allows the user to monitor the status of various sub systems within the 130 without having a terminal device attached. For storing large amounts of data the IBM MicrodriveTM is offered. User setup, control and status monitoring is done either with a Personal Digital Assistant (PDA) (Palm OS compatible) using our Palm Field Controller (PFC) software or from a PC/workstation using our REF TEK Network Controller (RNC) GUI interface. StarBand VSAT is the premier two-way, always-on, high-speed satellite Internet ser- vice. StarBand means high-speed Internet without the constraints and congestion of land-based cable or telephone networks. StarBand uses a single satellite dish antenna for receiving and for sending dataUno telephone connection is needed. The hardware ° cost is much less than standard VSAT equipment with double or single hop transmis- sion. REF TEK protocol (RTP) provides end-to-end error-correcting data transmission and command/control. StarBandSs low cost VSAT provides two-way, always-on, high speed satellite Internet data availability. REF TEK and StarBand create the most ad- vanced real-time seismological data acquisition
Yang, Dongmei; Dai, Yunlu; Ma, Pingan; Kang, Xiaojiao; Cheng, Ziyong; Li, Chunxia; Lin, Jun
2013-02-18
Small (2-28 nm) NaREF(4) (rare earth (RE)=Nd-Lu, Y) nanoparticles (NPs) were prepared by an oil/water two-phase approach. Meanwhile, hydrophilic NPs can be obtained through a successful phase-transition process by introducing the amphiphilic surfactant sodium dodecylsulfate (SDS) into the same reaction system. Hollow-structured NaREF(4) (RE=Y, Yb, Lu) NPs can be fabricated in situ by electron-beam lithography on solid NPs. The MTT assay indicates that these hydrophilic NPs with hollow structures exhibit good biocompatibility. The as-prepared hollow-structured NPs can be used as anti-cancer drug carriers for drug storage/release investigations. Doxorubicin hydrochloride (DOX) was taken as model drug. The release of DOX from hollow α-NaLuF(4):20% Yb(3+), 2% Er(3+) exhibits a pH-sensitive release patterns. Confocal microscopy observations indicate that the NPs can be taken up by HeLa cells and show obvious anti-cancer efficacy. Furthermore, α-NaLuF(4):20% Yb(3+), 2% Er(3+) NPs show bright-red emission under IR excitation, making both the excitation and emission light fall within the "optical window" of biological tissues. The application of α-NaLuF(4):20% Yb(3+), 2% Er(3+) in the luminescence imaging of cells was also investigated, which shows a bright-red emission without background noise. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Electronic transport behavior of diameter-graded Ag nanowires
International Nuclear Information System (INIS)
Wang Xuewei; Yuan Zhihao
2010-01-01
Ag nanowires with a graded diameter in anodic aluminum oxide (AAO) membranes were fabricated by the direct-current electrodeposition. The Ag nanowires have a graded-change in diameter from 8 to 32 nm, which is matched with the graded-change of the AAO pore diameter. Electronic transport measurements show that there is a transport behavior similar to that of a metal-semiconductor junction along the axial direction in the diameter-graded Ag nanowires. Such a novel homogeneous nanojunction will be of great fundamental and practical significance.
Superconducting properties of Pb82Bi18 films controlled by ferromagnetic nanowire arrays
International Nuclear Information System (INIS)
Ye Zuxin; Lyuksyutov, Igor F; Wu Wenhao; Naugle, Donald G
2011-01-01
The superconducting properties of Pb 82 Bi 18 alloy films deposited on ferromagnetic nanowire arrays have been investigated. Ferromagnetic Co or Ni nanowires are first electroplated into the columnar pores of anodic aluminum oxide (AAO) membranes. Superconducting Pb 82 Bi 18 films are then quench condensed onto the polished surface of the AAO membranes filled with magnetic nanowires. A strong dependence of the Pb 82 Bi 18 superconducting properties on the ratio of the superconducting film thickness to the magnetic nanowire diameter and material variety was observed.
Electronic transport behavior of diameter-graded Ag nanowires
Wang, Xue Wei; Yuan, Zhi Hao
2010-05-01
Ag nanowires with a graded diameter in anodic aluminum oxide (AAO) membranes were fabricated by the direct-current electrodeposition. The Ag nanowires have a graded-change in diameter from 8 to 32 nm, which is matched with the graded-change of the AAO pore diameter. Electronic transport measurements show that there is a transport behavior similar to that of a metal-semiconductor junction along the axial direction in the diameter-graded Ag nanowires. Such a novel homogeneous nanojunction will be of great fundamental and practical significance.
Superconducting properties of Pb82Bi18 films controlled by ferromagnetic nanowire arrays
Ye, Zuxin; Lyuksyutov, Igor F.; Wu, Wenhao; Naugle, Donald G.
2011-02-01
The superconducting properties of Pb82Bi18 alloy films deposited on ferromagnetic nanowire arrays have been investigated. Ferromagnetic Co or Ni nanowires are first electroplated into the columnar pores of anodic aluminum oxide (AAO) membranes. Superconducting Pb82Bi18 films are then quench condensed onto the polished surface of the AAO membranes filled with magnetic nanowires. A strong dependence of the Pb82Bi18 superconducting properties on the ratio of the superconducting film thickness to the magnetic nanowire diameter and material variety was observed.
Noh, Kunbae
2011-12-01
Self-ordered arrangements observed in various materials systems such as anodic aluminum oxide, polystyrene nanoparticles, and block copolymer are of great interest in terms of providing new opportunities in nanofabrication field where lithographic techniques are broadly used in general. Investigations on self-assembled nano arrays to understand how to obtain periodic nano arrays in an efficient yet inexpensive way, and how to realize advanced material and device systems thereof, can lead to significant impacts on science and technology for many forefront device applications. In this thesis, various aspects of periodic nano-arrays have been discussed including novel preparations, properties and applications of anodized aluminum oxide (AAO) and PS-b-P4VP (S4VP) di-block copolymer self-assembly. First, long-range ordered AAO arrays have been demonstrated. Nanoimprint lithography (NIL) process allowed a faithful pattern transfer of the imprint mold pattern onto Al thin film, and interesting self-healing and pattern tripling phenomena were observed, which could be applicable towards fabrication of the NIL master mold having highly dense pattern over large area, useful for fabrication of a large-area substrate for predictable positioning of arrayed devices. Second, S4VP diblock copolymer self-assembly and S4VP directed AAO self-assembly have been demonstrated in the Al thin film on Si substrate. Such a novel combination of two dissimilar self-assembly techniques demonstrated a potential as a versatile tool for nanopatterning formation on a Si substrate, capable of being integrated into Si process technology. As exemplary applications, vertically aligned Ni nanowires have been synthesized into an S4VP-guided AAO membrane on a Si substrate in addition to anti-dot structured [Co/Pd]n magnetic multilayer using S4VP self assembly. Third, a highly hexagonally ordered, vertically parallel aluminum oxide nanotube array was successfully fabricated via hard anodization technique
Hydrogen Incorporation during Aluminium Anodisation on Silicon Wafer Surfaces
International Nuclear Information System (INIS)
Lu, Pei Hsuan Doris; Strutzberg, Hartmuth; Wenham, Stuart; Lennon, Alison
2014-01-01
Hydrogen can act to reduce recombination at silicon surfaces for solar cell devices and consequently the ability of dielectric layers to provide a source of hydrogen for this purpose is of interest. However, due to the ubiquitous nature of hydrogen and its mobility, direct measurements of hydrogen incorporation in dielectric layers are challenging. In this paper, we report the use of secondary ion mass spectrometry measurements to show that deuterium from an electrolyte can be incorporated in an anodic aluminium oxide (AAO) layer and be introduced into an underlying amorphous silicon layer during anodisation of aluminium on silicon wafers. After annealing at 400 °C, the concentration of deuterium in the AAO was reduced by a factor of two, as the deuterium was re-distributed to the interface between the amorphous silicon and AAO and to the amorphous silicon. The assumption that hydrogen, from an aqueous electrolyte, could be similarly incorporated in AAO, is supported by the observation that the hydrogen content in the underlying amorphous silicon was increased by a factor of ∼ 3 after anodisation. Evidence for hydrogen being introduced into crystalline silicon after aluminium anodisation was provided by electrochemical capacitance voltage measurements indicating boron electrical deactivation in the underlying crystalline silicon. If introduced hydrogen can electrically deactivate dopant atoms at the surface, then it is reasonable to assume that it could also deactivate recombination-active states at the crystalline silicon interface therefore enabling higher minority carrier lifetimes in the silicon wafer
Scrape-off layer width of parallel heat flux on tokamak COMPASS
Czech Academy of Sciences Publication Activity Database
Loureiro, J.; Silva, C.; Horáček, Jan; Adámek, Jiří; Stöckel, Jan
2014-01-01
Roč. 1, č. 3 (2014), s. 121 ISSN 2336-2626. [SPPT 2014 - 26th Symposium on Plasma Physics and Technology/26./. Prague, 16.06.2014-19.06.2014] R&D Projects: GA ČR(CZ) GAP205/12/2327 Institutional support: RVO:61389021 Keywords : tokamak * edge turbulent transport * Scrape-Off layer * Langmuir probe * Ball- pen probe Subject RIV: BL - Plasma and Gas Discharge Physics http://fyzika.feld.cvut.cz/misc/ppt/articles/2014/loureiro.pdf
Taxonomic Evaluation of Cleveland Harbor Lake Areas
2014-01-01
collected using a standard (8.2-L) stainless steel ponar grab (229 x 229 mm) in basic accordance with USEPA (2001). The grab sampler was dropped from...through stacked 1.0- and 0.5-mm stainless steel sieves to separate coarse and fine material. Sample material retained in both sieves was thoroughly... 416 . Berry, E. 1943. The Amnicolidae of Michigan: Distribution, ecology, and taxonomy. Misc. Publ. Mus. Zool. U. Mich. 57:1-68. Dillon, R. T., Jr
Antarctic 20th Century Accumulation Changes Based on Regional Climate Model Simulations
Directory of Open Access Journals (Sweden)
Klaus Dethloff
2010-01-01
investigated on the basis of ERA-40 data and HIRHAM simulations. It is shown that the regional accumulation changes are largely driven by changes in the transient activity around the Antarctic coasts due to the varying AAO phases. During positive AAO, more transient pressure systems travelling towards the continent, and Western Antarctica and parts of South-Eastern Antarctica gain more precipitation and mass. Over central Antarctica the prevailing anticyclone causes a strengthening of polar desertification connected with a reduced surface mass balance in the northern part of East Antarctica.
Superconducting Properties of Lead-Bismuth Films Controlled by Ferromagnetic Nanowire Arrays
Ye, Zuxin; Lyuksyutov, Igor F.; Wu, Wenhao; Naugle, Donald G.
2011-03-01
Superconducting properties of lead-bismuth (82% Pb and 18% Bi) alloy films deposited on ferromagnetic nanowire arrays have been investigated. Ferromagnetic Co or Ni nanowires are first electroplated into the columnar pores of anodic aluminum oxide (AAO) membranes. Superconducting Pb 82 Bi 18 films are then quench-condensed onto the polished surface of the AAO membranes filled with magnetic nanowires. A strong dependence of the Pb 82 Bi 18 superconducting properties on the ratio of the superconducting film thickness to the magnetic nanowire diameter and the material variety was observed.
Superhydrophilicity of anodic aluminum oxide films: From 'honeycomb' to 'bird's nest'
International Nuclear Information System (INIS)
Ye Jiaming; Yin Qiming; Zhou Yongliang
2009-01-01
An electrochemical method has been used to prepare different kinds of surfaces including 'honeycomb'-like and 'bird's nest'-like surfaces on anodic aluminum oxide (AAO) films. The relationship between the morphology and wettability of the AAO films was investigated by scanning electron microscopy and the measurement of water contact angles. The results show that the 'bird's nest'-like structure is necessary for superhydrophilic property, which provide direct experimental evidences for the 3D capillary theory concerning superhydrophilicity. It is expected that this investigation will be devoted to guiding the fabrication of superhydrophilic and superhydrophobic surfaces.
Zhang, Lei
Materials scientists have embraced nanoscale materials as allowing new degrees of freedom in materials design, as well as producing completely new and enhanced properties compared with conventional materials. However, most nanofabrication methods are tedious and expensive, or require extreme conditions. This thesis presents efficient methods for generating nanostructured materials under relatively mild chemistry and experimental conditions. The basis of most of this work is porous anodic aluminum oxide (p-AAO) membranes, which have hexagonally close-packed pores and were fabricated following a two-step aluminum anodization procedure. Partially removing the barrier layer of a p-AAO membrane enabled the preparation of silver nanorod arrays using a very simple electrodepostition procedure. One dimensional (1-D) alumina nanostructures were also electrochemically synthesized on the surface of a p-AAO membrane by carefully controlling the anodization parameters. Polyacrylonitrile nanofibers containing platinum salt were fabricated by polymerization of acrylonitrile in p-AAO templates. Subsequent pyrolysis resulted in carbon nanofibers wherein the platinum salt is reduced in-situ to elemental Pt. The Pt nanoparticles are dispersed throughout the carbon nanofibers, have a narrow size range, and are single crystals. Rotating disc electrode voltammetry suggests that the dispersion of Pt nanocrystals in the carbon nanofiber matrix should exhibit excellent electrocatalytic activity. The preparation of catalyst ink and the construction of membrane-electrode-assembly need to be optimized to get better performance in polymer electrolyte membrane fuel cells. Platinum nanoparticles embedded in carbon fibers were also prepared using electrospinning. The prepared platinum nanoparticles are narrowly distributed in size and well dispersed in the carbon matrix. This method can provide a large yield of products with a simple setup and procedure. 2-D arrays of nanopillars made from
Directory of Open Access Journals (Sweden)
Ralini F. de Melo
2006-06-01
Full Text Available Objetivou-se, com este estudo, determinar os fatores de retardamento e os coeficientes de dispersão-difusão dos íons potássio, sódio, cálcio e magnésio, presentes na água residuária de fecularias ou manipueira, e simular as concentrações residentes em colunas de solos de 160 cm, pelo período de 5 h. Os ensaios foram realizados em laboratório utilizando-se colunas de percolação preenchidas com amostras de Neossolo Quartzarênico órtico espódico (RQo, Latossolo Amarelo distrófico típico (LAd e Latossolo Vermelho Amarelo distrófico típico (LVAd. A concentração dos íons no efluente foram analisados empregando-se a metodologia de deslocamento de fluidos miscíveis. Os valores mais elevados dos fatores de retardamento ocorreram no LVAd, indicando maior retenção dos íons potássio, sódio, cálcio e magnésio nesse solo. Os valores dos coeficientes dispersivos-difusivos decresceram no sentido do RQo para o LVAd, sendo que o maior valor ocorreu no RQo para o íon potássio, e o menor no LVAd, para o íon cálcio. A simulação para um período de aplicação da manipueira de 5 h, mostrou pequeno avanço dos íons na coluna do LVAd, em comparação com RQo e LAd alertando, assim, para os perigos de contaminação de águas subterrâneas ao se aplicar a manipueira nesses solos.This study aimed to determine the retardation factors and the diffusion-dispersion coefficients of the potassium, sodium, calcium and magnesium ions found in the cassava wastewater, as well as to simulate the resident concentrations in soil columns with 160 cm over a five-hours period. The trials were accomplished under laboratory conditions, by using percolation columns fulfilled with materials from the spodic ortic Quartzarenic Neosol (RQo, typical distrophic Yellow Latosol (LAd and typical distrophic Yellow Red Latosol (LVAd. The data of the ion concentrations in effluent were analyzed, by using the miscible fluid displacement methodology. The highest
Electrochemical method for rapid synthesis of Zinc Pentacyanonitrosylferrate Nanotubes
Directory of Open Access Journals (Sweden)
Rogaieh Bargeshadi
2014-10-01
Full Text Available In this paper, a rapid and simple approach was developed for the preparation of zinc pentacyanonitrosylferrate nanotubes (ZnPCNF NTs within the cylindrical pores of anodic aluminum oxide (AAO template by electrochemical method. The AAO was fabricated in two steps anodizing from aluminum foil. The first anodization of aluminum foil was performed in 0.2 mol L-1 H2C2O4 followed by removal of the formed porous oxide film by a solution of 6 wt% of phosphoric acid. The second anodization step was then performed using the same conditions as the previous step. Scanning electron microscope (SEM and X-ray diffraction (XRD method were employed to characterize the resulting highly oriented uniform hollow tube array which its diameter was in the range of 25-75 nm depending on the applied voltage and the length of nanotubes was equal to the thickness of AAO which was about 2 m. The growth properties of the ZnPCNF NTs array film can be achieved by controlling the structure of the template and applied potential across the cell.
Hekmat, F.; Sohrabi, B.; Rahmanifar, M. S.; Jalali, A.
2015-06-01
Multi-wall carbon nanotubes (MW-CNTs) have been arranged in nanochannels of anodic aluminum oxide template (AAO) by electrophoretic deposition (EPD) to make a vertically-aligned carbon nanotube (VA-CNT) based electrode. Well ordered AAO templates were prepared by a two-step anodizing process by applying a constant voltage of 45 V in oxalic acid solution. The stabilized CNTs in a water-soluble room temperature ionic liquid (1-methyl-3-octadecylimidazolium bromide), were deposited in the pores of AAO templates which were conductive by deposition of Ni nanoparticles in the bottom of pores. In order to obtain ideal results, different EPD parameters, such as concentration of MWCNTs and ionic liquid on stability of MWCNT suspensions, deposition time and voltage which are applied in EPD process and also optimal conditions for anodizing of template were investigated. The capacitive performance of prepared electrodes was analyzed by measuring the specific capacitance from cyclic voltammograms and the charge-discharge curves. A maximum value of 50 Fg-1 at the scan rate of 20 mV s-1was achieved for the specific capacitance.
Chen, Yungting; Cheng, Tzuhuan; Cheng, Chungliang; Wang, Chunhsiung; Chen, Chihwei; Wei, Chihming; Chen, Yangfang
2010-01-04
A new approach for developing highly sensitive MOS photodetector based on the assistance of anodic aluminum oxide (AAO) membrane is proposed, fabricated, and characterized. It enables the photodetector with the tunability of not only the intensity but also the range of the response. Under a forward bias, the response of the MOS photodetector with AAO membrane covers the visible as well as infrared spectrum; however, under a reverse bias, the near-infrared light around Si band edge dominates the photoresponse. Unlike general MOS photodetectors which only work under a reverse bias, our MOS photodetectors can work even under a forward bias, and the responsivity at the optical communication wavelength of 850nm can reach up to 0.24 A/W with an external quantum efficiency (EQE) of 35%. Moreover, the response shows a large enhancement factor of 10 times at 1050 nm under a reverse bias of 0.5V comparing with the device without AAO membrane. The underlying mechanism for the novel properties of the newly designed device has been proposed.
Dielectric capacitors with three-dimensional nanoscale interdigital electrodes for energy storage.
Han, Fangming; Meng, Guowen; Zhou, Fei; Song, Li; Li, Xinhua; Hu, Xiaoye; Zhu, Xiaoguang; Wu, Bing; Wei, Bingqing
2015-10-01
Dielectric capacitors are promising candidates for high-performance energy storage systems due to their high power density and increasing energy density. However, the traditional approach strategies to enhance the performance of dielectric capacitors cannot simultaneously achieve large capacitance and high breakdown voltage. We demonstrate that such limitations can be overcome by using a completely new three-dimensional (3D) nanoarchitectural electrode design. First, we fabricate a unique nanoporous anodic aluminum oxide (AAO) membrane with two sets of interdigitated and isolated straight nanopores opening toward opposite planar surfaces. By depositing carbon nanotubes in both sets of pores inside the AAO membrane, the new dielectric capacitor with 3D nanoscale interdigital electrodes is simply realized. In our new capacitors, the large specific surface area of AAO can provide large capacitance, whereas uniform pore walls and hemispheric barrier layers can enhance breakdown voltage. As a result, a high energy density of 2 Wh/kg, which is close to the value of a supercapacitor, can be achieved, showing promising potential in high-density electrical energy storage for various applications.
Separating attoliter-sized compartments using fluid pore-spanning lipid bilayers.
Lazzara, Thomas D; Carnarius, Christian; Kocun, Marta; Janshoff, Andreas; Steinem, Claudia
2011-09-27
Anodic aluminum oxide (AAO) is a porous material having aligned cylindrical compartments with 55-60 nm diameter pores, and being several micrometers deep. A protocol was developed to generate pore-spanning fluid lipid bilayers separating the attoliter-sized compartments of the nanoporous material from the bulk solution, while preserving the optical transparency of the AAO. The AAO was selectively functionalized by silane chemistry to spread giant unilamellar vesicles (GUVs) resulting in large continuous membrane patches covering the pores. Formation of fluid single lipid bilayers through GUV rupture could be readily observed by fluorescence microscopy and further supported by conservation of membrane surface area, before and after GUV rupture. Fluorescence recovery after photobleaching gave low immobile fractions (5-15%) and lipid diffusion coefficients similar to those found for bilayers on silica. The entrapment of molecules within the porous underlying cylindrical compartments, as well as the exclusion of macromolecules from the nanopores, demonstrate the barrier function of the pore-spanning membranes and could be investigated in three-dimensions using confocal laser scanning fluorescence imaging. © 2011 American Chemical Society
Kinetic models of controllable pore growth of anodic aluminum oxide membrane
Huang, Yan; Zeng, Hong-yan; Zhao, Ce; Qu, Ye-qing; Zhang, Pin
2012-06-01
An anodized Al2O3 (AAO) membrane with apertures about 72 nm in diameter was prepared by two-step anodic oxidation. The appearance and pore arrangement of the AAO membrane were characterized by energy dispersive x-ray spectroscopy and scanning electron microscopy. It was confirmed that the pores with high pore aspect ratio were parallel, well-ordered, and uniform. The kinetics of pores growth in the AAO membrane was derived, and the kinetic models showed that pores stopped developing when the pressure ( σ) trended to equal the surface tension at the end of anodic oxidation. During pore expansion, the effects of the oxalic acid concentration and expansion time on the pore size were investigated, and the kinetic behaviors were explained with two kinetic models derived in this study. They showed that the pore size increased with extended time ( r= G· t+ G'), but decreased with increased concentration ( r = - K·ln c- K') through the derived mathematic formula. Also, the values of G, G', K, and K' were derived from our experimental data.
The role and effect of residual stress on pore generation during anodization of aluminium thin films
International Nuclear Information System (INIS)
Liao, M.W.; Chung, C.K.
2013-01-01
Highlights: •Al films of varying residual stress were prepared by sputtering. •Variation of the residual stress in the Al films influences pore growth during anodization. •The change in average pore size with residual stress is fairly small. •Interaction of residual stress with oxide growth stress leads to change in structure. •Residual tensile stress increases the pore density of porous alumina. -- Abstract: The role and effect of residual stress on pore generation of anodized aluminium oxide (AAO) have been investigated into anodizing the various-residual-stresses aluminium films. The plane stresses were characterised by X-ray diffraction with sin 2 ψ method. The pore density roughly linearly increased with residual stress from 64.6 (−132.5 MPa) to 90.5 pores/μm 2 (135.9 MPa). However, the average pore size around 40 nm was not changed significantly except for the rougher film. The tensile residual stress lessened the compressive oxide growth stress to reduce AAO plastic deformation for higher pore density. The findings provide new foundations for realizing AAO films on silicon
Ko, Hao-Wen; Cheng, Ming-Hsiang; Chi, Mu-Huan; Chang, Chun-Wei; Chen, Jiun-Tai
2016-03-01
We demonstrate a novel wetting method to prepare hierarchical polymer films with polymer nanotubes on selective regions. This strategy is based on the selective wetting abilities of polymer chains, annealed in different solvent vapors, into the nanopores of porous templates. Phase-separated films of polystyrene (PS) and poly(methyl methacrylate) (PMMA), two commonly used polymers, are prepared as a model system. After anodic aluminum oxide (AAO) templates are placed on the films, the samples are annealed in vapors of acetic acid, in which the PMMA chains are swollen and wet the nanopores of the AAO templates selectively. As a result, hierarchical polymer films containing PMMA nanotubes can be obtained after the AAO templates are removed. The distribution of the PMMA nanotubes of the hierarchical polymer films can also be controlled by changing the compositions of the polymer blends. This work not only presents a novel method to fabricate hierarchical polymer films with polymer nanotubes on selective regions, but also gives a deeper understanding in the selective wetting ability of polymer chains in solvent vapors.
Omni-directional reflectors for deep blue LED using symmetric autocloning method
Chen, Sheng-Hui; Chen, Chun-Ko; Huang, Yu-Chia; Lee, Cheng-Chung
2013-03-01
Omni-directional reflectors (ODRs) for deep blue LED were designed and fabricated using symmetric autocloning method. The symmetric stack multi-layers for the reflectors were designed by finite-difference time-domain simulation. The fabricating process of ODR is combined with the techniques of anodic aluminum oxide (AAO) process and autocloning method. The two-dimensional structure template of nano-channel array was grown using AAO with the period of 150 nm. Then the shaping layer was deposited on the AAO template by evaporation deposition. Besides, the ion etching was applied to modify the apex angle to the triangle shape at 100°. Finally, the sub/(0.5TiO2 SiO2 0.5TiO2)8 multi-layer stack was deposited on the shaping layer using autocloning method to achieve the ODR. The results show the reflective spectra of ODR at the incident angles of 0, 30, 45, and 60° had high values within the range 400-450 nm. Besides, the central wavelength shifting is not obvious which is very good for keeping the color of LED stable.
Vengatesh, Panneerselvam; Kulandainathan, Manickam Anbu
2015-01-28
Herein, we report a facile method for the fabrication of self-lubricating superhydrophobic hierarchical anodic aluminum oxide (AAO) surfaces with improved corrosion protection, which is greatly anticipated to have a high impact in catalysis, aerospace, and the shipping industries. This method involves chemical grafting of as-formed AAO using low surface free energy molecules like long chain saturated fatty acids, perfluorinated fatty acid (perfluorooctadecanoic acid, PFODA), and perfluorosulfonicacid-polytetrafluoroethylene copolymer. The pre and post treatment processes in the anodization of aluminum (Al) play a vital role in the grafting of fatty acids. Wettability and surface free energy were analyzed using a contact angle meter and achieved 161.5° for PFODA grafted anodized aluminum (PFODA-Al). This study was also aimed at evaluating the surface for corrosion resistance by Tafel polarization and self-lubricating properties by tribological studies using a pin-on-disc tribometer. The collective results showed that chemically grafted AAO nanostructures exhibit high corrosion resistance toward seawater and low frictional coefficient due to low surface energy and self-lubricating property of fatty acids covalently linked to anodized Al surfaces.
Directory of Open Access Journals (Sweden)
Leiming GUO
2018-05-01
Full Text Available Background and objective The main manifestations of radiation pneumonitis are injury of alveolar epithelial and endothelial cells, abnormal expression of cytokines, abnormal proliferation of fibroblasts and synthesis of fibrous matrix. The occurrence of radiation pneumonitis is associated with multiplecytokine level abnormality. These cytokines can also be used as bio-markers to predict the occurrence of radiation pneumonitis. This study was to evaluate the correlation between the change of apurinic/apyrimidinic endonuclease 1/redox factor-1 (Ape1/Ref-1, intercellular adhesion molecules 1 (ICAM-1 and interleukin-17A (IL-17A before and after radiotherapy and radiation pneumonitis for local advanced non-small cell lung cancer (NSCLC patients with concurrent chemoradiotherapy. Methods NSCLC patients (68 cases were treated with concurrent radiotherapy and chemotherapy, every patient’s normal tissue were controlled with a same radation dose. 68 local advanced NSCLC patients with concurrent chemoradiotherapy were detected the levels of Ape1/Ref-1, ICAM-1 and IL-17A in serum by ELISA before radiotherapy and in the 14th week after radiotherapy. Acute and advanced radiation pulmonary injury was graded according to Radiation Therapy Oncology Group/European Organization For Research and Treatment (RTOG/EORTC diagnostic and grading criteria. Grade 2 or more radiation pneumonitis was taken as the main end point. Results Eighteen cases out of 68 developed radiation pneumonitis, 50 of 68 cases have no radiation pneumonia development. There was no significant change of Ape1/Ref-1 levels before and after radiotherapy in radiation pneumonitis group (P>0.05. There was no significant change of Ape1/Ref-1 concentration in serum after radiotherapy between radiation pneumonitis group and non-radiation pneumonitis group (P>0.05. Compared with before radiotherapy, upregulation degree of ICAM-1 levels in radiation pneumonitis group was significantly higher than that in
Hot Embossing for Whole Teflon Superhydrophobic Surfaces
Directory of Open Access Journals (Sweden)
Jie Li
2018-06-01
Full Text Available In this paper, we report a simple fabrication process of whole Teflon superhydrophobic surfaces, featuring high-aspect-ratio (>20 nanowire structures, using a hot embossing process. An anodic aluminum oxide (AAO membrane is used as the embossing mold for the fabrication of high-aspect-ratio nanowires directly on a Teflon substrate. First, high-aspect-ratio nanowire structures of Teflon are formed by pressing a fluorinated ethylene propylene (FEP sheet onto a heated AAO membrane at 340 °C, which is above the melting point of FEP. Experimental results show that the heating time and aspect ratios of nanopores in the AAO mold are critical to the fidelity of the hot embossed nanowire structures. It has also been found that during the de-molding step, a large adhesive force between the AAO mold and the molded FEP greatly prolongs the length of nanowires. Contact angle measurements indicate that Teflon nanowires make the surface superhydrophobic. The reliability and robustness of superhydrophobicity is verified by a long-term (~6.5 h underwater turbulent channel flow test. After the first step of hot-embossing the Teflon nanowires, microstructures are further superimposed by repeating the hot embossing process, but this time with microstructured silicon substrates as micromolds and at a temperature lower than the melting temperature of the FEP. The results indicate that the hot embossing process is also an effective way to fabricate hierarchical micro/nanostructures of whole Teflon, which can be useful for applications of Teflon material, such as superhydrophobic surfaces.
Zelle, Boris A; Francisco, Ben S; Bossmann, James P; Fajardo, Roberto J; Bhandari, Mohit
2017-05-01
Hispanics represent the largest minority group within the US population accounting for an estimated 55.4 million individuals. Enrolling Hispanics into clinical outcome studies is important in order for study populations to be externally valid and representative of the US population. Inclusion of Mexican-Americans in clinical studies is frequently limited by the lack of validated outcome measures. The goal of this study was to validate a Spanish version of the American Academy of Orthopaedic Surgeons Foot and Ankle Outcomes Questionnaire (AAOS-FAOQ) in Mexican-Americans with traumatic foot and ankle injuries. The translation and cross-cultural adaptation procedure was performed by a committee of bilingual speakers using the following steps: (1) forward translation and adaptation, (2) synthesis, (3) back translation, (4) committee review, and (5) pilot testing. The validation was performed in 100 Mexican-Americans with traumatic foot and ankle injuries. A total of 41 females and 59 males were enrolled in this study. The mean age was 42.98 years (range 18-88). The Spanish version of the Global Foot and Ankle Scale of the AAOS-FAOQ showed statistically significant correlations with all 8 subscales of the Spanish SF-36 as well as the Physical Component Summary scale and the Mental Component Summary scale (P Foot and Ankle scale of the Spanish AAOS-FAOQ demonstrated a test-retest reliability of 0.68. We provide a Spanish translation and cross-cultural adaptation of the AAOS-FAOQ. The instrument demonstrates appropriate psychometric properties in Mexican-Americans with traumatic foot and ankle injuries.
Energy Technology Data Exchange (ETDEWEB)
Zhou, Changwu [Center for Biomedical Imaging Research, Department of Biomedical Engineering, Tsinghua University School of Medicine, Beijing (China); Department of Radiology, The Second Clinical Medical College, Yangzhou University, Yangzhou (China); Qiao, Huiyu; He, Le [Center for Biomedical Imaging Research, Department of Biomedical Engineering, Tsinghua University School of Medicine, Beijing (China); Yuan, Chun [Center for Biomedical Imaging Research, Department of Biomedical Engineering, Tsinghua University School of Medicine, Beijing (China); Department of Radiology, University of Washington, Seattle, WA (United States); Chen, Huijun; Zhang, Qiang; Li, Rui [Center for Biomedical Imaging Research, Department of Biomedical Engineering, Tsinghua University School of Medicine, Beijing (China); Wang, Wei; Du, Fang [Department of Radiology, The Second Clinical Medical College, Yangzhou University, Yangzhou (China); Li, Cheng, E-mail: cjr.licheng@vip.163.com [Department of Radiology, Zhongda Hospital, Medical School of Southeast University, Nanjing (China); Zhao, Xihai, E-mail: xihaizhao@tsinghua.edu.cn [Center for Biomedical Imaging Research, Department of Biomedical Engineering, Tsinghua University School of Medicine, Beijing (China)
2016-11-15
Purpose: To investigate the characteristics of plaque in the thoracic aorta using three dimensional multicontrast magnetic resonance imaging. Materials and methods: Elderly subjects (≥60 years) were recruited in this study. Thoracic aorta was imaged on a 3.0T MR scanner by acquiring multicontrast sequences. The plaque burden was evaluated by measuring lumen area, wall area, wall thickness, and normalized wall index. The presence or absence of plaque and intraplaque hemorrhage (IPH)/mural thrombus (MT) were identified. The characteristics of atherosclerosis among different thoracic aorta segments (AAO: ascending aorta; AOA: aortic arch, and DOA: descending aorta) were determined. Results: Of 66 recruited subjects (mean age 72.3 ± 6.2 years, 30 males), 55 (83.3%) had plaques in the thoracic aorta. The prevalence of plaque in AAO, AOA, and DAO was 5.4%, 72.7%, and 71.2%, respectively. In addition, 21.2% of subjects were found to have lesions with IPH/MT in the thoracic aorta. The prevalence of IPH/MT in segment of AAO, AOA and DAO was 0%, 13.6%, and 12.1%, respectively. The aortic wall showed the highest NWI in DAO (34.1% ± 4.8%), followed by AOA (31.2% ± 5%), and AAO (26.8% ± 3.3%) (p < 0.001). Conclusion: Three dimensional multicontrast MR imaging is capable of characterizing atherosclerotic plaques in the thoracic aorta. The findings of high prevalence of plaques and the presence of high risk plaques in the thoracic aorta suggest early screening for aortic vulnerable lesions in the elderly.
International Nuclear Information System (INIS)
Zhou, Changwu; Qiao, Huiyu; He, Le; Yuan, Chun; Chen, Huijun; Zhang, Qiang; Li, Rui; Wang, Wei; Du, Fang; Li, Cheng; Zhao, Xihai
2016-01-01
Purpose: To investigate the characteristics of plaque in the thoracic aorta using three dimensional multicontrast magnetic resonance imaging. Materials and methods: Elderly subjects (≥60 years) were recruited in this study. Thoracic aorta was imaged on a 3.0T MR scanner by acquiring multicontrast sequences. The plaque burden was evaluated by measuring lumen area, wall area, wall thickness, and normalized wall index. The presence or absence of plaque and intraplaque hemorrhage (IPH)/mural thrombus (MT) were identified. The characteristics of atherosclerosis among different thoracic aorta segments (AAO: ascending aorta; AOA: aortic arch, and DOA: descending aorta) were determined. Results: Of 66 recruited subjects (mean age 72.3 ± 6.2 years, 30 males), 55 (83.3%) had plaques in the thoracic aorta. The prevalence of plaque in AAO, AOA, and DAO was 5.4%, 72.7%, and 71.2%, respectively. In addition, 21.2% of subjects were found to have lesions with IPH/MT in the thoracic aorta. The prevalence of IPH/MT in segment of AAO, AOA and DAO was 0%, 13.6%, and 12.1%, respectively. The aortic wall showed the highest NWI in DAO (34.1% ± 4.8%), followed by AOA (31.2% ± 5%), and AAO (26.8% ± 3.3%) (p < 0.001). Conclusion: Three dimensional multicontrast MR imaging is capable of characterizing atherosclerotic plaques in the thoracic aorta. The findings of high prevalence of plaques and the presence of high risk plaques in the thoracic aorta suggest early screening for aortic vulnerable lesions in the elderly.
Lightweight Combat Vehicle S&T Initiatives
2015-08-01
Signature management, electromagnetic shielding over potentially non-metallic surfaces • Diagnostics & prognostics for structural health assessment...Misc Project Mg 1 1 1 Al 1 1 1 AHSS 2 4 2 1 1 FRC 3 1 1 AHSS weld wire Hi Speed AL FSW MG FSW MG SP Rivets Breakthru MIFERD AHSS weld wire Al...Chrysler, AET) • Integrated “ rivets ” cast into Mg part and mechanically joined to steel. 5. Laser-Assisted Joining Process of Aluminum and Carbon Fiber
The extent and nature of television food advertising to children in Xi?an, China
Li, Danyang; Wang, Ting; Cheng, Yue; Zhang, Min; Yang, Xue; Zhu, Zhonghai; Liu, Danli; Yang, Wenfang; Zeng, Lingxia
2016-01-01
Background To explore the extent and nature of television food advertising especially unhealthy food advertising to primary school children in Xi?an, China. Methods Television data were recorded for 2 weekdays and 2 weekend days between 6:00 and 22:00 during May and June in 2012 from a total of five television channels most popular with children in Xi?an. Pearson ? 2 tests and logistic regression were applied to determine differences in the proportion of healthy food, unhealthy food and misce...
Anodic Aluminum Oxide Membrane-Assisted Fabrication of ?-In2S3Nanowires
Shi, Jen-Bin; Chen, Chih-Jung; Lin, Ya-Ting; Hsu, Wen-Chia; Chen, Yu-Cheng; Wu, Po-Feng
2009-01-01
Abstract In this study, β-In2S3nanowires were first synthesized by sulfurizing the pure Indium (In) nanowires in an AAO membrane. As FE-SEM results, β-In2S3nanowires are highly ordered, arranged tightly corresponding to the high porosity of the AAO membrane used. The diameter of the β-In2S3nanowires is about 60 nm with the length of about 6–8 μm. Moreover, the aspect ratio of β-In2S3nanowires is up to 117. An EDS analysis revealed the β-In2S3nanowires with ...
Electrochemical Thinning for Anodic Aluminum Oxide and Anodic Titanium Oxide
Energy Technology Data Exchange (ETDEWEB)
Lee, In Hae; Jo, Yun Kyoung; Kim, Yong Tae; Tak, Yong Sug; Choi, Jin Sub [Inha University, Incheon (Korea, Republic of)
2012-05-15
For given electrolytes, different behaviors of anodic aluminum oxide (AAO) and anodic titanium oxide (ATO) during electrochemical thinning are explained by ionic and electronic current modes. Branched structures are unavoidably created in AAO since the switch of ionic to electronic current is slow, whereas the barrier oxide in ATO is thinned without formation of the branched structures. In addition, pore opening can be possible in ATO if chemical etching is performed after the thinning process. The thinning was optimized for complete pore opening in ATO and potential-current behavior is interpreted in terms of ionic current-electronic current switching.
Ocakoglu, Kasim; Joya, Khurram S.; Harputlu, Ersan; Tarnowska, Anna; Gryko, Daniel T.
2014-07-01
Self-assembled supramolecular organization of nano-structured biomimetic light-harvesting modules inside solid-state nano-templates can be exploited to develop excellent light-harvesting materials for artificial photosynthetic devices. We present here a hybrid light-harvesting system mimicking the chlorosomal structures of the natural photosynthetic system using synthetic zinc chlorin units (ZnChl-C6, ZnChl-C12 and ZnChl-C18) that are self-aggregated inside the anodic aluminum oxide (AAO) nano-channel membranes. AAO nano-templates were modified with a TiO2 matrix and functionalized with long hydrophobic chains to facilitate the formation of supramolecular Zn-chlorin aggregates. The transparent Zn-chlorin nano-aggregates inside the alkyl-TiO2 modified AAO nano-channels have a diameter of ~120 nm in a 60 μm length channel. UV-Vis studies and fluorescence emission spectra further confirm the formation of the supramolecular ZnChl aggregates from monomer molecules inside the alkyl-functionalized nano-channels. Our results prove that the novel and unique method can be used to produce efficient and stable light-harvesting assemblies for effective solar energy capture through transparent and stable nano-channel ceramic materials modified with bio-mimetic molecular self-assembled nano-aggregates.Self-assembled supramolecular organization of nano-structured biomimetic light-harvesting modules inside solid-state nano-templates can be exploited to develop excellent light-harvesting materials for artificial photosynthetic devices. We present here a hybrid light-harvesting system mimicking the chlorosomal structures of the natural photosynthetic system using synthetic zinc chlorin units (ZnChl-C6, ZnChl-C12 and ZnChl-C18) that are self-aggregated inside the anodic aluminum oxide (AAO) nano-channel membranes. AAO nano-templates were modified with a TiO2 matrix and functionalized with long hydrophobic chains to facilitate the formation of supramolecular Zn-chlorin aggregates. The
Wildner, Elena
2016-01-01
Neutrinos are produced by many processes in our universe. These elusive particles reach the earth having a certain energy permitting them to react with nuclei in detectors that are specifically designed to probe their properties. However, to get higher intensities and higher energy neutrinos for better statistics and better physics reach, the use of accelerators is necessary to advance in the field of neutrino research. To produce neutrinos with an accelerator, one needs to send a high power beam onto a target to get particles or isotopes that produce neutrinos with the required properties, by decay. The parent particles have to be collected and prepared for injection into an accelerating structure. Accelerator-based experiments can tune the energy of the produced neutrinos by boosting and controlling the energy of the parent particle. The produced neutrinos will travel the distance between the source and the detector, generally through earth; the distance the neutrino travels through earth, the energy of the...
Heavy Metals and the Petroleum Industr
1993-05-01
460 11 Fat Rendering 220 210 70 460 6 Bakery 150 330 430 280 2 Misc. Foods 350 150 110 1100 6 Brewery 410 60 40 470 5 Soft Drinks/ Flavoring 2040 180...arsenic react with -SH groups and can form coordination complexes and chelates with various compounds and structures in the cell .’ The -SH and...important in the function of the human body. It is present in the circulatory system, and a component in the formation of bones and teeth. Calcium is
Plasmonic nanostructures for surface-enhanced Raman spectroscopy
Jiang, Ruiqian
In the last three decades, a large number of different plasmonic nanostructures have attracted much attention due to their unique optical properties. Those plasmonic nanostructures include nanoparticles, nanoholes and metal nanovoids. They have been widely utilized in optical devices and sensors. When the plasmonic nanostructures interact with the electromagnetic wave and their surface plasmon frequency match with the light frequency, the electrons in plasmonic nanostructures will resonate with the same oscillation as incident light. In this case, the plasmonic nanostructures can absorb light and enhance the light scattering. Therefore, the plasmonic nanostructures can be used as substrate for surface-enhanced Raman spectroscopy to enhance the Raman signal. Using plasmonic nanostructures can significantly enhance Raman scattering of molecules with very low concentrations. In this thesis, two different plasmonic nanostructures Ag dendrites and Au/Ag core-shell nanoparticles are investigated. Simple methods were used to produce these two plasmonic nanostructures. Then, their applications in surface enhanced Raman scattering have been explored. Ag dendrites were produced by galvanic replacement reaction, which was conducted using Ag nitrate aqueous solution and copper metal. Metal copper layer was deposited at the bottom side of anodic aluminum oxide (AAO) membrane. Silver wires formed inside AAO channels connected Ag nitrate on the top of AAO membrane and copper layer at the bottom side of AAO. Silver dendrites were formed on the top side of AAO. The second plasmonic nanostructure is Au/Ag core-shell nanoparticles. They were fabricated by electroless plating (galvanic replacement) reaction in a silver plating solution. First, electrochemically evolved hydrogen bubbles were used as template through electroless deposition to produce hollow Au nanoparticles. Then, the Au nanoparticles were coated with Cu shells in a Cu plating solution. In the following step, a Ag
Directory of Open Access Journals (Sweden)
Gérrard Eddy Jai Poinern
2011-01-01
Full Text Available Gérrard Eddy Jai Poinern, Robert Shackleton, Shariful Islam Mamun, Derek FawcettMurdoch Applied Nanotechnology Research Group, Department of Physics, Energy Studies and Nanotechnology, School of Engineering and Energy, Murdoch University, Murdoch, Western Australia, AustraliaAbstract: Tissue engineering is a multidisciplinary field that can directly benefit from the many advancements in nanotechnology and nanoscience. This article reviews a novel biocompatible anodic aluminum oxide (AAO, alumina membrane in terms of tissue engineering. Cells respond and interact with their natural environment, the extracellular matrix, and the landscape of the substrate. The interaction with the topographical features of the landscape occurs both in the micrometer and nanoscales. If all these parameters are favorable to the cell, the cell will respond in terms of adhesion, proliferation, and migration. The role of the substrate/scaffold is crucial in soliciting a favorable response from the cell. The size and type of surface feature can directly influence the response and behavior of the cell. In the case of using an AAO membrane, the surface features and porosity of the membrane can be dictated at the nanoscale during the manufacturing stage. This is achieved by using general laboratory equipment to perform a relatively straightforward electrochemical process. During this technique, changing the operational parameters of the process directly controls the nanoscale features produced. For example, the pore size, pore density, and, hence, density can be effectively controlled during the synthesis of the AAO membrane. In addition, being able to control the pore size and porosity of a biomaterial such as AAO significantly broadens its application in tissue engineering.Keywords: anodic aluminum oxide, nanoscaffolds, cellular response, tissue engineering
McLean, Duncan; John, Sujit; Barrett, Robert; McGrath, John; Loa, Peter; Thara, Rangaswamy; Mowry, Bryan
2012-04-30
We contrasted demographic and clinical characteristics in transethnic schizophrenia populations from Australia (n=821), India (n=520) and Sarawak, Malaysia (n=298) and proposed cultural explanations for identified site differences. From these we aimed to identify candidate variables free from significant cultural confounding that are hence suitable for inclusion in genetic analyses. We observed five phenomena: (1) more individuals were living alone in Australia than India or Sarawak; (2) drug use was lower in India than Australia or Sarawak; (3) duration of untreated psychosis (DUP) was longer in India than Australia or Sarawak; (4) the rate of schizoaffective disorder was lower in India than Australia or Sarawak; and (5) age at psychosis onset (AAO) was older in Sarawak than Australia or India. We suggest that site differences for living arrangements, drug use and DUP are culturally confounded. The schizoaffective site difference likely results from measurement bias. The AAO site difference, however, has no obvious cultural or measurement bias explanation. Therefore, this may be an ideal candidate for use in genetic studies, given that genetic variants affecting AAO have already been proposed. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Readability of Orthopaedic Oncology-related Patient Education Materials Available on the Internet.
Shah, Akash K; Yi, Paul H; Stein, Andrew
2015-12-01
A person's health literacy is one of the most important indicators of a patient's health status. According to national recommendations, patient education materials should be written at no higher than the sixth- to eighth-grade reading level. The purpose of our study was to assess the readability of online patient education materials related to orthopaedic oncology on the websites of the American Academy of Orthopaedic Surgeons (AAOS), American Cancer Society (ACS), Bone and Cancer Foundation (BCF), and National Cancer Institute (NCI). We searched the online patient education libraries of the AAOS, ACS, BCF, and NCI for all articles related to orthopaedic oncology. The Flesch-Kincaid (FK) readability score was calculated for each article and compared between sources. A total of 227 articles were identified with an overall mean FK grade level of 9.8. Stratified by source, the mean FK grade levels were 10.1, 9.6, 11.1, and 9.5 for the AAOS, ACS, BCF, and NCI, respectively (P education materials related to orthopaedic oncology appear to be written at a level above the comprehension ability of the average patient. Copyright 2015 by the American Academy of Orthopaedic Surgeons.
Template directed synthesis of plasmonic gold nanotubes with tunable IR absorbance.
Bridges, Colin R; Schon, Tyler B; DiCarmine, Paul M; Seferos, Dwight S
2013-04-01
A nearly parallel array of pores can be produced by anodizing aluminum foils in acidic environments. Applications of anodic aluminum oxide (AAO) membranes have been under development since the 1990's and have become a common method to template the synthesis of high aspect ratio nanostructures, mostly by electrochemical growth or pore-wetting. Recently, these membranes have become commercially available in a wide range of pore sizes and densities, leading to an extensive library of functional nanostructures being synthesized from AAO membranes. These include composite nanorods, nanowires and nanotubes made of metals, inorganic materials or polymers. Nanoporous membranes have been used to synthesize nanoparticle and nanotube arrays that perform well as refractive index sensors, plasmonic biosensors, or surface enhanced Raman spectroscopy (SERS) substrates, as well as a wide range of other fields such as photo-thermal heating, permselective transport, catalysis, microfluidics, and electrochemical sensing. Here, we report a novel procedure to prepare gold nanotubes in AAO membranes. Hollow nanostructures have potential application in plasmonic and SERS sensing, and we anticipate these gold nanotubes will allow for high sensitivity and strong plasmon signals, arising from decreased material dampening.
Tailoring defect structure and optical absorption of porous anodic aluminum oxide membranes
International Nuclear Information System (INIS)
Yan Hongdan; Lemmens, Peter; Wulferding, Dirk; Shi, Jianmin; Becker, Klaus Dieter; Lin, Chengtian; Lak, Aidin; Schilling, Meinhard
2012-01-01
Defects influence the optical and electronic properties of nanostructured materials that may be relevant for applications. In self-organized anodic aluminum oxide (AAO) templates we have investigated the effect of annealing, doping and nanoscale metal deposition. Optical absorption spectroscopy has been used as a sensitive probe for the defect density in AAO templates. The electronic spectra are found to be dominated by bands which originate from oxygen-deficient color centers (F + , F and F 2 ). In annealing studies, the integrated absorption of the bands changes non-monotonically with annealing temperature and annealing time. This demonstrates that the concentration of defects can be optimized to tailor the optical properties of the AAO. Metallic Au wires are deposited in the template to establish a plasmonic template or array. The investigations provide an interesting insight into the interplay of reactivity and diffusivity on nanoscales. - Highlights: ► Preparation of metal wire arrays in oxide templates with tailored plasmonic properties. ► Oxygen defects are characterized using optical absorption and fluorescence. ► Optical absorption spectra are assigned to energy levels of oxygen vacancies (color centers). ► Annealing and electrodeposition of Au wires minimize defects maintaining the morphology.
International Nuclear Information System (INIS)
Nguyen, Hoang-Duy; Nguyen, Hieu Pham Trung; Lee, Jae-jin; Mho, Sun-Il
2012-01-01
We report on the achievement of the enhanced cathodoluminescence (CL) from InGaN/GaN light-emitting diodes (LEDs) by using roughening surface. Nanoporous anodic aluminum oxide (AAO) mask was utilized to form nano-hole arrays on the surface of InGaN/GaN LEDs. AAO membranes with ordered hexagonal structures were fabricated from aluminum foils by a two-step anodization method. The average pore densities of ∼1.0 × 10 10 cm −2 and 3.0 × 10 10 cm −2 were fabricated with the constant anodization voltages of 25 and 40 V, respectively. Anodic porous alumina film with a thickness of ∼600 nm has been used as a mask for the induced couple plasma etching process to fabricate nano-hole arrays on the LED surface. Diameter and depth of nano-holes can be controlled by varying the etching duration and/or the diameter of AAO membranes. Due to the reduction of total internal reflection obtained in the patterned samples, we have observed that the cathodoluminescence intensity of LEDs with nanoporous structures is increased up to eight times compared to that of samples without using nanoporous structure. (paper)
Nguyen, Hoang-Duy; Nguyen, Hieu Pham Trung; Lee, Jae-jin; Mho, Sun-Il
2012-12-01
We report on the achievement of the enhanced cathodoluminescence (CL) from InGaN/GaN light-emitting diodes (LEDs) by using roughening surface. Nanoporous anodic aluminum oxide (AAO) mask was utilized to form nano-hole arrays on the surface of InGaN/GaN LEDs. AAO membranes with ordered hexagonal structures were fabricated from aluminum foils by a two-step anodization method. The average pore densities of ˜1.0 × 1010 cm-2 and 3.0 × 1010 cm-2 were fabricated with the constant anodization voltages of 25 and 40 V, respectively. Anodic porous alumina film with a thickness of ˜600 nm has been used as a mask for the induced couple plasma etching process to fabricate nano-hole arrays on the LED surface. Diameter and depth of nano-holes can be controlled by varying the etching duration and/or the diameter of AAO membranes. Due to the reduction of total internal reflection obtained in the patterned samples, we have observed that the cathodoluminescence intensity of LEDs with nanoporous structures is increased up to eight times compared to that of samples without using nanoporous structure.
Sol-gel auto-combustion synthesis of hydroxyapatite nanotubes array in porous alumina template
International Nuclear Information System (INIS)
Yuan Yuan; Liu Changsheng; Zhang Yuan; Shan Xiaoqian
2008-01-01
In this paper, an array of highly ordered hydroxyapatite (HAP) nanotubes was synthesized by sol-gel auto-combustion method with porous anodic aluminum oxide (AAO) template for the first time. Based on thermogravimetry (DTA/TG), Fourier transform infrared (FTIR) and X-ray diffraction (XRD), the dried gel, derived from the sol solution with Ca(NO 3 ) 2 .4H 2 O and PO(CH 3 O) 3 as precursors and ethylene glycol as the polymeric matrix, exhibited a typical self-propagating combustion behavior at low temperature, directly resulting in hexagonal crystalline HAP materials. The resultant HAP arrays fabricated from the above sol-gel in the AAO template were uniformly distributed, highly ordered nanotubes with uniform length and diameter according to the observations of scanning electron microscopy (SEM) and transmission electron microscope (TEM). The electron diffraction (ED), XRD and X-ray photoelectron spectroscopy (XPS) survey proved the formation of HAP phase with polycrystalline structure in the AAO template. Based on these results, a potential mechanism of 'an auto-combustion from dried gel to nanoparticles and a subsequent in situ reaction from nanoparticles to nanotubes' was proposed
International Nuclear Information System (INIS)
Kuang Qin; Lin Zhiwei; Lian Wei; Jiang Zhiyuan; Xie Zhaoxiong; Huang Rongbin; Zheng Lansun
2007-01-01
In this paper, we report a versatile synthetic method of ordered rare-earth metal (RE) oxide nanotubes. RE (RE=Y, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho, Er, Yb) oxide nanotubes were successfully prepared from corresponding RE nitrate solution via the sol-gel method assisted with porous anodic aluminum oxide (AAO) templates. Scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution TEM, and X-ray diffraction (XRD) have been employed to characterize the morphology and composition of the as-prepared nanotubes. It is found that as-prepared RE oxides evolve into bamboo-like nanotubes and entirely hollow nanotubes. A new possible formation mechanism of RE oxide nanotubes in the AAO channels is proposed. These high-quantity RE oxide nanotubes are expected to have promising applications in many areas such as luminescent materials, catalysts, magnets, etc. - Graphical abstract: A versatile synthetic method for the preparation of ordered rare-earth (RE) oxide nanotubes is reported, by which RE (RE=Y, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho, Er, Yb) oxide nanotubes were successfully prepared from corresponding RE nitrate solution via the sol-gel method assisted with porous anodic aluminum oxide (AAO) templates
Fabrication of polymeric nano-batteries array using anodic aluminum oxide templates.
Zhao, Qiang; Cui, Xiaoli; Chen, Ling; Liu, Ling; Sun, Zhenkun; Jiang, Zhiyu
2009-02-01
Rechargeable nano-batteries were fabricated in the array pores of anodic aluminum oxide (AAO) template, combining template method and electrochemical method. The battery consisted of electropolymerized PPy electrode, porous TiO2 separator, and chemically polymerized PAn electrode was fabricated in the array pores of two-step anodizing aluminum oxide (AAO) membrane, based on three-step assembling method. It performs typical electrochemical battery behavior with good charge-discharge ability, and presents a capacity of 25 nAs. AFM results show the hexagonal array of nano-batteries' top side. The nano-battery may be a promising device for the development of Micro-Electro-Mechanical Systems (MEMS), and Nano-Electro-Mechanical Systems (NEMS).
Template-based fabrication of nanowire-nanotube hybrid arrays
International Nuclear Information System (INIS)
Ye Zuxin; Liu Haidong; Schultz, Isabel; Wu Wenhao; Naugle, D G; Lyuksyutov, I
2008-01-01
The fabrication and structure characterization of ordered nanowire-nanotube hybrid arrays embedded in porous anodic aluminum oxide (AAO) membranes are reported. Arrays of TiO 2 nanotubes were first deposited into the pores of AAO membranes by a sol-gel technique. Co nanowires were then electrochemically deposited into the TiO 2 nanotubes to form the nanowire-nanotube hybrid arrays. Scanning electron microscopy and transmission electron microscopy measurements showed a high nanowire filling factor and a clean interface between the Co nanowire and the TiO 2 nanotube. Application of these hybrids to the fabrication of ordered nanowire arrays with highly controllable geometric parameters is discussed
Metrology measurements for large-aperture VPH gratings
Zheng, Jessica R.; Gers, Luke; Heijmans, Jeroen
2013-09-01
The High Efficiency and Resolution Multi Element Spectrograph (HERMES) for the Australian Astronomical Observatory (AAO) uses four large aperture, high angle of incidence volume phase holographic gratings (VPHG) for high resolution `Galactic archaeology' spectroscopy. The large clear aperture, the high diffraction efficiency, the line frequency homogeneity, and mosaic alignment made manufacturing and testing challenging. We developed new metrology systems at the AAO to verify the performance of these VPH gratings. The measured diffraction efficiencies and line frequency of the VPH gratings received so far meet the vendor's provided data. The wavefront quality for the Blue VPH grating is good but the Green and Red VPH gratings need to be post polishing.
Design and fabrication of Ni nanowires having periodically hollow nanostructures
Sada, Takao; Fujigaya, Tsuyohiko; Nakashima, Naotoshi
2014-09-01
We propose a concept for the design and fabrication of metal nanowires having periodically hollow nanostructures inside the pores of an anodic aluminum oxide (AAO) membrane using a sacrificial metal. In this study, nickel (Ni) and silver (Ag) were used as the base metal and the sacrificial metal, respectively. Alternating an applied potential between -0.4 and -1.0 V provided alternatively deposited Ni and Ag segments in a Ni-Ag `barcode' nanowire with a diameter of 18 or 35 nm. After etching away the Ag segments, we fabricated Ni nanowires with nanopores of 12 +/- 5.3 nm. Such nanostructure formation is explained by the formation of a Ni shell layer over the surface of the Ag segments due to the strong affinity of Ni2+ for the interior surfaces of AAO. The Ni shell layer allows the Ni segments to remain even after dissolution of the Ag segments. Because the electroplating conditions can be easily controlled, we could carefully adjust the size and pitch of the periodically hollow nanospaces. We also describe a method for the fabrication of Ni nanorods by forming an Ag shell instead of a Ni shell on the Ni-Ag barcode nanowire, in which the interior of the AAO surfaces was modified with a compound bearing a thiol group prior to electroplating.We propose a concept for the design and fabrication of metal nanowires having periodically hollow nanostructures inside the pores of an anodic aluminum oxide (AAO) membrane using a sacrificial metal. In this study, nickel (Ni) and silver (Ag) were used as the base metal and the sacrificial metal, respectively. Alternating an applied potential between -0.4 and -1.0 V provided alternatively deposited Ni and Ag segments in a Ni-Ag `barcode' nanowire with a diameter of 18 or 35 nm. After etching away the Ag segments, we fabricated Ni nanowires with nanopores of 12 +/- 5.3 nm. Such nanostructure formation is explained by the formation of a Ni shell layer over the surface of the Ag segments due to the strong affinity of Ni2+ for the
Moral Hazard: How The National Flood Insurance Program Is Limiting Risk Reduction
2016-12-01
Improvements,” YouTube video, posted by Gary Taylor, October 15, 2014, https://www.youtube.com/watch?v=Wt3lMwCRhd0&list=PLADFiMUo5Nk7 ajNQxa8N5s9G1IJ4gRrsZ...disaster assistance. A review of our history shows that federal intervention in disaster recovery before the Great Depression was essentially non...Service, 2011), https://www.fas.org/sgp/crs/misc/R40650.pdf, Summary. 84 Patricia Griggs, “The National Flood Insurance Program,” YouTube video
Im, Dohyun; Matsui, Daisuke; Arakawa, Takatoshi; Isobe, Kimiyasu; Asano, Yasuhisa; Fushinobu, Shinya
2018-03-01
l-Amino acid oxidase/monooxygenase from Pseudomonas sp. AIU 813 (l-AAO/MOG) catalyzes both the oxidative deamination and oxidative decarboxylation of the α-group of l-Lys to produce a keto acid and amide, respectively. l-AAO/MOG exhibits limited specificity for l-amino acid substrates with a basic side chain. We previously determined its ligand-free crystal structure and identified a key residue for maintaining the dual activities. Here, we determined the structures of l-AAO/MOG complexed with l-Lys, l-ornithine, and l-Arg and revealed its substrate recognition. Asp238 is located at the ceiling of a long hydrophobic pocket and forms a strong interaction with the terminal, positively charged group of the substrates. A mutational analysis on the D238A mutant indicated that the interaction is critical for substrate binding but not for catalytic control between the oxidase/monooxygenase activities. The catalytic activities of the D238E mutant unexpectedly increased, while the D238F mutant exhibited altered substrate specificity to long hydrophobic substrates. In the ligand-free structure, there are two channels connecting the active site and solvent, and a short region located at the dimer interface is disordered. In the l-Lys complex structure, a loop region is displaced to plug the channels. Moreover, the disordered region in the ligand-free structure forms a short helix in the substrate complex structures and creates the second binding site for the substrate. It is assumed that the amino acid substrate enters the active site of l-AAO/MOG through this route. The atomic coordinates and structure factors (codes 5YB6, 5YB7, and 5YB8) have been deposited in the Protein Data Bank (http://wwpdb.org/). 1.4.3.2 (l-amino acid oxidase), 1.13.12.2 (lysine 2-monooxygenase).
Cruchaga, Carlos; Graff, Caroline; Chiang, Huei-Hsin; Wang, Jun; Hinrichs, Anthony L.; Spiegel, Noah; Bertelsen, Sarah; Mayo, Kevin; Norton, Joanne B.; Morris, John C.; Goate, Alison
2011-01-01
Objective A recent genome-wide association study for frontotemporal lobar degeneration with TAR DNA-binding protein inclusions (FTLD-TDP), identified rs1990622 (TMEM106B) as a risk factor for FTLD-TDP. In this study we tested whether rs1990622 is associated with age at onset (AAO) in granulin (GRN) mutation carriers and with plasma GRN levels in mutation carriers and healthy elderly individuals. Design Rs1990622 was genotyped in GRN mutation carriers and tested for association with AAO using the Kaplan-Meier and a Cox proportional hazards model. Subjects We analyzed 50 affected and unaffected GRN mutation carriers from four previously reported FTLD-TDP families (HDDD1, FD1, HDDD2 and the Karolinska family). GRN plasma levels were also measured in 73 healthy, elderly individuals. Results The risk allele of rs1990622 is associated with a mean decrease of the age at onset of thirteen years (p=9.9×10−7), with lower plasma granulin levels in both healthy older adults (p = 4×10−4) and GRN mutation carriers (p=0.0027). Analysis of the HAPMAP database identified a non-synonymous single nucleotide polymorphism, rs3173615 (T185S) in perfect linkage disequilibrium with rs1990622. Conclusions The association of rs1990622 with AAO explains, in part, the wide range in the age at onset of disease among GRN mutation carriers. We hypothesize that rs1990622 or another variant in linkage disequilibrium could act in a manner similar to APOE in Alzheimer’s disease, increasing risk for disease in the general population and modifying AAO in mutation carriers. Our results also suggest that genetic variation in TMEM106B may influence risk for FTLD-TDP by modulating secreted levels of GRN. PMID:21220649
Altered aortic shape in bicuspid aortic valve relatives influences blood flow patterns.
Schnell, Susanne; Smith, Danielle A; Barker, Alex J; Entezari, Pegah; Honarmand, Amir R; Carr, Maria L; Malaisrie, S Chris; McCarthy, Patrick M; Collins, Jeremy; Carr, James C; Markl, Michael
2016-11-01
Bicuspid aortic valve (BAV) is known to exhibit familial inheritance and is associated with aortopathy and altered aortic haemodynamics. However, it remains unclear whether BAV-related aortopathy can be inherited independently of valve morphology. Four-dimensional flow magnetic resonance imaging for the in vivo assessment of thoracic aortic 3D blood flow was performed in 24 BAV relatives with trileaflet aortic valves (age = 40 ± 14 years) and 15 healthy controls (age = 37 ± 10 years). Data analysis included aortic dimensions, shape (round/gothic/cubic), and 3D blood flow characteristics (semi-quantitative vortex/helix grading and peak velocities). Cubic and gothic aortic shapes were markedly more prevalent in BAV relatives compared with controls (38 vs. 7%). Ascending aorta (AAo) vortex flow in BAV relatives was significantly increased compared with controls (grading = 1.5 ± 1.0 vs. 0.6 ± 0.9, P = 0.015). Aortic haemodynamics were influenced by aortic shape: peak velocities were reduced for gothic aortas vs. round aortas (P = 0.003); vortex flow was increased for cubic aortas in the AAo (P gothic aortas in the AAo and descending aorta (P = 0.003, P = 0.029). Logistic regression demonstrated significant associations of shape with severity of vortex flow in AAo (P < 0.001) and aortic arch (P = 0.016) in BAV relatives. BAV relatives expressed altered aortic shape and increased vortex flow despite the absence of valvular disease or aortic dilatation. These data suggest a heritable component of BAV-related aortopathy affecting aortic shape and aberrant blood flow, independent of valve morphology. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2016. For permissions please email: journals.permissions@oup.com.
Bowan, Merrill D
2002-09-01
In 1998, the American Academy of Pediatrics, the American Academy of Ophthalmology, and the American Association of Pediatric Ophthalmology and Strabismus (AAP/AAO/AAPOS) published a position paper entitled "Learning Disabilities, Dyslexia And Vision: A Subject Review," intended to support their assertion that there is no relationship between learning disabilities, dyslexia, and vision. The paper presents an unsupported opinion that optometrists (by implication) have said that vision problems cause learning disabilities and/or dyslexia and that visual therapy cures the conditions. The 1998 position paper follows two very similar and discredited papers published in 1972 and 1981. This article critically reviews and comments on the many problems of scholarship, the inconsistencies, and the false allegations the position paper presents. Perhaps the foremost problem is that the authoring committee has ignored a veritable mountain of relevant literature that strongly argues against their assertion that vision does not relate to academic performance. It is for this reason that an overview, drawn from more than 1,400 identified references from Medline and other database sources and pertinent texts that were reviewed, is incorporated into this current article. The AAP/AAO/AAPOS paper is also examined for the Levels of Evidence that their references offer in support of their position. The AAP/AAO/AAPOS paper contains errors and internal inconsistencies. Through highly selective reference choices, it misrepresents the great body of evidence from the literature that supports a relationship between visual and perceptual problems as they contribute to classroom difficulties. The 1998 paper should be retracted because of the errors, bias, and disinformation it presents. The public assigns great trust to authorities for accurate, intellectually honest guidance, which is lacking in this AAP/AAO/AAPOS position paper.
A Review on Anodic Aluminum Oxide Methods for Fabrication of Nanostructures for Organic Solar Cells
DEFF Research Database (Denmark)
Goszczak, Arkadiusz Jaroslaw; Cielecki, Pawel Piotr
2018-01-01
Implementation of nanostructures into the organic solar cell (OSC) architecture has great influence on the device performance. Nanostructuring the active layer increases the interfacial area between donor and acceptor, which enhances the probability of exciton dissociation. Introduction of nanost......Implementation of nanostructures into the organic solar cell (OSC) architecture has great influence on the device performance. Nanostructuring the active layer increases the interfacial area between donor and acceptor, which enhances the probability of exciton dissociation. Introduction......, low fabrication cost and easy control over its nano-scale morphology, make AAO patterning methods an intriguing candidate for nanopatterning. Hence, in this work, we present a review on the fabrication techniques and on nanostructures from Anodic Aluminum Oxide (AAO) for OSC applications...
Capacitance of a highly ordered array of nanocapacitors: Model and microscopy
Cortés, A.; Celedón, C.; Ulloa, P.; Kepaptsoglou, D.; Häberle, P.
2011-11-01
This manuscript describes briefly the process used to build an ordered porous array in an anodic aluminum oxide (AAO) membrane, filled with multiwall carbon nanotubes (MWCNTs). The MWCNTs were grown directly inside the membrane through chemical vapor deposition (CVD). The role of the CNTs is to provide narrow metal electrodes contact with a dielectric surface barrier, hence, forming a capacitor. This procedure allows the construction of an array of 1010 parallel nano-spherical capacitors/cm2. A central part of this contribution is the use of physical parameters obtained from processing transmission electron microscopy (TEM) images, to predict the specific capacitance of the AAOs arrays. Electrical parameters were obtained by solving Laplace's equation through finite element methods (FEMs).
International Nuclear Information System (INIS)
Chen, Shu-Fang; Wei, Hao Han; Liu, Chuan-Pu; Hsu, C Y; Huang, J C A
2010-01-01
The magnetic and magneto-transport properties of Ni nanowire (NW) arrays, fabricated by electrodeposition in anodic-aluminum-oxide (AAO) templates, have been investigated. The AAO pores have diameters ranging from 35 to 75 nm, and the crystallinity of the Ni NW arrays could change from poly-crystalline to single-crystalline with the [111] and [110] orientations based on the electrodeposition potential. Notably, double switching magnetization loops and double-peaked magnetoresistance curves were observed in [110]-oriented NWs. The crystalline orientation of the Ni NW arrays is found to influence the corresponding magnetic and magneto-transport properties significantly. These magnetic behaviors are dominated by the competition between the magneto-crystalline and shape anisotropy.
ORF Alignment: NC_004557 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Query: 323 RIDNILEEETICESKNPKAPSSYDIEFNNVSFSYNALDASTRKEALSNISFKAKKDSLTA 382 ... RIDNILEEETICESKNPK...APSSYDIEFNNVSFSYNALDASTRKEALSNISFKAKKDSLTA Sbjct: 1 ... RIDNILEEETICESKNPKAPSSYDIEF...lostridium tetani E88] gb|AAO35968.1| transporter ... [Clostridium tetani E88] ... Length = 262
Optical constants of anodic aluminum oxide films formed in oxalic acid solution
Energy Technology Data Exchange (ETDEWEB)
Wang Jian [College of Physics and Electronic Engineering, Northwest Normal University, Lanzhou 730070 (China); Wang Chengwei [College of Physics and Electronic Engineering, Northwest Normal University, Lanzhou 730070 (China); State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China)], E-mail: cwwang@nwnu.edu.cn; Li Yan [College of Physics and Electronic Engineering, Northwest Normal University, Lanzhou 730070 (China); Liu Weimin [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China)
2008-09-01
The anodic aluminum oxide (AAO) films with highly ordered nanopore arrays were prepared in oxalic acid solution under different anodizing voltage and time, its surface and cross section appearances were characterized by using field emission scanning electron microscopy, the transmission spectra with the interference fringes were measured at normal incidence over the wavelength range 200 to 2500 nm. Then the modified Swanepoel method was used for the determination of the optical constants and thickness of the free standing AAO films. The results indicate that the refractive index increases with the increase of anodizing voltage and the decrease of anodizing time, which is mainly due to the content of Al{sub 2}O{sub 3} with octahedron increases in the AAO films. The dispersion of the refractive index is discussed in terms of the single-oscillator Wemple-DiDomenico model, and the energy dependence of the absorption coefficient can be described using the direct transition model proposed by Tauc. Likewise, the optical energy gap E{sub g} is derived from Tauc's extrapolation, and E{sub g} increases from 4.178 to 4.256 eV with the anodizing voltage, but is weakly dependent on anodizing time. All the results are self-consistent in the paper.
Liang, Yanyan; Liu, Zhengping
2016-12-20
Ionic current rectification of nanofluidic diode membranes has been studied widely in recent years because it is analogous to the functionality of biological ion channels in principle. We report a new method to fabricate ionic current rectification membranes based on mesoporous silica confined in anodic aluminum oxide (AAO) membranes. Two types of mesostructured silica nanocomposites, hexagonal structure and nanoparticle stacked structure, were used to asymmetrically fill nanochannels of AAO membranes by a vapor-phase synthesis (VPS) method with aspiration approach and were further modified via sequence vapor infiltration (SVI) treatment. The ionic current measurements indicated that SVI treatment can modulate the asymmetric ionic transport in prepared membranes, which exhibited clear ionic current rectification phenomenon under optimal conditions. The ionic current rectifying behavior is derived from the asymmetry of surface conformations, silica species components, and hydrophobic wettability, which are created by the asymmetrical filling type, silica depositions on the heterogeneous membranes, and the condensation of silanol groups. This article provides a considerable strategy to fabricate composite membranes with obvious ionic current rectification performance via the cooperation of the VPS method and SVI treatment and opens up the potential of mesoporous silica confined in AAO membranes to mimic fluid transport in biological processes.
Nugraha Pratama, Sendi; Kurniawan, Yudhi; Muhammady, Shibghatullah; Takase, Kouichi; Darma, Yudi
2018-03-01
We study the formation of nickel nanowires (Ni NWs) grown in porous anodic aluminium oxide (AAO) template by the electrochemical deposition technique. Here, the initial AAO template was grown by anodization of aluminium substrate in sulphuric acid solution. The cross-section, crystal structure, and magnetic properties of Ni NWs system were characterized by field-emission SEM, XRD, and SQUID. As a result, the highly-ordered Ni NWs are observed with the uniform diameter of 27 nm and the length from 31 to 163 nm. Based on XRD spectra analysis, Ni NWs have the face-centered cubic structure with the lattice parameter of 0.35 nm and average crystallite size of 17.19 nm. From SQUID measurement at room temperature, by maintaining the magnetic field perpendicular to Ni NWs axis, the magnetic hysteresis of Ni NWs system show the strong ferromagnetism with the coercivity and remanence ratio of ∼148 Oe and ∼0.23, respectively. The magnetic properties are also calculated by means of generalized gradient approximation methods. From the calculation result, we show that the ferromagnetism behavior comes from Ni NWs without any contribution from AAO template or the substrate. This study opens the potential application of Ni NWs system for novel functional magnetic devices.
Electronic and optical properties of AgAlO_2: A first-principles study
International Nuclear Information System (INIS)
Bhamu, K.C.; Priolkar, K.R.
2017-01-01
In this paper, we present electronic and optical properties of silver-based delafossite compound AgAlO_2 (AAO). For the electronic properties, we have computed band structure and density of states. The origin of band structure is elucidated in terms of density of states. A significant contribution in band structure comes from Ag-4d and O-2p states around the Fermi level. The estimated band gap shows the indirect semiconducting nature of AAO having the band gap value of 2.34 eV. For the optical properties, we have calculated frequency dependent dielectric functions. The peaks in the imaginary component of dielectric function are explained by electronic transitions in the dispersion relation. Our computed results are in agreement with those available in the literature. The wide band gap and hence transparency for the UV and visible incident light photons makes AAO a precious material for transparent electronics. - Highlights: • Applied different-different types of exchange-correlations and potentials. • Becke–Johnson with Hubbard potential (BJ + U) is better for 2H-AgAlO_2. • Band gap is in reasonable agreement with experimentally reported. • Origin of energy bands is elucidated in terms of density of states. • 2H-AgAlO_2 is a promising candidate for transparent electronics.
Ocakoǧlu, Kasim; Joya, Khurram Saleem; Harputlu, Ersan; Tarnowska, Anna; Gryko, Daniel T.
2014-01-01
Self-assembled supramolecular organization of nano-structured biomimetic light-harvesting modules inside solid-state nano-templates can be exploited to develop excellent light-harvesting materials for artificial photosynthetic devices. We present here a hybrid light-harvesting system mimicking the chlorosomal structures of the natural photosynthetic system using synthetic zinc chlorin units (ZnChl-C6, ZnChl-C12 and ZnChl-C 18) that are self-aggregated inside the anodic aluminum oxide (AAO) nano-channel membranes. AAO nano-templates were modified with a TiO2 matrix and functionalized with long hydrophobic chains to facilitate the formation of supramolecular Zn-chlorin aggregates. The transparent Zn-chlorin nano-aggregates inside the alkyl-TiO2 modified AAO nano-channels have a diameter of ∼120 nm in a 60 μm length channel. UV-Vis studies and fluorescence emission spectra further confirm the formation of the supramolecular ZnChl aggregates from monomer molecules inside the alkyl-functionalized nano-channels. Our results prove that the novel and unique method can be used to produce efficient and stable light-harvesting assemblies for effective solar energy capture through transparent and stable nano-channel ceramic materials modified with bio-mimetic molecular self-assembled nano-aggregates. © 2014 the Partner Organisations.
Management of Carpal Tunnel Syndrome.
Mooar, Pekka A; Doherty, William J; Murray, Jayson N; Pezold, Ryan; Sevarino, Kaitlyn S
2018-03-15
The American Academy of Orthopaedic Surgeons (AAOS) has developed Appropriate Use Criteria (AUC) for Management of Carpal Tunnel Syndrome. Evidence-based information, in conjunction with the clinical expertise of physicians, was used to develop the criteria to improve patient care and obtain best outcomes while considering the subtleties and distinctions necessary in making clinical decisions. To provide the evidence foundation for this AUC, the AAOS Evidence-Based Medicine Unit provided the writing panel and voting panel with the 2016 AAOS Clinical Practice Guideline titled Management of Carpal Tunnel Syndrome Evidence-Based Clinical Practice Guideline. The Management of Carpal Tunnel Syndrome AUC clinical patient scenarios were derived from indications typical of patients with suspected carpal tunnel syndrome in clinical practice, as well as from current evidence-based clinical practice guidelines and supporting literature to identify the appropriateness of treatments. The 135 patient scenarios and 6 treatments were developed by the writing panel, a group of clinicians who are specialists in this AUC topic. Next, a separate, multidisciplinary, voting panel (made up of specialists and nonspecialists) rated the appropriateness of treatment of each patient scenario using a 9-point scale to designate a treatment as Appropriate (median rating, 7 to 9), May Be Appropriate (median rating, 4 to 6), or Rarely Appropriate (median rating, 1 to 3).
Energy Technology Data Exchange (ETDEWEB)
Nurmi, A [VTT Energy, Jyvaeskylae (Finland)
1997-12-01
The goal of this project is to develop a system to which source sorted combustible industrial, office and municipal waste material can be taken and where it is then processed in such way that it can be burnt in modern fluidized bed and circulating bed boilers. The project started in the end of year 1995. The main stages of the project are: (1) Study and analysis of existing technology and equipment, (2) Development of system components, (3) Development of the system, (4) Building a pilot/demonstration plant, (5) Tests and results analysis and (6) Decisions on further actions. In the year 1996 the main stage was development of system components; especially crushing. Results of running slow-speed big crushers were collected, analysed and the main development details determined. Additionally, particle size distribution from different crushing methods were analyzed using also primary and secondary crushing. Development of a heavy-duty 2-rotor ECO-Crusher and a crushing screen was started. Regarding to the development of the REF-system, different alternatives have been analyzed and possible demonstration places have been searched. The first multi-crushing line will be demonstrated in Sweden. (orig.)
Alopecia areata ofiásia na infância: do diagnóstico ao tratamento
Directory of Open Access Journals (Sweden)
José Otávio Alquezar Gozzano
2016-10-01
Full Text Available Introdução: Entre as alopecias mais comuns na infância está a alopecia areata (AA, uma afecção crônica dos folículos pilosos, de etiologia auto-imune e genética. Apresenta-se pela queda de pelos, devido a interrupção de sua síntese, sem a atrofia dos folículos, por isso é reversível. AA afeta ambos os sexos e inicia- se em qualquer idade; porém, 60% dos primeiros episódios ocorrem entre 5 e 20 anos. AA manifesta-se por placas de alopecia assintomáticas, arredondadas, sem inflamação, podendo afetar qualquer área com folículos pilosos, frequentemente o couro cabeludo. Sinal de tração positivo, pelos cadavéricos e penugem branca no exame físico da fase aguda auxiliam o diagnóstico. AA é classificada como atípica e clássica, esta última pode ser: placa única, placas múltiplas, AA total, ou AA ofiásica (AAO. AAO consiste na perda de cabelos na linha de implantação temporooccipital, atingindo as bordas inferiores do couro cabeludo; seu diagnóstico é clinico devendo ser diferenciado de Tinha do couro cabeludo, pseudopelada de Brocq e tricotilomania. O tratamento para AAO é sintomático e não altera o prognóstico, sendo utilizados principalmente corticoides tópicos, infiltrações intralesionais, antralina e minoxidil. Objetivo: Relatar caso de AAO na infância. Relato do caso: Feminina, 13 anos, com perda de cabelos há 4 anos e piora há 6 meses. Ao exame: área extensa de alopecia em região temporoocciptal até margem inferior de implantação do couro cabeludo. Sinal de tração positivo na periferia da área de alopecia. Hipótese diagnóstica: AAO. Terapia: infiltração de corticoide. Metodologia: Paciente atendida em ambulatório e revisão de literatura. Conclusão: Por acometer sobretudo os cabelos, AA afeta a autoestima e os aspectos psicológicos, principalmente das crianças, que crescem em meio propício a julgamentos e rejeição social. Assim, é importante a intervenção terapêutica precoce
U.S. Environmental Protection Agency — ToxCast is used as a cost-effective approach for efficiently prioritizing the toxicity testing of thousands of chemicals. It uses data from state-of-the-art high...
Kremli hirmud / ref. Igor Taro
2007-01-01
Ilmunud ka: Postimees : na russkom jazõke 21. apr. lk. 11. Kokkuvõte Venemaa naftakompanii Jukos endise juhi Mihhail Hodorkovski advokaadi Robert Amsterdami esinemisest Tartu Ülikooli Õigusinstituudis, kus ta rääkis Venemaa võimude tegevusest meeleavalduste laialiajamisel ja kritiseeris president Vladimir Putini poliitikat ning Saksamaa endise kantsleri Gerhard Schröderi koostööd Venemaaga Vene-Saksa gaasijuhtme projektis
Energy Technology Data Exchange (ETDEWEB)
Wong-ek, Krongkamol [Nanoscience and Technology Program, Chulalongkorn University, Bangkok 10330 (Thailand); Eiamchai, Pitak; Horprathum, Mati; Patthanasettakul, Viyapol [National Electronics and Computer Technology Center, 112 Thailand Science Park, Phahonyothin Rd., Klong Luang, Pathumthani 12120 (Thailand); Limnonthakul, Puenisara [Department of Physics, Faculty of Science, King Mongkut' s University of Technology Thonburi, Bangkok 10140 (Thailand); Chindaudom, Pongpan [National Electronics and Computer Technology Center, 112 Thailand Science Park, Phahonyothin Rd., Klong Luang, Pathumthani 12120 (Thailand); Nuntawong, Noppadon, E-mail: noppadon.nuntawong@nectec.or.t [National Electronics and Computer Technology Center, 112 Thailand Science Park, Phahonyothin Rd., Klong Luang, Pathumthani 12120 (Thailand)
2010-09-30
Low-cost and highly sensitive surface-enhanced Raman scattering (SERS) substrates have been fabricated by a simple anodizing process and a magnetron sputtering deposition. The substrates, which consist of silver nanoparticles embedded on anodic aluminum oxide (AAO) templates, are investigated by a scanning electron microscope and a confocal Raman spectroscopy. The SERS activities are demonstrated by Raman scattering from adsorbed solutions of methylene blue and pyridine on the SERS substrate surface. The most optimized SERS substrate contains the silver nanoparticles, with a size distribution of 10-30 nm, deposited on the AAO template. From a calculation, the SERS enhancement factor is as high as 8.5 x 10{sup 7}, which suggests strong potentials for direct applications in the chemical detection and analyses.
Fernanda Cerqueira Vasconcellos
2012-01-01
A Oscilação Antártica (AAO), também chamada de Modo Anular do Hemisfério Sul (HS), é um padrão de oscilação entre os cinturões de pressão das latitudes médias e altas no HS. Alguns autores indicam uma relação entre o clima da América do Sul (AS) e este padrão. Desta forma, este estudo visa avaliar a influência da AAO sobre a AS e incrementar a análise sobre os mecanismos físicos envolvidos. O objetivo geral desta tese foi analisar a configuração troposférica-estratosférica sobre a AS e oceano...
Liu, Chih-Ting; Tsai, Chia-Chan; Chu, Chien-Wei; Chi, Mu-Huan; Chung, Pei-Yun; Chen, Jiun-Tai
2018-04-18
We study the dewetting behaviors of poly(methyl methacrylate) (PMMA) thin films coated in the cylindrical nanopores of anodic aluminum oxide (AAO) templates by thermal annealing. Self-assembled monolayers (SAMs) of n-octadecyltrichlorosilane (ODTS) are introduced to modify the pore surfaces of the AAO templates to induce the dewetting process. By using scanning electron microscopy (SEM), the dewetting-induced morphology transformation from the PMMA thin films to PMMA nanoparticles with asymmetric shapes can be observed. The sizes of the PMMA nanoparticles can be controlled by the original PMMA solution concentrations. The dewetting phenomena on the modified nanopores are explained by taking into account the excess intermolecular interaction free energy (ΔG). This work opens a new possibility for creating polymer nanoparticles with asymmetric shapes in confined geometries.
Energy Technology Data Exchange (ETDEWEB)
Zhang Fan; Liu Xiaohua; Pan Caofeng; Zhu Jing [Beijing National Center for Electron Microscopy, Tsinghua University, Beijing 100084 (China); Laboratory of Advanced Materials, Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China)
2007-08-29
Self-organized nano-porous anodic aluminium oxide (AAO) membranes with small pore diameters were obtained by applying a low anodizing potential in sulfuric acid solutions. The pore diameters of the as-prepared AAO membranes were in the range of about 6-19 nm and the interpore distances were about 20-58 nm. Low potentials (6-18 V) were applied in anodizing processes to make such small pores. A linear relationship between the anodizing potential (U{sub a}) and the interpore distance (D{sub int}) was also revealed. By carefully monitoring the current density's evolution as a function of time with different U{sub a} (2-18 V) during the anodizing processes, a new formula is proposed to simulate the self-ordering anodizing process.
Template-Based Electrochemically Controlled Growth of Segmented Multimetal Nanorods
Directory of Open Access Journals (Sweden)
Mee Rahn Kim
2010-01-01
Full Text Available Multisegmented one-dimensional nanostructures composed of gold, copper, and nickel have been fabricated by depositing metals electrochemically in the pores of anodic aluminum oxide (AAO templates. The electrodeposition process has been carried out using a direct current in a two-electrode electrochemical cell, where a silver-evaporated AAO membrane and a platinum plate have served as a working electrode and a counter electrode, respectively. The striped multimetal rods with an average diameter of about 300 nm have tunable lengths ranging from a few hundred nanometers to a few micrometers. The lengths and the sequence of metal segments in a striped rod can be tailored readily by controlling the durations of electrodeposition and the order of electroplating solutions, respectively.
Luminescence characteristics of nanoporous anodic alumina annealed at different temperatures
Ilin, D. O.; Vokhmintsev, A. S.; Weinstein, I. A.
2016-09-01
Anodic aluminum oxide (AAO) membranes with 100 µm thickness were synthesized in oxalic acid solution under constant current density. Grown samples were annealed in 500-1250 °C range for 5 h in air. Average pore diameter was evaluated using quantitative analysis of SEM images and appeared to be within 78-86 nm diapason. It was found there was a broad emission band in the 350-620 nm region of photoluminescence (PL) spectra in amorphous membranes which is attributed to F-type oxygen deficient centers or oxalic ions. It was shown that intensive red emission caused by Cr3+ (696 nm) and Mn4+ (680 nm) impurities dominates in PL of AAO samples with crystalline α- and δ-phases after annealing at 1100-1250 °C temperatures.
Síntese enzimática de ascorbil oleato utilizando tecnologias alternativas
Balen, Manuela
2016-01-01
Tese (doutorado) - Universidade Federal de Santa Catarina, Centro Tecnológico, Programa de Pós-Graduação em Engenharia de Alimentos, Florianópolis, 2016. A produção enzimática de ascorbil oleato utilizando como substratos Lascórbico e ácido oleico necessita da total solubilização entre substratos a fim de se obter maiores rendimentos. Contudo, o ácido L-ascórbico e ácido oleico não são totalmente miscíveis por possuírem polaridades bastante distintas. Assim, este trabalho objetivou bus...
Climate Prediction Center (CPC) Daily Antarctic Oscillation Index
National Oceanic and Atmospheric Administration, Department of Commerce — The Antarctic Oscillation (AAO) is a leading teleconnection pattern in the Southern Hemisphere circulation. It is calculated as the first Empirical Orthogonal...
Climate Prediction Center(CPC)Monthly Antarctic Oscillation Index
National Oceanic and Atmospheric Administration, Department of Commerce — The Antarctic Oscillation (AAO) is a leading teleconnection pattern in the Southern Hemisphere circulation. It is calculated as the first Empirical Orthogonal...
Direitos humanos e refúgio: uma análise sobre o momento pós-determinação do status de refugiado
Directory of Open Access Journals (Sweden)
Thais Silva Menezes
2013-01-01
Full Text Available A literatura sobre refugiados tem explorado a vinculação entre refúgio e direitos humanos nos países de acolhida - aspecto fundamental do regime internacional dos refugiados - em uma perspectiva predominantemente descritiva. Ressaltando a necessidade de abordagens analíticas sobre a temática, este trabalho analisa como o Alto Comissariado das Nações Unidas para os Refugiados (ACNUR tem se manifestado no que concerne aos direitos humanos dos refugiados nos países de acolhida, apontando a influência da política internacional nesse contexto. Entende-se que, uma vez compreendido o regime em sua relação com os direitos humanos, estes devem representar o parâmetro para se analisar a forma como ocorre a concretização da proteção internacional.
Venegas-González, Alejandro; Chagas, Matheus Peres; Anholetto Júnior, Claudio Roberto; Alvares, Clayton Alcarde; Roig, Fidel Alejandro; Tomazello Filho, Mario
2016-01-01
We explored the relationship between tree growth in two tropical species and local and large-scale climate variability in Southeastern Brazil. Tree ring width chronologies of Tectona grandis (teak) and Pinus caribaea (Caribbean pine) trees were compared with local (Water Requirement Satisfaction Index—WRSI, Standardized Precipitation Index—SPI, and Palmer Drought Severity Index—PDSI) and large-scale climate indices that analyze the equatorial pacific sea surface temperature (Trans-Niño Index-TNI and Niño-3.4-N3.4) and atmospheric circulation variations in the Southern Hemisphere (Antarctic Oscillation-AAO). Teak trees showed positive correlation with three indices in the current summer and fall. A significant correlation between WRSI index and Caribbean pine was observed in the dry season preceding tree ring formation. The influence of large-scale climate patterns was observed only for TNI and AAO, where there was a radial growth reduction in months preceding the growing season with positive values of the TNI in teak trees and radial growth increase (decrease) during December (March) to February (May) of the previous (current) growing season with positive phase of the AAO in teak (Caribbean pine) trees. The development of a new dendroclimatological study in Southeastern Brazil sheds light to local and large-scale climate influence on tree growth in recent decades, contributing in future climate change studies.
Pt–Al2O3 dual layer atomic layer deposition coating in high aspect ratio nanopores
International Nuclear Information System (INIS)
Pardon, Gaspard; Gatty, Hithesh K; Stemme, Göran; Wijngaart, Wouter van der; Roxhed, Niclas
2013-01-01
Functional nanoporous materials are promising for a number of applications ranging from selective biofiltration to fuel cell electrodes. This work reports the functionalization of nanoporous membranes using atomic layer deposition (ALD). ALD is used to conformally deposit platinum (Pt) and aluminum oxide (Al 2 O 3 ) on Pt in nanopores to form a metal–insulator stack inside the nanopore. Deposition of these materials inside nanopores allows the addition of extra functionalities to nanoporous materials such as anodic aluminum oxide (AAO) membranes. Conformal deposition of Pt on such materials enables increased performances for electrochemical sensing applications or fuel cell electrodes. An additional conformal Al 2 O 3 layer on such a Pt film forms a metal–insulator–electrolyte system, enabling field effect control of the nanofluidic properties of the membrane. This opens novel possibilities in electrically controlled biofiltration. In this work, the deposition of these two materials on AAO membranes is investigated theoretically and experimentally. Successful process parameters are proposed for a reliable and cost-effective conformal deposition on high aspect ratio three-dimensional nanostructures. A device consisting of a silicon chip supporting an AAO membrane of 6 mm diameter and 1.3 μm thickness with 80 nm diameter pores is fabricated. The pore diameter is reduced to 40 nm by a conformal deposition of 11 nm Pt and 9 nm Al 2 O 3 using ALD. (paper)
Energy Technology Data Exchange (ETDEWEB)
Frydrychowicz, Alex [University Hospital Schleswig-Holstein, Clinic for Radiology and Nuclear Medicine, Luebeck (Germany); Berger, Alexander; Russe, Maximilian F.; Bock, Jelena [University Hospital Freiburg, Department of Radiology, Medical Physics, Freiburg (Germany); Munoz del Rio, Alejandro [University of Wisconsin - Madison, Departments of Radiology and Medical Physics, Madison, WI (United States); Harloff, Andreas [University Hospital Freiburg, Department of Neurology and Clinical Neurophysiology, Freiburg (Germany); Markl, Michael [University Hospital Freiburg, Department of Radiology, Medical Physics, Freiburg (Germany); Northwestern University, Departments of Radiology and Biomedical Engineering, Chicago, IL (United States)
2012-05-15
It was the aim to analyse the impact of age, aortic arch geometry, and size on secondary flow patterns such as helix and vortex flow derived from flow-sensitive magnetic resonance imaging (4D PC-MRI). 62 subjects (age range = 20-80 years) without circumscribed pathologies of the thoracic aorta (ascending aortic (AAo) diameter: 3.2 {+-} 0.6 cm [range 2.2-5.1]) were examined by 4D PC-MRI after IRB-approval and written informed consent. Blood flow visualisation based on streamlines and time-resolved 3D particle traces was performed. Aortic diameter, shape (gothic, crook-shaped, cubic), angle, and age were correlated with existence and extent of secondary flow patterns (helicity, vortices); statistical modelling was performed. Helical flow was the typical pattern in standard crook-shaped aortic arches. With altered shapes and increasing age, helicity was less common. AAo diameter and age had the highest correlation (r = 0.69 and 0.68, respectively) with number of detected vortices. None of the other arch geometric or demographic variables (for all, P {>=} 0.177) improved statistical modelling. Substantially different secondary flow patterns can be observed in the normal thoracic aorta. Age and the AAo diameter were the parameters correlating best with presence and amount of vortices. Findings underline the importance of age- and geometry-matched control groups for haemodynamic studies. (orig.)
Electronic and optical properties of AgAlO{sub 2}: A first-principles study
Energy Technology Data Exchange (ETDEWEB)
Bhamu, K.C., E-mail: kcbhamu85@gmail.com; Priolkar, K.R.
2017-04-01
In this paper, we present electronic and optical properties of silver-based delafossite compound AgAlO{sub 2} (AAO). For the electronic properties, we have computed band structure and density of states. The origin of band structure is elucidated in terms of density of states. A significant contribution in band structure comes from Ag-4d and O-2p states around the Fermi level. The estimated band gap shows the indirect semiconducting nature of AAO having the band gap value of 2.34 eV. For the optical properties, we have calculated frequency dependent dielectric functions. The peaks in the imaginary component of dielectric function are explained by electronic transitions in the dispersion relation. Our computed results are in agreement with those available in the literature. The wide band gap and hence transparency for the UV and visible incident light photons makes AAO a precious material for transparent electronics. - Highlights: • Applied different-different types of exchange-correlations and potentials. • Becke–Johnson with Hubbard potential (BJ + U) is better for 2H-AgAlO{sub 2}. • Band gap is in reasonable agreement with experimentally reported. • Origin of energy bands is elucidated in terms of density of states. • 2H-AgAlO{sub 2} is a promising candidate for transparent electronics.
Pt-Al2O3 dual layer atomic layer deposition coating in high aspect ratio nanopores
Pardon, Gaspard; Gatty, Hithesh K.; Stemme, Göran; van der Wijngaart, Wouter; Roxhed, Niclas
2013-01-01
Functional nanoporous materials are promising for a number of applications ranging from selective biofiltration to fuel cell electrodes. This work reports the functionalization of nanoporous membranes using atomic layer deposition (ALD). ALD is used to conformally deposit platinum (Pt) and aluminum oxide (Al2O3) on Pt in nanopores to form a metal-insulator stack inside the nanopore. Deposition of these materials inside nanopores allows the addition of extra functionalities to nanoporous materials such as anodic aluminum oxide (AAO) membranes. Conformal deposition of Pt on such materials enables increased performances for electrochemical sensing applications or fuel cell electrodes. An additional conformal Al2O3 layer on such a Pt film forms a metal-insulator-electrolyte system, enabling field effect control of the nanofluidic properties of the membrane. This opens novel possibilities in electrically controlled biofiltration. In this work, the deposition of these two materials on AAO membranes is investigated theoretically and experimentally. Successful process parameters are proposed for a reliable and cost-effective conformal deposition on high aspect ratio three-dimensional nanostructures. A device consisting of a silicon chip supporting an AAO membrane of 6 mm diameter and 1.3 μm thickness with 80 nm diameter pores is fabricated. The pore diameter is reduced to 40 nm by a conformal deposition of 11 nm Pt and 9 nm Al2O3 using ALD.
Lin, Yu-Hsuan; Chen, Kun-Tso; Ho, Jeng-Rong
2011-06-01
A method for rapidly fabricating dense and high-aspect-ratio silver nanowires, with wire diameter of 200 nm and wire length more than 30 µm, is reported. The fabrication process simply involves filling the silver nitrate solution into the pores of an anodic-aluminum-oxide (AAO) membrane through capillary attraction and irradiating the dried template AAO membrane using a pulsed ArF excimer laser. Through varying the thickness and pore diameter of the employed AAO membrane, the primary dimensions of the targeted silver nanowires can be plainly specified; and, by amending the initial concentration of the silver nitrate solution and adjusting the laser operation parameters, laser fluence and number of laser pulses, the surface morphology and size of the resulting nanowires can be finely regulated. The wire formation mechanism is considered through two stages: the period of precipitation of silver particles from the dried silver nitrate film through the laser-induced photoreduction; and, the phase of clustering, merging and fusing of the reduced particles to form nanowires in the template pores by the thermal energy owing to photothermal effect. This approach is straightforward and takes the advantage that all the fabrication processes can be executed in an ambient environment and at room temperature. In addition, by the excellence in local processing that the laser possesses, this method is suitable for precisely growing nanowires.
Design and fabrication of Ni nanowires having periodically hollow nanostructures.
Sada, Takao; Fujigaya, Tsuyohiko; Nakashima, Naotoshi
2014-10-07
We propose a concept for the design and fabrication of metal nanowires having periodically hollow nanostructures inside the pores of an anodic aluminum oxide (AAO) membrane using a sacrificial metal. In this study, nickel (Ni) and silver (Ag) were used as the base metal and the sacrificial metal, respectively. Alternating an applied potential between -0.4 and -1.0 V provided alternatively deposited Ni and Ag segments in a Ni-Ag 'barcode' nanowire with a diameter of 18 or 35 nm. After etching away the Ag segments, we fabricated Ni nanowires with nanopores of 12 ± 5.3 nm. Such nanostructure formation is explained by the formation of a Ni shell layer over the surface of the Ag segments due to the strong affinity of Ni(2+) for the interior surfaces of AAO. The Ni shell layer allows the Ni segments to remain even after dissolution of the Ag segments. Because the electroplating conditions can be easily controlled, we could carefully adjust the size and pitch of the periodically hollow nanospaces. We also describe a method for the fabrication of Ni nanorods by forming an Ag shell instead of a Ni shell on the Ni-Ag barcode nanowire, in which the interior of the AAO surfaces was modified with a compound bearing a thiol group prior to electroplating.
International Nuclear Information System (INIS)
Frydrychowicz, Alex; Berger, Alexander; Russe, Maximilian F.; Bock, Jelena; Munoz del Rio, Alejandro; Harloff, Andreas; Markl, Michael
2012-01-01
It was the aim to analyse the impact of age, aortic arch geometry, and size on secondary flow patterns such as helix and vortex flow derived from flow-sensitive magnetic resonance imaging (4D PC-MRI). 62 subjects (age range = 20-80 years) without circumscribed pathologies of the thoracic aorta (ascending aortic (AAo) diameter: 3.2 ± 0.6 cm [range 2.2-5.1]) were examined by 4D PC-MRI after IRB-approval and written informed consent. Blood flow visualisation based on streamlines and time-resolved 3D particle traces was performed. Aortic diameter, shape (gothic, crook-shaped, cubic), angle, and age were correlated with existence and extent of secondary flow patterns (helicity, vortices); statistical modelling was performed. Helical flow was the typical pattern in standard crook-shaped aortic arches. With altered shapes and increasing age, helicity was less common. AAo diameter and age had the highest correlation (r = 0.69 and 0.68, respectively) with number of detected vortices. None of the other arch geometric or demographic variables (for all, P ≥ 0.177) improved statistical modelling. Substantially different secondary flow patterns can be observed in the normal thoracic aorta. Age and the AAo diameter were the parameters correlating best with presence and amount of vortices. Findings underline the importance of age- and geometry-matched control groups for haemodynamic studies. (orig.)
Resources - arthritis ... The following organizations provide more information on arthritis : American Academy of Orthopaedic Surgeons -- orthoinfo.aaos.org/menus/arthritis.cfm Arthritis Foundation -- www.arthritis.org Centers for Disease Control and Prevention -- www. ...
Demming, Anna
2013-02-01
People working in device design rarely see something that works without thinking how it could be made to work better. The work on anodic aluminum oxide materials in this issue provides a case in point [1]. Over the past century researchers have observed, manipulated and exploited the porous structures that result when anodizing aluminum in for example oxalic, sulfuric, and phosphoric acid solutions [1, 2]. The self-organized pore arrays have demonstrated the potential to facilitate high through-put, low-cost fabrication of nanocomposites as well as other nanostructures. The straight self-aligned nanochannels in porous anodic aluminum oxide (AAO) have long been accepted as an inherent property of these films and for many applications they are an attractive attribute. However, researchers in Taiwan have considered a novel manifestation of AAO materials which may enhance their natural attributes by generating arrays that bend [3]. Their work is an example of how even well studied systems continue to harbour surprises and scope for creative innovation. As the authors point out, 'This novel fan-out platform facilitates probing and handling many signals from different areas on a sample's surface and is therefore promising for applications in detection and manipulation at the nanoscale level'. It has long been recognized that the inter-pore distance, pore diameter and pore depth in AAO can be controlled by changing the anodization conditions. These accommodating features have motivated researchers to seek a better understanding of how to optimize fabrication conditions. A collaboration of researchers in Sweden, Chile and Uruguay studied the structural and optical properties of silver nanowires electrodeposited in commercially available nanoporous alumina templates, with a nominal pore diameter of 20 nm [4]. Their results revealed a decrease in the uniformity of pore filling with increasing deposition overpotential and suggested that overpotentials were preferred for the
Dager, William E
2012-01-01
Guidelines for the prevention of venous thromboembolism (VTE) after elective total hip or knee arthroplasty (THA/TKA) have been developed separately by the American Academy of Orthopaedic Surgeons (AAOS) and the American College of Chest Physicians (ACCP). Differences exist in approaches to preventing postoperative VTE through prophylaxis. To compare trials using vitamin K antagonists (VKAs) and differences in guidelines to determine the benefits and drawbacks of warfarin for VTE prophylaxis following THA/TKA. Guidelines from the AAOS published in 2009 and revised in 2011 and from the ACCP published in 2008 were compared for recommendations on the use of VKAs. A MEDLINE search from 1960 to November 2009 was conducted to identify pertinent articles on the use of warfarin or VKAs for VTE prophylaxis following THA/TKA. Search terms included warfarin, vitamin K antagonist, total hip or total knee replacement, and total hip or total knee arthroplasty. Only clinical trials in which warfarin was the primary agent for prophylaxis compared to other anticoagulants were included. Data on differences between guideline recommendations for the use of VKAs and the importance of a deep vein thrombosis or asymptomatic events were extracted. Thirteen comparative trials using VKAs for VTE prophylaxis and international normalized ratio (INR) targets were assessed. Overall, the incidence of bleeding tended to be lower with the use of VKAs, but thrombosis when including asymptomatic events was numerically higher when comparing INR targets. However, INR targets varied, with no comparative trials assessing the AAOS 2009 recommended INR target of 1.5-2.0. The AAOS guidelines initially recommended a longer duration of therapy and expressed stronger support for the use of aspirin for prophylaxis; however, in 2011, its guidelines were revised, with no specific recommendations as to agent, dose, or INR target goal. Warfarin is an effective agent to prevent VTE after elective THA/TKA. The most
10 Tips to Reduce Your Chance of Losing Vision from the Most Common Cause of Blindness
... aao.org. Log In Forgot password | Forgot email Shop the Academy Store Focal Points 2018 Module: Neuro-Ophthalmic Disorders Caused By Medications Basic and Clinical Science Course Self-Assessment Program 2018-2019 Basic and ...
Kuo, Chin-Guo; Chang, Ho; Wang, Jian-Hao
2016-01-01
In this investigation, anodic aluminum oxide (AAO) with arrayed and regularly arranged nanopores is used as a template in the high-vacuum die casting of molten zinc metal (Zn) into the nanopores. The proposed technique yields arrayed Zn nanowires with an aspect ratio of over 600. After annealing, arrayed zinc oxide (ZnO) nanowires are obtained. Varying the anodizing time yields AAO templates with thicknesses of approximately 50 μm, 60 μm, and 70 μm that can be used in the fabrication of nanowires of three lengths with high aspect ratios. Experimental results reveal that a longer nanowire generates a greater measured piezoelectric current. The ZnO nanowires that are fabricated using an alumina template are anodized for 7 h and produce higher piezoelectric current of up to 69 pA. PMID:27023546
Progress in Nano-Engineered Anodic Aluminum Oxide Membrane Development
Poinern, Gerrard Eddy Jai; Ali, Nurshahidah; Fawcett, Derek
2011-01-01
The anodization of aluminum is an electro-chemical process that changes the surface chemistry of the metal, via oxidation, to produce an anodic oxide layer. During this process a self organized, highly ordered array of cylindrical shaped pores can be produced with controllable pore diameters, periodicity and density distribution. This enables anodic aluminum oxide (AAO) membranes to be used as templates in a variety of nanotechnology applications without the need for expensive lithographical techniques. This review article is an overview of the current state of research on AAO membranes and the various applications of nanotechnology that use them in the manufacture of nano-materials and devices or incorporate them into specific applications such as biological/chemical sensors, nano-electronic devices, filter membranes and medical scaffolds for tissue engineering. PMID:28880002
Kuo, Chin-Guo; Chang, Ho; Wang, Jian-Hao
2016-03-24
In this investigation, anodic aluminum oxide (AAO) with arrayed and regularly arranged nanopores is used as a template in the high-vacuum die casting of molten zinc metal (Zn) into the nanopores. The proposed technique yields arrayed Zn nanowires with an aspect ratio of over 600. After annealing, arrayed zinc oxide (ZnO) nanowires are obtained. Varying the anodizing time yields AAO templates with thicknesses of approximately 50 μm, 60 μm, and 70 μm that can be used in the fabrication of nanowires of three lengths with high aspect ratios. Experimental results reveal that a longer nanowire generates a greater measured piezoelectric current. The ZnO nanowires that are fabricated using an alumina template are anodized for 7 h and produce higher piezoelectric current of up to 69 pA.
Magnetization Reversal Mechanism for CoFeB Ferromagnetic Nanotube Arrays
International Nuclear Information System (INIS)
Hai-Rui, Liu; Qing-Feng, Lu; Shamaila, S.; Jun-Yang, Chen; Sharif, R.; Xiu-Feng, Han
2009-01-01
CoFeB nanotube arrays are fabricated in anodic aluminum oxide (AAO) membranes and track etched polycarbonate (PCTE) membranes by using an electrochemical method, and their magnetic properties are investigated by vibrating sample magnetometry. The coercivity H c and remanent squareness S Q of these CoFeB nanotube arrays are derived from hysteresis loops as a function of angle between the field and tube axis. The H c (θ) curves for CoFeB nanotube arrays in AAO and PCTE membranes show M-type variation, while they change shape from M to mountain-type as the tube length increases. However, the overall easy axis perpendicular to tube axis does not change with tube length. The different angular dependences are attributed to different magnetization reversal mechanisms. (condensed matter: electronicstructure, electrical, magnetic, and opticalproperties)
Progress in Nano-Engineered Anodic Aluminum Oxide Membrane Development.
Poinern, Gerrard Eddy Jai; Ali, Nurshahidah; Fawcett, Derek
2011-02-25
The anodization of aluminum is an electro-chemical process that changes the surface chemistry of the metal, via oxidation, to produce an anodic oxide layer. During this process a self organized, highly ordered array of cylindrical shaped pores can be produced with controllable pore diameters, periodicity and density distribution. This enables anodic aluminum oxide (AAO) membranes to be used as templates in a variety of nanotechnology applications without the need for expensive lithographical techniques. This review article is an overview of the current state of research on AAO membranes and the various applications of nanotechnology that use them in the manufacture of nano-materials and devices or incorporate them into specific applications such as biological/chemical sensors, nano-electronic devices, filter membranes and medical scaffolds for tissue engineering.
Formation of self-ordered porous anodized alumina template for growing tungsten trioxide nanowires
Hussain, Tajamal; Shah, Asma Tufail; Shehzad, Khurram; Mujahid, Adnan; Farooqi, Zahoor Hussain; Raza, Muhammad Hamid; Ahmed, Mirza Nadeem; Nisa, Zaib Un
2015-12-01
Uniform porous anodized aluminum oxide (AAO) membrane has been synthesized by two-step anodization for fabricating tungsten trioxide (WO3) nanowires. Under assayed conditions, uniform porous structure of alumina (Al2O3) membrane with long range ordered hexagonal arrangements of nanopores was achieved. The self-assembled template possesses pores of internal diameter of 50 nm and interpore distance ( d int) of 80 nm with a thickness of about 80 µm, i.e., used for fabrication of nanostructures. WO3 nanowires have been fabricated by simple electroless deposition method inside Al2O3 nanopores. SEM images show tungsten trioxide nanowire with internal diameter of about 50 nm, similar to porous diameter of AAO template. XRD results showed that nanowires exist in cubic crystalline state with minor proportion of monoclinic phase.
Progress in Nano-Engineered Anodic Aluminum Oxide Membrane Development
Directory of Open Access Journals (Sweden)
Gerrard Eddy Jai Poinern
2011-02-01
Full Text Available The anodization of aluminum is an electro-chemical process that changes the surface chemistry of the metal, via oxidation, to produce an anodic oxide layer. During this process a self organized, highly ordered array of cylindrical shaped pores can be produced with controllable pore diameters, periodicity and density distribution. This enables anodic aluminum oxide (AAO membranes to be used as templates in a variety of nanotechnology applications without the need for expensive lithographical techniques. This review article is an overview of the current state of research on AAO membranes and the various applications of nanotechnology that use them in the manufacture of nano-materials and devices or incorporate them into specific applications such as biological/chemical sensors, nano-electronic devices, filter membranes and medical scaffolds for tissue engineering.
Growth and FIB-SEM analyses of C60 microtubes vertically synthesized on porous alumina membranes
Miyazawa, Kun'ichi; Kuriyama, Ryota; Shimomura, Shuichi; Wakahara, Takatsugu; Tachibana, Masaru
2014-02-01
The vertical growth of C60 microtubes (C60MTs) on anodic aluminum oxide (AAO) membranes was investigated. The C60MT size dependence on isopropyl alcohol (IPA) injection rate, into C60-saturated toluene solutions through AAO membranes, was measured. A longitudinal section of the interface between a vertically grown C60MT (V-C60MT) and a membrane was prepared by focused ion beam processing, and observed with scanning electron microscopy. No cracking was observed along the interface, suggesting good bonding. V-C60MTs exhibited spiral growth. V-C60MT planar density, wall thickness and aspect ratio all decreased with increasing IPA injection rate. The relationships among length, inner and outer diameters of V-C60MTs were also investigated by varying IPA injection rate.
American Academy of Ophthalmology
... location. Phaco at 50: The Challenge of Innovation Charles D. Kelman, MD, introduced phacoemulsification for cataract surgery ... Oct. 27 – 30 for AAO 2018. Subspecialty Day will take place Oct. 26 and 27. In response ...
... Award Recipients Nov 07, 2017 View all news Optometry and Vision Science Journal Optometry and Vision Science is the official journal of the American Academy of Optometry. AAO members receive a complimentary online subscription. Learn ...
The Open Science Peer Review Oath [v1; ref status: indexed, http://f1000r.es/4ou
Directory of Open Access Journals (Sweden)
Jelena Aleksic
2014-11-01
Full Text Available One of the foundations of the scientific method is to be able to reproduce experiments and corroborate the results of research that has been done before. However, with the increasing complexities of new technologies and techniques, coupled with the specialisation of experiments, reproducing research findings has become a growing challenge. Clearly, scientific methods must be conveyed succinctly, and with clarity and rigour, in order for research to be reproducible. Here, we propose steps to help increase the transparency of the scientific method and the reproducibility of research results: specifically, we introduce a peer-review oath and accompanying manifesto. These have been designed to offer guidelines to enable reviewers (with the minimum friction or bias to follow and apply open science principles, and support the ideas of transparency, reproducibility and ultimately greater societal impact. Introducing the oath and manifesto at the stage of peer review will help to check that the research being published includes everything that other researchers would need to successfully repeat the work. Peer review is the lynchpin of the publishing system: encouraging the community to consciously (and conscientiously uphold these principles should help to improve published papers, increase confidence in the reproducibility of the work and, ultimately, provide strategic benefits to authors and their institutions. Future incarnations of the various national Research Excellence Frameworks (REFs will evolve away from simple citations towards measurable societal value and impact. The proposed manifesto aspires to facilitate this goal by making transparency, reproducibility and citizen-scientist engagement (with the knowledge-creation and dissemination processes the default parameters for performing sound research.
NCBI nr-aa BLAST: CBRC-OSAT-05-0034 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OSAT-05-0034 gb|AAM20520.1| serine/threonine protein kinase isolog [Arabidopsi...s thaliana] gb|AAO30076.1| serine/threonine protein kinase isolog [Arabidopsis thaliana] AAM20520.1 1e-156 49% ...
NCBI nr-aa BLAST: CBRC-OSAT-01-0062 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OSAT-01-0062 gb|AAM20520.1| serine/threonine protein kinase isolog [Arabidopsi...s thaliana] gb|AAO30076.1| serine/threonine protein kinase isolog [Arabidopsis thaliana] AAM20520.1 1e-152 47% ...
Eltorai, Adam E M; P Thomas, Nathan; Yang, Heejae; Daniels, Alan H; Born, Christopher T
2016-02-01
According to the american medical association (AMA) and the national institutes of health (NIH), the recommended readability of patient education materials should be no greater than a sixth-grade reading level. The online patient education information produced by the american academy of orthopaedic surgeons (AAOS) may be too complicated for some patients to understand. This study evaluated whether the AAOS's online trauma-related patient education materials meet recommended readability guidelines for medical information. Ninety-nine articles from the "Broken Bones and Injuries" section of the AAOS-produced patient education website, orthoinfo.org, were analyzed for grade level readability using the Flesch-Kincaid formula, a widely-used and validated tool to evaluate the text reading level. Results for each webpage were compared to the AMA/NIH recommended sixth-grade reading level and the average reading level of U.S. adults (eighth-grade). The mean (SD) grade level readability for all patient education articles was 8.8 (1.1). All but three of the articles had a readability score above the sixth-grade level. The readability of the articles exceeded this level by an average of 2.8 grade levels (95% confidence interval, 2.6 - 3.0; P reading skill level of U.S. adults (eighth grade) by nearly an entire grade level (95% confidence interval, 0.6-1.0; P education website have readability levels that may make comprehension difficult for a substantial portion of the patient population.
International Nuclear Information System (INIS)
Tan, Wei-min; Huang, Ning; Wang, Li-jun; Song, Tian-shun; Lu, Chun-hua; Wang, Liu-fang; Zhang, Jun-zhi
2013-01-01
SiO 2 : Sm 3+ nanotube arrays with excellent antireflective property at 1.06 μm were synthesized by a template-assisted sol–gel process. The molecular structure, morphology and optical properties of the fabricated SiO 2 :Sm 3+ nanotube arrays were investigated by a Fourier transform infrared spectroscope (FTIR), a Scanning electron microscope (SEM), and a spectro-fluorometer, respectively. The experimental results demonstrate that the SiO 2 :Sm 3+ nanotube arrays were formed via the AAO membrane during the sol–gel process. The remarkable antireflective characteristic of about 0.166% at 1.06 μm was attributed to the drastic decrease of effective refraction index which enhances the matching effect between air and substrate. As well as the absorption performance of Sm3+ at 1.06 μm which consumes the energies of incident light. - Graphical abstract: Directional aligned SiO 2 :Sm 3+ nanotube arrays were synthesized in AAO template by sol–gel process, and the antiflective performance of arrays is prominent comparing to the blank AAO template. Highlights: ► SiO 2 :Sm 3+ nanotube arrays are synthesized by a template-assisted sol–gel process. ► SiO 2 :Sm 3+ nanotube arrays have remarkable antireflective properties at 1.06 μm. ► The subwavelength structure results in a decrease of effective refraction index. ► The absorption performance of Sm 3+ at 1.06 μm consume the energies of incident light
Kang, Edith Y; Fields, Henry W; Kiyak, Asuman; Beck, F Michael; Firestone, Allen R
2009-10-01
Low general and health literacy in the United States means informed consent documents are not well understood by most adults. Methods to improve recall and comprehension of informed consent have not been tested in orthodontics. The purposes of this study were to evaluate (1) recall and comprehension among patients and parents by using the American Association of Orthodontists' (AAO) informed consent form and new forms incorporating improved readability and processability; (2) the association between reading ability, anxiety, and sociodemographic variables and recall and comprehension; and (3) how various domains (treatment, risk, and responsibility) of information are affected by the forms. Three treatment groups (30 patient-parent pairs in each) received an orthodontic case presentation and either the AAO form, an improved readability form (MIC), or an improved readability and processability (pairing audio and visual cues) form (MIC + SS). Structured interviews were transcribed and coded to evaluate recall and comprehension. Significant relationships among patient-related variables and recall and comprehension explained little of the variance. The MIC + SS form significantly improved patient recall and parent recall and comprehension. Recall was better than comprehension, and parents performed better than patients. The MIC + SS form significantly improved patient treatment comprehension and risk recall and parent treatment recall and comprehension. Patients and parents both overestimated their understanding of the materials. Improving the readability of consent materials made little difference, but combining improved readability and processability benefited both patients' recall and parents' recall and comprehension compared with the AAO form.
Pai, Yi-Hao; Lin, Gong-Ru
2011-01-17
By depositing Si-rich SiOx nano-rod in nano-porous anodic aluminum oxide (AAO) membrane using PECVD, the spatially confined synthesis of Si quantum-dots (Si-QDs) with ultra-bright photoluminescence spectra are demonstrated after low-temperature annealing. Spatially confined SiOx nano-rod in nano-porous AAO membrane greatly increases the density of nucleated positions for Si-QD precursors, which essentially impedes the route of thermally diffused Si atoms and confines the degree of atomic self-aggregation. The diffusion controlled growth mechanism is employed to determine the activation energy of 6.284 kJ mole(-1) and diffusion length of 2.84 nm for SiO1.5 nano-rod in nano-porous AAO membrane. HRTEM results verify that the reduced geometric dimension of the SiOx host matrix effectively constrain the buried Si-QD size at even lower annealing temperature. The spatially confined synthesis of Si-QD essentially contributes the intense PL with its spectral linewidth shrinking from 210 to 140 nm and its peak intensity enhancing by two orders of magnitude, corresponding to the reduction on both the average Si-QD size and its standard deviation from 2.6 to 2.0 nm and from 25% to 12.5%, respectively. The red-shifted PL wavelength of the Si-QD reveals an inverse exponential trend with increasing temperature of annealing, which is in good agree with the Si-QD size simulation via the atomic diffusion theory.
Pt-Al{sub 2}O{sub 3} dual layer atomic layer deposition coating in high aspect ratio nanopores
Energy Technology Data Exchange (ETDEWEB)
Pardon, Gaspard; Gatty, Hithesh K; Stemme, Goeran; Wijngaart, Wouter van der; Roxhed, Niclas [KTH Royal Institute of Technology, School of Electrical Engineering, Micro and Nanosystems, Osquldas Vaeg 10, SE-10044 Stockholm (Sweden)
2013-01-11
Functional nanoporous materials are promising for a number of applications ranging from selective biofiltration to fuel cell electrodes. This work reports the functionalization of nanoporous membranes using atomic layer deposition (ALD). ALD is used to conformally deposit platinum (Pt) and aluminum oxide (Al{sub 2}O{sub 3}) on Pt in nanopores to form a metal-insulator stack inside the nanopore. Deposition of these materials inside nanopores allows the addition of extra functionalities to nanoporous materials such as anodic aluminum oxide (AAO) membranes. Conformal deposition of Pt on such materials enables increased performances for electrochemical sensing applications or fuel cell electrodes. An additional conformal Al{sub 2}O{sub 3} layer on such a Pt film forms a metal-insulator-electrolyte system, enabling field effect control of the nanofluidic properties of the membrane. This opens novel possibilities in electrically controlled biofiltration. In this work, the deposition of these two materials on AAO membranes is investigated theoretically and experimentally. Successful process parameters are proposed for a reliable and cost-effective conformal deposition on high aspect ratio three-dimensional nanostructures. A device consisting of a silicon chip supporting an AAO membrane of 6 mm diameter and 1.3 {mu}m thickness with 80 nm diameter pores is fabricated. The pore diameter is reduced to 40 nm by a conformal deposition of 11 nm Pt and 9 nm Al{sub 2}O{sub 3} using ALD. (paper)
Confinement effects on the crystalline features of poly(9,9-dioctylfluorene)
Martin, Jaime; Scaccabarozzi, Alberto D.; Nogales, Aurora; Li, Ruipeng; Smilgies, Detlef-M.; Stingelin, Natalie
2016-01-01
the cylindrical nanopores of anodic aluminium oxide (AAO) templates and crystallized via two crystallization strategies, namely, in the presence or in the absence of a surface bulk reservoir located at the template surface. We show that highly textured
Anodization of Aluminium using a fast two-step process
Indian Academy of Sciences (India)
283.6 eV. Keywords. Anodization; phosphoric acid; anodization time; anodized aluminium oxide; aluminium. ... of anodization.5–7 The AAO layer has a large band gap, good ..... transmittance increases as the anodised membrane is heated to ...
ORF Alignment: NC_002128 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ing protein SopA [Large-insert cloning vector ... pSMART VC] gb|AAR05665.1| stabilization of plasmid ... ... protein A [Salmonella typhimurium] gb|AAO61293.1| ParA ... [BAC cloning vector pEBAC190G
Overuse Injury: How to Prevent Training Injuries
... Accessed Dec. 21, 2015. Tips for a safe running program. American Academy of Orthopaedic Surgeons. http://orthoinfo.aaos.org/topic.cfm?topic=A00132. Accessed Dec. 21, 2015. Overuse injury. The American Orthopaedic Society for Sports Medicine. http:// ...
Directory of Open Access Journals (Sweden)
Chin-Guo Kuo
2016-03-01
Full Text Available In this investigation, anodic aluminum oxide (AAO with arrayed and regularly arranged nanopores is used as a template in the high-vacuum die casting of molten zinc metal (Zn into the nanopores. The proposed technique yields arrayed Zn nanowires with an aspect ratio of over 600. After annealing, arrayed zinc oxide (ZnO nanowires are obtained. Varying the anodizing time yields AAO templates with thicknesses of approximately 50 μm, 60 μm, and 70 μm that can be used in the fabrication of nanowires of three lengths with high aspect ratios. Experimental results reveal that a longer nanowire generates a greater measured piezoelectric current. The ZnO nanowires that are fabricated using an alumina template are anodized for 7 h and produce higher piezoelectric current of up to 69 pA.
Liu, Jianxi; Ma, Shuanhong; Wei, Qiangbing; Jia, Lei; Yu, Bo; Wang, Daoai; Zhou, Feng
2013-12-07
Smart systems on the nanometer scale for continuous flow-through reaction present fascinating advantages in heterogeneous catalysis, in which a parallel array of straight nanochannels offers a platform with high surface area for assembling and stabilizing metallic nanoparticles working as catalysts. Herein we demonstrate a method for finely modifying the nanoporous anodic aluminum oxide (AAO), and further integration of nanoreactors. By using atomic transfer radical polymerization (ATRP), polymer brushes were successfully grafted on the inner wall of the nanochannels of the AAO membrane, followed by exchanging counter ions with a precursor for nanoparticles (NPs), and used as the template for deposition of well-defined Au NPs. The membrane was used as a functional nanochannel for novel flow-through catalysis. High catalytic performance and instantaneous separation of products from the reaction system was achieved in reduction of 4-nitrophenol.
A Patient-Centered Approach to Clinical Practice Guidelines in Otolaryngology
Pynnonen, Melissa A.; Hawley, Sarah T.
2014-01-01
Patient education is used to engage patients in their own health care and is relevant in most clinical situations. Shared decision making (SDM) is used to engage patients when a choice needs to be made about a diagnostic or therapeutic procedure and the medical evidence does not indicate which choice is best. American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS) clinical practice guidelines (CPGs) include multiple action statements that may benefit from patient education or SDM. In this Commentary we discuss patient education and SDM using examples from AAO-HNS CPGs. We believe that use of patient education and decision support materials for SDM will enhance the effectiveness of SDM and improve the uptake of CPG. We issue a call to action for all stakeholders to consider how to put these materials into the hands of our patients. PMID:24718756
Broadband infrared metamaterial absorber based on anodic aluminum oxide template
Yang, Jingfan; Qu, Shaobo; Ma, Hua; Wang, Jiafu; Yang, Shen; Pang, Yongqiang
2018-05-01
In this work, a broadband infrared metamaterial absorber is proposed based on trapezoid-shaped anodic aluminum oxide (AAO) template. Unlike traditional metamaterial absorber constructed from metal-dielectric-metal sandwich structure, our proposed absorber is composed of trapezoid-shaped AAO template with metallic nanowires inside. The infrared absorption efficiency is numerically calculated and the mechanism analysis is given in the paper. Owing to the superposition of multiple resonances produced by the nanowires with different heights, the infrared metamatrial absorber can keep high absorption efficiency during broad working wavelength band from 3.4 μm to 6.1 μm. In addition, the resonance wavelength is associated with the height of nanowires, which indicates that the resonance wavelength can be modulated flexibly through changing the heights of nanowires. This kind of design can also be adapted to other wavelength regions.
Nanochannels Photoelectrochemical Biosensor.
Zhang, Nan; Ruan, Yi-Fan; Zhang, Li-Bin; Zhao, Wei-Wei; Xu, Jing-Juan; Chen, Hong-Yuan
2018-02-06
Nanochannels have brought new opportunities for biosensor development. Herein, we present the novel concept of a nanochannels photoelectrochemical (PEC) biosensor based on the integration of a unique Cu x O-nanopyramid-islands (NPIs) photocathode, an anodic aluminum oxide (AAO) membrane, and alkaline phosphatase (ALP) catalytic chemistry. The Cu x O-NPIs photocathode possesses good performance, and further assembly with AAO yields a designed architecture composed of vertically aligned, highly ordered nanoarrays on top of the Cu x O-NPIs film. After biocatalytic precipitation (BCP) was stimulated within the channels, the biosensor was used for the successful detection of ALP activity. This study has not only provided a novel paradigm for an unconventional nanochannels PEC biosensor, which can be used for general bioanalytical purposes, but also indicated that the new concept of nanochannel-semiconductor heterostructures is a step toward innovative biomedical applications.
Nanoporous polymeric nanofibers based on selectively etched PS-b-PDMS block copolymers.
Demirel, Gokcen B; Buyukserin, Fatih; Morris, Michael A; Demirel, Gokhan
2012-01-01
One-dimensional nanoporous polymeric nanofibers have been fabricated within an anodic aluminum oxide (AAO) membrane by a facile approach based on selective etching of poly(dimethylsiloxane) (PDMS) domains in polystyrene-block-poly(dimethylsiloxane) (PS-b-PDMS) block copolymers that had been formed within the AAO template. It was observed that prior to etching, the well-ordered PS-b-PDMS nanofibers are solid and do not have any porosity. The postetched PS nanofibers, on the other hand, had a highly porous structure having about 20-50 nm pore size. The nanoporous polymeric fibers were also employed as a drug carrier for the native, continuous, and pulsatile drug release using Rhodamine B (RB) as a model drug. These studies showed that enhanced drug release and tunable drug dosage can be achieved by using ultrasound irradiation. © 2011 American Chemical Society
Liu, Jianxi; Ma, Shuanhong; Wei, Qiangbing; Jia, Lei; Yu, Bo; Wang, Daoai; Zhou, Feng
2013-11-01
Smart systems on the nanometer scale for continuous flow-through reaction present fascinating advantages in heterogeneous catalysis, in which a parallel array of straight nanochannels offers a platform with high surface area for assembling and stabilizing metallic nanoparticles working as catalysts. Herein we demonstrate a method for finely modifying the nanoporous anodic aluminum oxide (AAO), and further integration of nanoreactors. By using atomic transfer radical polymerization (ATRP), polymer brushes were successfully grafted on the inner wall of the nanochannels of the AAO membrane, followed by exchanging counter ions with a precursor for nanoparticles (NPs), and used as the template for deposition of well-defined Au NPs. The membrane was used as a functional nanochannel for novel flow-through catalysis. High catalytic performance and instantaneous separation of products from the reaction system was achieved in reduction of 4-nitrophenol.
Designed synthesis of tunable amorphous carbon nanotubes (a ...
Indian Academy of Sciences (India)
Administrator
The as-prepared a-CNTs were a kind of hydrogenated a-CNTs containing both ... aluminium oxide (AAO) template, solvothermal method, etc., have been developed to ... above products were treated by dilute HCl solution to remove VOx in the ...
Kang, Eunae; Jeon, Gumhye; Kim, Jin Kon
2013-07-21
The mesoporous carbon nanofiber arrays that stand on carbon-gold double-layer current collectors are synthesized by self-assembly of a PS-b-PEO copolymer and resol in AAO templates for a high-power micro-supercapacitor at high current densities.
Unustamatu aasta 1988 / ref. Urmi Reinde
2008-01-01
Rahvarinde 20. aastapäevale pühendatud konverentsil peetud ettekannete referaadid: Rein Ruutsoo, Dainis Ivans, Kazimiera Danute Prunskiene, Juri Afanasjev, Edgar Savisaar, Kazimieras Motieka, Kauko Sipponen
International Nuclear Information System (INIS)
Sharma, Kashish; Routkevitch, Dmitri; Varaksa, Natalia; George, Steven M.
2016-01-01
Spatial atomic layer deposition (S-ALD) was examined on flexible porous substrates utilizing a rotating cylinder reactor to perform the S-ALD. S-ALD was first explored on flexible polyethylene terephthalate polymer substrates to obtain S-ALD growth rates on flat surfaces. ZnO ALD with diethylzinc and ozone as the reactants at 50 °C was the model S-ALD system. ZnO S-ALD was then performed on nanoporous flexible anodic aluminum oxide (AAO) films. ZnO S-ALD in porous substrates depends on the pore diameter, pore aspect ratio, and reactant exposure time that define the gas transport. To evaluate these parameters, the Zn coverage profiles in the pores of the AAO films were measured using energy dispersive spectroscopy (EDS). EDS measurements were conducted for different reaction conditions and AAO pore geometries. Substrate speeds and reactant pulse durations were defined by rotating cylinder rates of 10, 100, and 200 revolutions per minute (RPM). AAO pore diameters of 10, 25, 50, and 100 nm were utilized with a pore length of 25 μm. Uniform Zn coverage profiles were obtained at 10 RPM and pore diameters of 100 nm. The Zn coverage was less uniform at higher RPM values and smaller pore diameters. These results indicate that S-ALD into porous substrates is feasible under certain reaction conditions. S-ALD was then performed on porous Li ion battery electrodes to test S-ALD on a technologically important porous substrate. Li 0.20 Mn 0.54 Ni 0.13 Co 0.13 O 2 electrodes on flexible metal foil were coated with Al 2 O 3 using 2–5 Al 2 O 3 ALD cycles. The Al 2 O 3 ALD was performed in the S-ALD reactor at a rotating cylinder rate of 10 RPM using trimethylaluminum and ozone as the reactants at 50 °C. The capacity of the electrodes was then tested versus number of charge–discharge cycles. These measurements revealed that the Al 2 O 3 S-ALD coating on the electrodes enhanced the capacity stability. This S-ALD process could be extended to roll-to-roll operation for
Nanoscale aluminum concaves for light-trapping in organic thin-films
DEFF Research Database (Denmark)
Goszczak, Arkadiusz Jaroslaw; Adam, Jost; Cielecki, Pawel Piotr
2016-01-01
Anodic aluminum oxide (AAO) templates, fabricated from oxalic acid and phosphoric acid, lead to non-periodic nanoscale concave structures in their underlying aluminum layer, which are investigated for their field-enhancement properties by applying a thin-film polymer coating based laser ablation...
Multifunctional Core-Shell and Nano-channel Design for Nano-sized Thermo-sensor
2015-04-01
based on the filling of metals into a nanochannel design. Particularly, different metal alloys with tunable metlingpoints were used to created...nanowires in nanopores of anodic aluminium oxide by mechanical pressure injection. These nanowires inside AAO channels can behave as effective thermal
Fabrication of Arrays of Metal and Metal Oxide Nanotubes by Shadow Evaporation
Dickey, Michael D.; Weiss, Emily A.; Smythe, Elizabeth J.; Chiechi, Ryan C.; Capasso, Federico; Whitesides, George M.
2008-01-01
This paper describes a simple technique for fabricating uniform arrays of metal and metal oxide nanotubes with controlled heights and diameters. The technique involves depositing material onto an anodized aluminum oxide (AAO) membrane template using a collimated electron beam evaporation source. The
Pinheiro, Paula C; Sousa, Célia T; Araújo, João P; Guiomar, António J; Trindade, Tito
2013-11-15
This work reports research on the development of bimodal magnetic and fluorescent 1D nanoprobes. First, ferromagnetic nickel nanowires (NiNW) have been prepared by Ni electrodeposition in an anodic aluminum oxide (AAO) template. The highly ordered self-assembled AAO nanoporous templates were fabricated using a two-step anodization method of aluminum foil. The surface of the NiNW were then modified with polyethyleneimine (PEI) which was previously labeled with an organic dye (fluorescein isothiocyanate: FITC) via covalent bonding. The ensuing functionalized NiNW exhibited the characteristic green fluorescence of FITC and could be magnetically separated from aqueous solutions by using a NdFeB magnet. Finally, the interest of these bimodal NiNW as nanoprobes for in vitro cell separation and biolabeling was preliminary assessed in a proof of principle experiment that involved the attachment of biofunctionalized NiNW to blood cells. Copyright © 2013 Elsevier Inc. All rights reserved.
The effect of age of onset of PD on risk of dementia
DEFF Research Database (Denmark)
Aarsland, Dag; Kvaløy, J.T.; Andersen, Kjeld
2007-01-01
followed prospectively for 3-4 years and assessed for dementia according to DSM-IIIR. All PD and control cases underwent neurological examination and were followed with neurological and neuropsychological assessments. We used Cox proportional hazards regression based on three different time scales...... to explore the effect of AAO of PD on risk of dementia, adjusting for age at baseline and other demographic and clinical variables. FINDINGS: In both PD groups and in the pooled analyses, there was a significant effect of age at baseline assessment on the time to develop dementia, but there was no effect...... AAO of PD symptoms is a risk factor for dementia independent of the general effect of age. METHODS: Two community-based studies of PD in New York (n=281) and Rogaland county, Norway (n=227) and two population-based groups of healthy elderly from New York (n=180) and Odense, Denmark (n=2414) were...
Anodic Aluminum Oxide Membrane-Assisted Fabrication of beta-In(2)S(3) Nanowires.
Shi, Jen-Bin; Chen, Chih-Jung; Lin, Ya-Ting; Hsu, Wen-Chia; Chen, Yu-Cheng; Wu, Po-Feng
2009-06-06
In this study, beta-In(2)S(3) nanowires were first synthesized by sulfurizing the pure Indium (In) nanowires in an AAO membrane. As FE-SEM results, beta-In(2)S(3) nanowires are highly ordered, arranged tightly corresponding to the high porosity of the AAO membrane used. The diameter of the beta-In(2)S(3) nanowires is about 60 nm with the length of about 6-8 mum. Moreover, the aspect ratio of beta-In(2)S(3) nanowires is up to 117. An EDS analysis revealed the beta-In(2)S(3) nanowires with an atomic ratio of nearly S/In = 1.5. X-ray diffraction and corresponding selected area electron diffraction patterns demonstrated that the beta-In(2)S(3) nanowire is tetragonal polycrystalline. The direct band gap energy (E(g)) is 2.40 eV from the optical measurement, and it is reasonable with literature.
Wang, Chuanju; Wang, Guiqiang; Yang, Rui; Sun, Xiangyu; Ma, Hui; Sun, Shuqing
2017-01-17
Arrays of ordered nanorods are of special interest in many fields. However, it remains challenging to obtain such arrays on conducting substrates in a facile manner. In this article, we report the fabrication of highly ordered and vertically standing nanorod arrays of both metals and semiconductors on Au films and indium tin oxide glass substrates without an additional layering. In this approach, following the simple hydrophilic treatment of an anodic aluminum oxide (AAO) membrane and conducting substrates, the AAO membrane was transferred onto the modified substrates with excellent adhesion. Subsequently, nanorod arrays of various materials were electrodeposited on the conducting substrates directly. This method avoids any expensive and tedious lithographic and ion milling process, which provides a simple yet robust route to the fabrication of arrays of 1D materials with high aspect ratio on conducting substrates, which shall pave the way for many practical applications in a range of fields.
Evolution of magnetic and transport properties in pore-modified CoAlO antidot arrays
International Nuclear Information System (INIS)
Ma, Y G; Lim, S L; Ong, C K
2007-01-01
CoAlO composite antidot arrays were fabricated on self-organized porous anodic aluminium oxide (AAO) membranes. The effects of pore size and film thickness on the magnetism and magnetotransport properties of the CoAlO films were investigated. On increasing the pore dimensions in the arrays, an anisotropic to isotropic magnetism transition was observed. The result is discussed based on the competitive contributions from the external field induced uniaxial anisotropy and the topology-induced shape anisotropy superimposed by the stray fields from the pore channels. Magnetoresistance showed corresponding variations with increasing pore sizes, as evidenced by a magnetoresistance variation from typically anisotropic to nearly isotropic behaviour. When deposited on large-pored AAO membranes, the antidot arrays showed no obvious anisotropy at different film thicknesses. It led to negligible magnetoresistive loops in the thick films of high structural continuity. The possible reasons for spin-independent electron scatterings are discussed
Outcomes after treatment of acute aortic occlusion.
de Varona Frolov, Serguei R; Acosta Silva, Marcela P; Volo Pérez, Guido; Fiuza Pérez, Maria D
2015-11-01
Acute aortic occlusion (AAO) is a rare disease with high morbidity and mortality. The aim of this study was to describe the results of surgical treatment of acute aortic occlusion and risk factors for mortality. Retrospective review of the clinical history of 29 patients diagnosed and operated on for AAO during 28 years. The following variables were analysed: age, sex, tabaco use, diabetes, chronic renal insufficiency, chronic heart failure, atrial fibrillation, arterial hypertension, symptoms, diagnosis and treatment, 30-day mortality and long-term survival. A univariant analysis was performed of variables related to mortality. Twenty-nine patients were included (18 male) with a mean age of 66,2 years. The aetiology was: embolism (EM) in 11 cases and Thrombosis (TR) in 18 cases. The surgical procedures performed included bilateral transfemoral thrombectomy (14 cases), aorto-bifemoral by-pass (8 cases), axilo uni/bifemoral by-pass (5 cases) and aortoiliac and renal tromboendarterectomy (2 cases). Morbidity included: renal failure (14 cases), mesenteric ischemia (4 cases), cardiac complications (7 cases), respiratory complications (5 cases) and loss of extremity (2 cases). The in-hospital mortality was 21% (EM 0%, TR 21%). The estimated survival at 1.3 and 5 years was 60, 50 and 44% respectively. Age (p=0.032), arterial hypertension (p=0.039) and aetiology of the AAO (p=0.039) were related to mortality. Acute aortic occlusion is a medical emergency with high mortality rates. Acute renal failure is the most common postoperative complication. Copyright © 2012 AEC. Publicado por Elsevier España, S.L.U. All rights reserved.
Polyelectrolyte layer-by-layer deposition in cylindrical nanopores.
Lazzara, Thomas D; Lau, K H Aaron; Abou-Kandil, Ahmed I; Caminade, Anne-Marie; Majoral, Jean-Pierre; Knoll, Wolfgang
2010-07-27
Layer-by-layer (LbL) deposition of polyelectrolytes within nanopores in terms of the pore size and the ionic strength was experimentally studied. Anodic aluminum oxide (AAO) membranes, which have aligned, cylindrical, nonintersecting pores, were used as a model nanoporous system. Furthermore, the AAO membranes were also employed as planar optical waveguides to enable in situ monitoring of the LbL process within the nanopores by optical waveguide spectroscopy (OWS). Structurally well-defined N,N-disubstituted hydrazine phosphorus-containing dendrimers of the fourth generation, with peripherally charged groups and diameters of approximately 7 nm, were used as the model polyelectrolytes. The pore diameter of the AAO was varied between 30-116 nm and the ionic strength was varied over 3 orders of magnitude. The dependence of the deposited layer thickness on ionic strength within the nanopores is found to be significantly stronger than LbL deposition on a planar surface. Furthermore, deposition within the nanopores can become inhibited even if the pore diameter is much larger than the diameter of the G4-polyelectrolyte, or if the screening length is insignificant relative to the dendrimer diameter at high ionic strengths. Our results will aid in the template preparation of polyelectrolyte multilayer nanotubes, and our experimental approach may be useful for investigating theories regarding the partitioning of nano-objects within nanopores where electrostatic interactions are dominant. Furthermore, we show that the enhanced ionic strength dependence of polyelectrolyte transport within the nanopores can be used to selectively deposit a LbL multilayer atop a nanoporous substrate.
A general melt-injection-decomposition route to oriented metal oxide nanowire arrays
International Nuclear Information System (INIS)
Han, Dongqiang; Zhang, Xinwei; Hua, Zhenghe; Yang, Shaoguang
2016-01-01
Highlights: • A general melt-injection-decomposition (MID) route is proposed for the fabrication of oriented metal oxide nanowire arrays. • Four kinds of metal oxide (CuO, Mn_2O_3, Co_3O_4 and Cr_2O_3) nanowire arrays have been realized as examples through the developed MID route. • The mechanism of the developed MID route is discussed using Thermogravimetry and Differential Thermal Analysis technique. • The MID route is a versatile, simple, facile and effective way to prepare different kinds of oriented metal oxide nanowire arrays in the future. - Abstract: In this manuscript, a general melt-injection-decomposition (MID) route has been proposed and realized for the fabrication of oriented metal oxide nanowire arrays. Nitrate was used as the starting materials, which was injected into the nanopores of the anodic aluminum oxide (AAO) membrane through the capillarity action in its liquid state. At higher temperature, the nitrate decomposed into corresponding metal oxide within the nanopores of the AAO membrane. Oriented metal oxide nanowire arrays were formed within the AAO membrane as a result of the confinement of the nanopores. Four kinds of metal oxide (CuO, Mn_2O_3, Co_3O_4 and Cr_2O_3) nanowire arrays are presented here as examples fabricated by this newly developed process. X-ray diffraction, scanning electron microscopy and transmission electron microscopy studies showed clear evidence of the formations of the oriented metal oxide nanowire arrays. Formation mechanism of the metal oxide nanowire arrays is discussed based on the Thermogravimetry and Differential Thermal Analysis measurement results.
Neubacher, Henrik; Mey, Ingo; Carnarius, Christian; Lazzara, Thomas D; Steinem, Claudia
2014-04-29
Screening tools to study antimicrobial peptides (AMPs) with the aim to optimize therapeutic delivery vectors require automated and parallelized sampling based on chip technology. Here, we present the development of a chip-based assay that allows for the investigation of the action of AMPs on planar lipid membranes in a time-resolved manner by fluorescence readout. Anodic aluminum oxide (AAO) composed of cylindrical pores with a diameter of 70 nm and a thickness of up to 10 μm was used as a support to generate pore-spanning lipid bilayers from giant unilamellar vesicle spreading, which resulted in large continuous membrane patches sealing the pores. Because AAO is optically transparent, fluid single lipid bilayers and the underlying pore cavities can be readily observed by three-dimensional confocal laser scanning microscopy (CLSM). To assay the membrane permeabilizing activity of the AMPs, the translocation of the water-soluble dyes into the AAO cavities and the fluorescence of the sulforhodamine 101 1,2-dihexadecanoyl-sn-glycero-3-phosphoethanol-l-amine triethylammonium salt (Texas Red DHPE)-labeled lipid membrane were observed by CLSM in a time-resolved manner as a function of the AMP concentration. The effect of two different AMPs, magainin-2 and melittin, was investigated, showing that the concentrations required for membrane permeabilization and the kinetics of the dye entrance differ significantly. Our results are discussed in light of the proposed permeabilization models of the two AMPs. The presented data demonstrate the potential of this setup for the development of an on-chip screening platform for AMPs.
Orthogonal functionalization of nanoporous substrates: control of 3D surface functionality.
Lazzara, Thomas D; Kliesch, Torben-Tobias; Janshoff, Andreas; Steinem, Claudia
2011-04-01
Anodic aluminum oxide (AAO) membranes with aligned, cylindrical, nonintersecting pores were selectively functionalized in order to create dual-functionality substrates with different pore-rim and pore-interior surface functionalities, using silane chemistry. We used a two-step process involving an evaporated thin gold film to protect the underlying surface functionality of the pore rims. Subsequent treatment with oxygen plasma of the modified AAO membrane removed the unprotected organic functional groups, i.e., the pore-interior surface. After gold removal, the substrate became optically transparent, and displayed two distinct surface functionalities, one at the pore-rim surface and another at the pore-interior surface. We achieved a selective hydrophobic functionalization with dodecyl-trichlorosilane of either the pore rims or the pore interiors. The deposition of planar lipid membranes on the functionalized areas by addition of small unilamellar vesicles occurred in a predetermined fashion. Small unilamellar vesicles only ruptured upon contact with the hydrophobic substrate regions forming solid supported hybrid bilayers. In addition, pore-rim functionalization with dodecyl-trichlorosilane allowed the formation of pore-spanning hybrid lipid membranes as a result of giant unilamellar vesicle rupture. Confocal laser scanning microscopy was employed to identify the selective spatial localization of the adsorbed fluorescently labeled lipids. The corresponding increase in the AAO refractive index due to lipid adsorption on the hydrophobic regions was monitored by optical waveguide spectroscopy. This simple orthogonal functionalization route is a promising method to control the three-dimensional surface functionality of nanoporous films. © 2011 American Chemical Society
Yang, Shan-Shan; Pang, Ji-Wei; Jin, Xiao-Man; Wu, Zhong-Yang; Yang, Xiao-Yin; Guo, Wan-Qian; Zhao, Zhi-Qing; Ren, Nan-Qi
2018-03-01
Redundant excess sludge production and considerable non-standard wastewater discharge from existing activated sludge processes are facing more and more challenges. The investigations on lower sludge production and higher sewage treatment efficiency are urgently needed. In this study, an anaerobic/anoxic/micro-aerobic/oxic-MBR combining a micro-aerobic starvation sludge holding tank (A2MMBR-M) system is developed. Batch tests on the optimization of the staged dissolved oxygen (DO) in the micro-aerobic, the first oxic, and the second oxic tanks were carried out by a 3-factor and 3-level Box-Behnken design (BBD). The optimal actual values of X1 , X2 , and X3 were DO1 of 0.3-0.5 mg/L, DO2 of 3.5-4.5 mg/L, and DO3 of 3-4 mg/L. After the optimization tests, continuous-flow experiments of anaerobic/anoxic/oxic (AAO) and A2MMBR-M systems were further conducted. Compared to AAO system, a 37.45% reduction in discharged excess sludge in A2MMBR-M system was achieved. The COD, TN, and TP removal efficiencies in A2MMBR-M system were respective 4.06%, 2.68%, and 4.04% higher than AAO system. The A2MMBR-M system is proved a promising wastewater treatment technology possessing enhanced in-situ sludge reduction and improved effluent quality. The staged optimized DO concentrations are the key controlling parameters for the realization of simultaneous in-situ sludge reduction and nutrient removal.
Improving web site performance using commercially available analytical tools.
Ogle, James A
2010-10-01
It is easy to accurately measure web site usage and to quantify key parameters such as page views, site visits, and more complex variables using commercially available tools that analyze web site log files and search engine use. This information can be used strategically to guide the design or redesign of a web site (templates, look-and-feel, and navigation infrastructure) to improve overall usability. The data can also be used tactically to assess the popularity and use of new pages and modules that are added and to rectify problems that surface. This paper describes software tools used to: (1) inventory search terms that lead to available content; (2) propose synonyms for commonly used search terms; (3) evaluate the effectiveness of calls to action; (4) conduct path analyses to targeted content. The American Academy of Orthopaedic Surgeons (AAOS) uses SurfRay's Behavior Tracking software (Santa Clara CA, USA, and Copenhagen, Denmark) to capture and archive the search terms that have been entered into the site's Google Mini search engine. The AAOS also uses Unica's NetInsight program to analyze its web site log files. These tools provide the AAOS with information that quantifies how well its web sites are operating and insights for making improvements to them. Although it is easy to quantify many aspects of an association's web presence, it also takes human involvement to analyze the results and then recommend changes. Without a dedicated resource to do this, the work often is accomplished only sporadically and on an ad hoc basis.
Quality of online pediatric orthopaedic education materials.
Feghhi, Daniel P; Komlos, Daniel; Agarwal, Nitin; Sabharwal, Sanjeev
2014-12-03
Increased availability of medical information on the Internet empowers patients to look up answers to questions about their medical conditions. However, the quality of medical information available on the Internet is highly variable. Various tools for the assessment of online medical information have been developed and used to assess the quality and accuracy of medical web sites. In this study we used the LIDA tool (Minervation) to assess the quality of pediatric patient information on the AAOS (American Academy of Orthopaedic Surgeons) and POSNA (Pediatric Orthopaedic Society of North America) web sites. The accessibility, usability, and reliability of online medical information in the "Children" section of the AAOS web site and on the POSNA web site were assessed with use of the LIDA tool. Flesch-Kincaid (FK) and Flesch Reading Ease (FRE) values were also calculated to assess the readability of the pediatric education material. Patient education materials on each web site scored in the moderate range in assessments of accessibility, usability, and reliability. FK and FRE values indicated that the readability of each web site remained at a somewhat higher (more difficult) level than the recommended benchmark. The quality and readability of online information for children on the AAOS and POSNA web sites are acceptable but can be improved further. The quality of online pediatric orthopaedic patient education materials may affect communication with patients and their caregivers, and further investigation and modification of quality are needed. Copyright © 2014 by The Journal of Bone and Joint Surgery, Incorporated.
Fabrication of arrays of metal and metal oxide nanotubes by shadow evaporation.
Dickey, Michael D; Weiss, Emily A; Smythe, Elizabeth J; Chiechi, Ryan C; Capasso, Federico; Whitesides, George M
2008-04-01
This paper describes a simple technique for fabricating uniform arrays of metal and metal oxide nanotubes with controlled heights and diameters. The technique involves depositing material onto an anodized aluminum oxide (AAO) membrane template using a collimated electron beam evaporation source. The evaporating material enters the porous openings of the AAO membrane and deposits onto the walls of the pores. The membrane is tilted with respect to the column of evaporating material, so the shadows cast by the openings of the pores onto the inside walls of the pores define the geometry of the tubes. Rotation of the membrane during evaporation ensures uniform deposition inside the pores. After evaporation, dissolution of the AAO in base easily removes the template to yield an array of nanotubes connected by a thin backing of the same metal or metal oxide. The diameter of the pores dictates the diameter of the tubes, and the incident angle of evaporation determines the height of the tubes. Tubes up to approximately 1.5 mum in height and 20-200 nm in diameter were fabricated. This method is adaptable to any material that can be vapor-deposited, including indium-tin oxide (ITO), a conductive, transparent material that is useful for many opto-electronic applications. An array of gold nanotubes produced by this technique served as a substrate for surface-enhanced Raman spectroscopy: the Raman signal (per molecule) from a monolayer of benzenethiolate was a factor of approximately 5 x 10(5) greater than that obtained using bulk liquid benzenethiol.