WorldWideScience

Sample records for aak alan brokaw

  1. Main: 2AAK [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Molecule: Ubiquitin Conjugating Enzyme; Chain: Null; Synonym: Ubc1; Engineered: Yes Ubiquitin Conjugation 6....TPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD arabi_2AAK.jpg ...

  2. Fotonäitus koduta loomade heaks / Indrek Galetin, Kerttu Rakke, Angela Aak ... [jt.

    Index Scriptorium Estoniae

    Galetin, Indrek

    2009-01-01

    Rotermani kvartalis 22.05.2009 avatud Indrek Galetini fotonäitus "Amour - Lemmikloomade eri". Kodutute loomade abistamiseks 20.07.2009 oksjonil müüdavate piltide valmimist kommenteerivad fotograaf ja modellid Kerttu Rakke, Angela Aak ja Max Kaur

  3. Low-Cost alpha Alane for Hydrogen Storage

    Energy Technology Data Exchange (ETDEWEB)

    Fabian, Tibor [Ardica Technologies, San Francisco, CA (United States); Petrie, Mark [SRI International, Menlo Park, CA (United States); Crouch-Baker, Steven [SRI International, Menlo Park, CA (United States); Fong, Henry [SRI International, Menlo Park, CA (United States)

    2017-10-10

    This project was directed towards the further development of the Savannah River National Laboratory (SRNL) lab-scale electrochemical synthesis of the hydrogen storage material alpha-alane and Ardica Technologies-SRI International (SRI) chemical downstream processes that are necessary to meet DoE cost metrics and transition alpha-alane synthesis to an industrial scale. Ardica has demonstrated the use of alpha-alane in a fuel-cell system for the U.S. Army WFC20 20W soldier power system that has successfully passed initial field trials with individual soldiers. While alpha-alane has been clearly identified as a desirable hydrogen storage material, cost-effective means for its production and regeneration on a scale of use applicable to the industry have yet to be established. We focused on three, principal development areas: 1. The construction of a comprehensive engineering techno-economic model to establish the production costs of alpha-alane by both electrochemical and chemical routes at scale. 2. The identification of critical, cost-saving design elements of the electrochemical cell and the quantification of the product yields of the primary electrochemical process. A moving particle-bed reactor design was constructed and operated. 3. The experimental quantification of the product yields of candidate downstream chemical processes necessary to produce alpha-alane to complete the most cost-effective overall manufacturing process. Our techno-economic model shows that under key assumptions most 2015 and 2020 DOE hydrogen storage system cost targets for low and medium power can be achieved using the electrochemical alane synthesis process. To meet the most aggressive 2020 storage system cost target, $1/g, our model indicates that 420 metric tons per year (MT/y) production of alpha-alane is required. Laboratory-scale experimental work demonstrated that the yields of two of the three critical component steps within the overall “electrochemical process” were

  4. Alan Riley : meid ootab tõsine gaasipuudus / Alan Riley ; interv. Krister Paris

    Index Scriptorium Estoniae

    Riley, Alan

    2007-01-01

    Briti majandus- ja õigusekspert doktor Alan Riley seab kahtluse alla Venemaa energiagigandi Gazpromi tugevuse energiaturul ning leiab, et gaasituru liberaliseerimine aitaks võidelda nii potentsiaalse gaasipuuduse kui Euroopa sõltuvusega Venemaa gaasitootjast. Lisa: Riley

  5. Kilpailustrategia käsityöalan case-mikroyritykselle

    OpenAIRE

    Sorri, Reetta

    2010-01-01

    Käsityöalan mikroyritysten nykytilanne on haasteellinen Suomessa. Käsityöyrittäjät joutuvat markkinoilla kovaan kilpailuun teollisten tuotteiden, halpatuonnin, ja suurten tuotantomäärien kanssa. Ongelmaksi on myös muodostunut tuotteiden kopiointi. Usein käsityöalan mikroyrittäjälle yrittäminen on elämäntapa, eikä yrityksellä ole resursseja eikä halua kasvaa. Käsityöalan mikroyritysten tulisi uudistaa toimintamallejaan niin, että ne olisivat kilpailukykyisempiä. Yritysten menestymisen sal...

  6. Powder X-ray diffraction study af alkali alanates

    DEFF Research Database (Denmark)

    Cao, Thao; Mosegaard Arnbjerg, Lene; Jensen, Torben René

    Powder X-ray diffraction study of alkali alanates Thao Cao, Lene Arnbjerg, Torben R. Jensen. Center for Materials Crystallography (CMC), Center for Energy Materials (CEM), iNANO and Department of Chemistry, Aarhus University, DK-8000, Denmark. Abstract: To meet the energy demand in the future...... for mobile applications, new materials with high gravimetric and volumetric storage capacity of hydrogen have to be developed. Alkali alanates are promising for hydrogen storage materials. Sodium alanate stores hydrogen reversibly at moderate conditions when catalysed with, e.g. titanium, whereas potassium...

  7. Kellest saab Alan Greenspani järeltulija? / Tõnis Oja

    Index Scriptorium Estoniae

    Oja, Tõnis, 1957-

    2005-01-01

    USA presidendil ei ole veel uut kandidaati ametist lahkuva keskpanga juhi Alan Greenspani asemele. Vt. samas: Alan Greenspani tegevuse olulisemad verstapostid keskpanga juhina; Pole välistatud ka ametikoha säilitamine

  8. Foreword: R. Alan Plumb—A brief biographical sketch and personal tribute

    Science.gov (United States)

    Sobel, Adam H.

    Raymond Alan Plumb was born on 30 March 1948 in Ripon, Yorkshire, United Kingdom. He is not known for talking about his childhood, but we do know that he liked to sing and was part of a group called the Avocets. Alan did his undergraduate degree in Manchester, obtaining his BS Physics with I Honors in 1969. He was offered a fellowship to do his PhD at Cambridge, but he had a negative reaction to a visit there and decided to stay at Manchester, where he pursued his studies in Astronomy, completing his PhD in 1972. With a highly disengaged thesis advisor, Alan was largely self-taught as a graduate student. He studied planetary atmospheres. Toward the end of his studies, Alan participated in a summer school organized by Steve Thorpe in Bangor,Wales, where he came into contact with the broader international community in geophysical fluid dynamics. Raymond Hide became particularly influential and became Alan's mentor at the UK Meteorological Office (UKMO), where Alan worked for 4 years after receiving his PhD. Another key early influence whom Alan met then was Michael McIntyre. McIntyre's interest and encouragement were very important to Alan at that early time and would continue to be so in later years, including after his move to Australia.

  9. DAF-18/PTEN signals through AAK-1/AMPK to inhibit MPK-1/MAPK in feedback control of germline stem cell proliferation.

    Directory of Open Access Journals (Sweden)

    Patrick Narbonne

    2017-04-01

    Full Text Available Under replete growth conditions, abundant nutrient uptake leads to the systemic activation of insulin/IGF-1 signalling (IIS and the promotion of stem cell growth/proliferation. Activated IIS can stimulate the ERK/MAPK pathway, the activation of which also supports optimal stem cell proliferation in various systems. Stem cell proliferation rates can further be locally refined to meet the resident tissue's need for differentiated progeny. We have recently shown that the accumulation of mature oocytes in the C. elegans germ line, through DAF-18/PTEN, inhibits adult germline stem cell (GSC proliferation, despite high systemic IIS activation. We show here that this feedback occurs through a novel cryptic signalling pathway that requires PAR-4/LKB1, AAK-1/AMPK and PAR-5/14-3-3 to inhibit the activity of MPK-1/MAPK, antagonize IIS, and inhibit both GSC proliferation and the production of additional oocytes. Interestingly, our results imply that DAF-18/PTEN, through PAR-4/LKB1, can activate AAK-1/AMPK in the absence of apparent energy stress. As all components are conserved, similar signalling cascades may regulate stem cell activities in other organisms and be widely implicated in cancer.

  10. The Imitation Game: Alan Turings enigmatiske imitationsspil

    DEFF Research Database (Denmark)

    Bentzen, Martin Mose

    2015-01-01

    Alan Turing revolutionerede computervidenskaben og modtog først verdens anerkendelse længe efter sin død. Nu sætter filmen 'The Imitation Game', der har premiere i Danmark 29. januar 2015, fokus på det oversete geni.......Alan Turing revolutionerede computervidenskaben og modtog først verdens anerkendelse længe efter sin død. Nu sætter filmen 'The Imitation Game', der har premiere i Danmark 29. januar 2015, fokus på det oversete geni....

  11. Preparation of polyaniline/sodium alanate hybrid using a spray-drying process

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, B. R., E-mail: bru-rms@yahoo.com.br, E-mail: fabiopassador@gmail.com, E-mail: pessan@ufscar.br; Passador, F. R., E-mail: bru-rms@yahoo.com.br, E-mail: fabiopassador@gmail.com, E-mail: pessan@ufscar.br; Pessan, L. A., E-mail: bru-rms@yahoo.com.br, E-mail: fabiopassador@gmail.com, E-mail: pessan@ufscar.br [Dep. de Engenharia de Materiais, Federal University of São Carlos (Brazil)

    2014-05-15

    Nowadays, hydrogen is highly interesting as an energy source, in particular in the automotive field. In fact, hydrogen is attractive as a fuel because it prevents air pollution and greenhouse emissions. One of the main problems with the utilization of hydrogen as a fuel is its on-board storage. The purpouse of this work was to develop a new hybrid material consisting of a polyaniline matrix with sodium alanate (NaAlH{sub 4}) using a spray-drying process. The polyaniline used for this experiment was synthesized by following a well-established method for the synthesis of the emeraldine base form of polyaniline using dodecylbenzenesulfonic acid as dopant. Micro particles of polyaniline/sodium alanate hybrids with 30 and 50 wt% of sodium alanate were prepared by using a spray-drying technique. Dilute solutions of polyaniline/sodium alanate were first prepared, 10g of the solid materials were mixed with 350 ml of toluene under stirring at room temperature for 24h and the solutions were dried using spray-dryer (Büchi, Switzerland) with 115°C of an inlet temperature. The hybrids were analyzed by differential scanning calorimetry, FT-IR and scanning electron microscopy (SEM). The addition of sodium alanate decreased the glass transition temperature of the hybrids when compared to neat polyaniline. FT-IR spectrum analysis was performed to identify the bonding environment of the synthesized material and was observed that simply physically mixture occurred between polyaniline and sodium alanate. The SEM images of the hybrids showed the formation of microspheres with sodium alanate dispersed in the polymer matrix.

  12. SubClones (Alan Parsons) visit CERN – and the subatomic world

    CERN Multimedia

    Jordan Juras

    2011-01-01

    While the LHC has been creating subatomic particles, Alan Parsons has re-entered the studio with his new project, SubClones. The three-piece electronic rock group has joined the legendary Alan Parsons Live Project on tour, and their common friend Patrick Geeraert gave them the chance to drop into CERN for a visit.   Alan Parsons during his visit to CERN. The Alan Parsons Live Project is back on tour, with dates scheduled for the end of the summer across Europe and the Americas. A stop at CERN recently complemented a day off between two cities and allowed the band to move from the frontier of the music industry to the frontier of science. “We saw everything there was to see at CERN,” explains Alan Parsons. “It was all fascinating stuff but unfortunately we couldn’t see what was underground, though, so I think we will have to come back.” Parsons’ new project, SubClones, features three members whose identities remain a secret. Althoug...

  13. Characteristics of the Dendrite Growth in the Electrochemical Alane Production Process

    Directory of Open Access Journals (Sweden)

    Park Hyun-Kyu

    2016-01-01

    Full Text Available The electrochemical alane production process was proposed for a feasible production of alane. The operation of process was difficult because of short circuit by a dendrite growth in the reactor. Therefore, characteristics of the dendrite growth in the process were investigated. We conducted the electrochemical alane production process using Teflon block for inhibition of the dendrite growth. The obtained dendrite was characterized by XRD, SEM and ICP-AES. It was concluded that the dendrite growth was attributed to a melting and agglomeration of Al fine particles existed in the solution.

  14. Elokuva-alan digitalisaatio – tallennemyynnin muuttuvat ansainta- ja jakelumallit

    OpenAIRE

    Alanko, Marko

    2017-01-01

    Opinnäytetyön aiheena oli tutkia digitalisaation vaikutusta elokuva-alan ansainta- ja jakelumalleihin. Keskeisimpinä kysymyksinä tässä tutkimuksessa olivat, miten elokuvaliiketoiminnan parissa toimineet ovat kokeneet murroksen vaikutuksen alaan ja sen liiketoimintamalleihin. Tutkimuksen tavoitteena oli selvittää miten käy perinteiselle elokuvatallenteen jakelijalle liiketoiminnan arvoketjussa tulevaisuudessa. Opinnäytetyön keskeisenä ongelmana oli alan työpaikkojen säilyminen tulevaisuudessa....

  15. Editors' overview for the Alan Turner Memorial volume

    Science.gov (United States)

    O'Regan, Hannah J.; Elton, Sarah; Schreve, Danielle

    2014-07-01

    The papers presented here, in this special volume dedicated to the memory of Alan Turner (1947-2012), provide a glimpse of the multi-faceted ways in which the mammalian fossil record can be investigated. The authors of contributions in this Special Issue are by no means an exhaustive list of his international collaborators and colleagues, and indeed, many are not represented here, but the contents cover many of the topics and issues that were of central archaeological and wider Quaternary mammalian interest to Alan. Although the papers are not intended to provide a comprehensive overview of all techniques that can be applied, the set nevertheless reveals a snapshot of the state-of-the-art and of some of the methods that have the potential to bring much more of the past to life. Alan always sought to move beyond the 'stamp-collecting' approach of simply listing which taxa were present at a site, attempting to elucidate what the presence of those animals might mean in terms of palaeoecology. In particular, the span of Alan's career has seen major advances in our understanding of Quaternary mammalian biostratigraphy and palaeobiogeography, the widespread application of novel techniques such as ancient DNA, the development of high-precision geochronology and the discovery of new hominin species. The papers presented here reflect those developments and highlight interdisciplinary approaches, from examination of sediments to careful measurements of the fossils themselves, from modelling the presence of taxa at particular points in the Quaternary to examination of the similarities and differences in fauna within and between sites.

  16. Obituary: Alan D. Fiala (1942-2010)

    Science.gov (United States)

    Kaplan, George

    2011-12-01

    Dr. Alan Dale Fiala, astronomer and expert on solar eclipses, died on May 26, 2010 in Arlington, Virginia, of respiratory failure after a brief illness. He was 67. Fiala had been a staff astronomer at the U.S. Naval Observatory in Washington, D.C., for his entire professional career, where he rose from a position as a summer intern to become the Chief of the Nautical Almanac Office, responsible for annual publications for astronomy and navigation that are used the world over. He retired from the observatory in 2000. Although a childhood case of polio affected his mobility for the rest of his life, he seldom let his physical constraints limit his activities, which were many and varied. Alan Fiala was born in Beatrice, Nebraska on November 9, 1942, the middle son of Emil A. ("John") and Lora Marie Fiala. Fiala's father was a postal clerk and Civil Service examiner. Fiala expressed interest in astronomy at a very young age. He contracted polio when he was 9. He graduated from Beatrice High School in 1960 with a straight-A average and went on to study at Carleton College. He received his B.A. summa cum laude after three years, in 1963, with a major in astronomy and minors in physics and mathematics. He was elected to Phi Beta Kappa, Sigma Xi, and Pi Mu Epsilon (mathematics). In 1962, Alan Fiala obtained a job as a summer intern at the Naval Observatory in Washington, working in the Nautical Almanac Office (NAO). He entered the graduate program at Yale University and continued to work summers at the observatory. He received his Ph.D. in 1968, under Gerald Clemence. His dissertation was titled "Determination of the Mass of Jupiter from a Study of the Motion of 57 Mnemosyne." After receiving his doctorate, Fiala became a permanent member of the Naval Observatory staff. Computers were just being introduced there and he participated in the automation of many procedures used to prepare the annual publications of the Nautical Almanac Office. One of his first assignments was

  17. Book Review: Equal Recognition: The Moral Foundations of Minority Rights, by Alan Patten

    DEFF Research Database (Denmark)

    Lægaard, Sune

    2017-01-01

    Review of Equal Recognition: The Moral Foundations of Minority Rights, by Alan Patten. Princeton: Princeton University Press, 2014.......Review of Equal Recognition: The Moral Foundations of Minority Rights, by Alan Patten. Princeton: Princeton University Press, 2014....

  18. Development of hydrogen storage systems using sodium alanate

    Energy Technology Data Exchange (ETDEWEB)

    Lozano Martinez, Gustavo Adolfo

    2010-12-06

    In this work, hydrogen storage systems based on sodium alanate were studied, modelled and optimised, using both experimental and theoretical approaches. The experimental approach covered investigations of the material from mg scale up to kg scale in demonstration test tanks, while the theoretical approach discussed modelling and simulation of the hydrogen sorption process in a hydride bed. Both approaches demonstrated the strong effect of heat transfer on the sorption behaviour of the hydride bed and led to feasible methods to improve and optimise the volumetric and gravimetric capacities of hydrogen storage systems. The applied approaches aimed at an optimal integration of sodium alanate material in practical hydrogen storage systems. First, it was experimentally shown that the size of the hydride bed influences the hydrogen sorption behaviour of the material. This is explained by the different temperature profiles that are developed inside the hydride bed during the sorptions. In addition, in a self-constructed cell it was possible to follow the hydrogen sorptions and the developed temperature profiles within the bed. Moreover, the effective thermal conductivity of the material was estimated in-situ in this cell, given very good agreement with reported values of ex-situ measurements. It was demonstrated that the effective thermal conductivity of the hydride bed can be enhanced by the addition of expanded graphite. This enhancement promotes lower temperature peaks during the sorptions due to faster heat conduction through the bed, which in addition allows faster heat transfer during sorption. Looking towards simulations and further evaluations, empirical kinetic models for both hydrogen absorption and desorption of doped sodium alanate were developed. Based on the results of the model, the optimal theoretical pressure-temperature conditions for hydrogen sorptions were determined. A new approach is proposed for the mass balance of the reactions when implementing

  19. Interview with Alan Maley on Teaching and Learning Creative Writing

    OpenAIRE

    Ruzbeh Babaee

    2015-01-01

    Alan Maley is a British, award-winning, internationally-known writer and artist, highly regarded for his unique observation of life at the turn of the century. He has been involved in English Language Teaching (ELT) for over 50 years. He worked for the British Council in Yugoslavia, Ghana, Italy, France, China and India and was the Director of the Bell Educational Trust in Cambridge for 5 years. He later worked in universities in Singapore, Thailand, Malaysia and UK. Alan has published over 4...

  20. Alan Turing the enigma

    CERN Document Server

    Hodges, Andrew

    1983-01-01

    It is only a slight exaggeration to say that the British mathematician Alan Turing (1912-1954) saved the Allies from the Nazis, invented the computer and artificial intelligence, and anticipated gay liberation by decades--all before his suicide at age forty-one. This classic biography of the founder of computer science, reissued on the centenary of his birth with a substantial new preface by the author, is the definitive account of an extraordinary mind and life. A gripping story of mathematics, computers, cryptography, and homosexual persecution, Andrew Hodges's acclaimed book captures bot

  1. Ravintola-alan esimiesten käsityksiä eettisestä johtamisesta

    OpenAIRE

    Saloranta, Tea

    2012-01-01

    Opinnäytetyön tarkoituksena oli tutkia, millaisia käsityksiä ravintola-alan esimiehillä on eettisestä johtamisesta alan työntekijöinä, työyhteisön jäseninä, johdettavina ja esimiehinä. Eettisellä johtamisella tarkoitetaan tuloksen tekemistä inhimilliset seikat huomioiden. Tutkimuksen kohderyhmänä oli pääkaupunkiseudun ravintoloiden keskijohto. Keskijohto työskentelee ravintola-alalla ylimmän johdon ja alaisten ristipaineessa. Siksi tässä tutkimuksessa selvitettiin heidän käsityksiään eettises...

  2. Artificial Intelligence, Evolutionary Computing and Metaheuristics In the Footsteps of Alan Turing

    CERN Document Server

    2013-01-01

    Alan Turing pioneered many research areas such as artificial intelligence, computability, heuristics and pattern formation.  Nowadays at the information age, it is hard to imagine how the world would be without computers and the Internet. Without Turing's work, especially the core concept of Turing Machine at the heart of every computer, mobile phone and microchip today, so many things on which we are so dependent would be impossible. 2012 is the Alan Turing year -- a centenary celebration of the life and work of Alan Turing. To celebrate Turing's legacy and follow the footsteps of this brilliant mind, we take this golden opportunity to review the latest developments in areas of artificial intelligence, evolutionary computation and metaheuristics, and all these areas can be traced back to Turing's pioneer work. Topics include Turing test, Turing machine, artificial intelligence, cryptography, software testing, image processing, neural networks, nature-inspired algorithms such as bat algorithm and cuckoo sear...

  3. Catalog of the George Alan Connor Esperanto Collection.

    Science.gov (United States)

    Smith, Karin, Comp.; Haake, Susan, Comp.

    This catalog inventories the collection of books, monographs, serials and periodicals, dictionaries, pamphlets, ephemera, and correspondence concerning Esperanto in the collection of George Alan Connor housed at the University of Oregon Library. Overall, the catalog contains approximately 475 serial entries and 3,000 author entries. Connor was a…

  4. Interview with Alan Maley on Teaching and Learning Creative Writing

    Directory of Open Access Journals (Sweden)

    Ruzbeh Babaee

    2015-07-01

    Full Text Available Alan Maley is a British, award-winning, internationally-known writer and artist, highly regarded for his unique observation of life at the turn of the century. He has been involved in English Language Teaching (ELT for over 50 years. He worked for the British Council in Yugoslavia, Ghana, Italy, France, China and India and was the Director of the Bell Educational Trust in Cambridge for 5 years. He later worked in universities in Singapore, Thailand, Malaysia and UK. Alan has published over 40 books and numerous articles. In the following, Dr. Maley answered our questions on teaching creative writing in academic centers, the relationship between creative writing and language learning, and the status of creative writing in non-English speaking countries.

  5. Multiscale modeling of interaction of alane clusters on Al(111) surfaces : a reactive force field and infrared absorbtion spectroscopy approach

    NARCIS (Netherlands)

    Ojwang, J.G.O.; Chaudhuri, S.; Duin, van A.C.T.; Chabal, Y.J.; Veyan, J.-F.; Santen, van R.A.; Kramer, G.J.; Goddard III, W.A.

    2010-01-01

    We have used reactive force field (ReaxFF) to investigate the mechanism of interaction of alanes on Al(111) surface. Our simulations show that, on the Al(111) surface, alanes oligomerize into larger alanes. In addition, from our simulations, adsorption of atomic hydrogen on Al(111) surface leads to

  6. Critical issues in mathematics education major contributions of Alan Bishop

    CERN Document Server

    Presmeg, Norma C; Presmeg, Norma C

    2008-01-01

    Here are presented the contributions of Professor Alan Bishop within the mathematics education research community. Six critical issues in the development of mathematics education research are reviewed and the current developments in each area are discussed.

  7. Sähköalan oppimateriaalin verkkodokumentointi

    OpenAIRE

    Riikonen, Timitri

    2015-01-01

    Tämän työn tavoitteena oli kehittää Savonia-ammattikorkeakoulun sähköalan opetuksen verkkodokumentointia. Työssä luodaan alusta, jota käytetään kurssin ohella. Alustaan tulisi sisällyttää sekä kurssimateriaali, että kurssin aikana käsiteltyjen asioiden havainnollistava materiaali. Sen tulisi olla helppo sekä käyttää että muokata. Alustaa varten testattiin useita eri sovelluksia. Työssä käytettiin Savonia-ammattikorkeakoululla käytössä olevaa DMS600NE-verkkotietojärjestelmää. Ohjelmaan luo...

  8. Parabolik Kuantum Kuyusundaki Hidrojenik Düzeyler Üzerine Manyetik Alan Etkisi

    Directory of Open Access Journals (Sweden)

    Ünal YEŞİLGÜL

    2015-05-01

    Full Text Available Özet.  Bu çalışmada,   tek parabolik kuantum kuyusunda 1s, 2s ve 2p± düzeylerindeki donor safsızlık atomunun bağlanma enerjisi, etkin kütle yaklaşımında varyasyonel olarak, kuyu genişliği ve dışarıdan uygulanan manyetik alanın bir fonksiyonu olarak hesaplamıştır. Ayrıca, GaAs/Ga1-xAlxAs tek parabolik kuantum kuyusunda hidrojenik düzeyler arasındaki kızılötesi geçişler üzerinde manyetik alanın etkisi incelenmiştir.Anahtar Kelimeler: Parabolik kuantum kuyusu, Safsızlık bağlanma enerjisi, Manyetik alan Abstract. In this study, the binding energy of the donor impurity at 1s, 2s and 2p± states in a   parabolic quantum well is calculated variationally within the effective mass approximation as a function of the quantum well width and the external magnetic field. Furthermore, the effects of the magnetic field on the infrared transitions between the hydrogenic states in a parabolic quantum well under are investigated.Keywords: Parabolic Quantum Well, Impurity Atoms, Magnetic Fields

  9. Professor Alan Turner (1947-2012). Specialist in Miocene-Pleistocene Carnivora, particularly Felidae and Hyaenidae and their palaeoecology

    Science.gov (United States)

    O'Regan, Hannah; Turner, Adam; Antón, Mauricio

    2014-07-01

    Alan first trained as a telecom engineer, working for the GPO (General Post Office) which later became British Telecom. He never forgot this early training and was fascinated by how things worked - always happy to take something apart and fix it (although his attempt to close a large plate glass window with a geological hammer was not one of his successes). Following a few years as an engineer, he went to Sheffield University to study archaeology as a mature student in 1973. At this time Sheffield was a hotbed of prehistory with Graeme Barker, Robin Dennell and many others contributing to a truly research-led degree (with tutorials in the pub (well, it was the 1970s)) (Fig. 1). Alan's interest in bones developed at this time, and having graduated in 1976 he went on to take a PhD, supervised by Robin Dennell, on "Aspects of the palaeoecology of large predators, including man, during the British Upper Pleistocene, with particular emphasis on predator-prey relationships" which resulted in a life-long interest in the Carnivora and particularly hyaenas. Following his PhD, Alan moved to the Environmental Archaeology Unit at York to undertake a Science Research Council project on the morphometrics of domestic cattle and pigs from Coppergate and other major urban excavations in the city. Faced with a lot of measurements and statistics, Alan retained his interest in the animals themselves. The project also confirmed to Alan that prehistory was his metier, rather than the historic periods. Former York colleagues still fondly recall Alan's dry wit, and the day that he successfully put the irritating lab telephone beyond use with no externally visible trace of damage.

  10. Alan Guth and Andrei Linde win international cosmology award

    CERN Multimedia

    2004-01-01

    "Leading theoretical cosmologists Alan Guth, Weisskopf Professor of Physics at the Massachusetts Institute of Technology, and Andrei Linde, Professor of Physics at Stanford University, who played prominent roles in developing and refining the theory of cosmic inflation, have been selected by an international panel of experts to receive the 2004 Cosmology Prize of the Peter Gruber Foundation" (1 page).

  11. The photograph collection of the Alan Paton Centre and Struggle ...

    African Journals Online (AJOL)

    To address the problem of easy access while adhering to archivally correct procedures, the Alan Paton Centre and Struggle Archives has devised a system of arranging and documenting their photograph collection which honours the principle of original order, but also considers the meanings and links between ...

  12. Näkökulmia suomalaisen ravintola-alan tulevaisuuteen

    OpenAIRE

    Paltamaa, Harri

    2017-01-01

    Opinnäytetyön tavoitteena oli saada tietoa tulevaisuuden ravintolatoimintaan kohdistuvista haasteista. Ravintolatoimintaa tarkasteltiin toimintaympäristön, asiakkaiden, palveluntuottajan ja asiakkaiden suhteen, eli asiakkuuden ja ravintola-alan henkilöstön näkökulmasta. Tutkimus toteutettiin kvalitatiivista tutkimusotetta käyttäen Delfoi-menetelmällä. Työn teoreettinen viitekehys rakentui palvelun laadun teoriasta ja tulevaisuudentutkimuksen teoriasta. Tutkimus toteutettiin sähköisesti kak...

  13. Pandivere kõrgustikule tuulepargid sobivad / Alan Senkel, Jaan Tepp ; interv. Raivo Raigna

    Index Scriptorium Estoniae

    Senkel, Alan

    2008-01-01

    Windpower Eesti OÜ juhatuse liige Alan Senkel ja Eesti Tuuleenergia Assotsiatsiooni esimees Jaan Tepp tuuleenergia kasutamisest Eestis. Vt. samas: Raivo Raigna. Kullengale tuulegeneraatorite rajamine kütab kohalike elanike kirgi

  14. Alan Turing and the origins of modern Gaussian elimination

    Directory of Open Access Journals (Sweden)

    Dopico, Froilán M.

    2013-12-01

    Full Text Available The solution of a system of linear equations is by far the most important problem in Applied Mathematics. It is important both in itself and because it is an intermediate step in many other important problems. Gaussian elimination is nowadays the standard method for solving this problem numerically on a computer and it was the first numerical algorithm to be subjected to rounding error analysis. In 1948, Alan Turing published a remarkable paper on this topic: “Rounding-off errors in matrix processes” (Quart. J. Mech. Appl. Math. 1, pp. 287-308. In this paper, Turing formulated Gaussian elimination as the matrix LU factorization and introduced the “condition number of a matrix”, both of them fundamental notions of modern Numerical Analysis. In addition, Turing presented an error analysis of Gaussian elimination for general matrices that deeply influenced the spirit of the definitive analysis developed by James Wilkinson in 1961. Alan Turing’s work on Gaussian elimination appears in a fascinating period for modern Numerical Analysis. Other giants of Mathematics, as John von Neumann, Herman Goldstine, and Harold Hotelling were also working in the mid-1940s on Gaussian elimination. The goal of these researchers was to find an efficient and reliable method for solving systems of linear equations in modern “automatic computers”. At that time, it was not clear at all whether Gaussian elimination was a right choice or not. The purpose of this paper is to revise, at an introductory level, the contributions of Alan Turing and other authors to the error analysis of Gaussian elimination, the historical context of these contributions, and their influence on modern Numerical Analysis.La resolución de sistemas de ecuaciones lineales es sin duda el problema más importante en Matemática Aplicada. Es importante en sí mismo y también porque es un paso intermedio en la resolución de muchos otros problemas de gran relevancia. La eliminaci

  15. 40 Years in Applied Linguistics: An Interview with Alan Davies

    Science.gov (United States)

    Kunnan, Antony John

    2005-01-01

    This article presents an interview with Professor Alan Davies who was born in Wales, studied at Oxford University and Birmingham University, and taught in Scotland at the University of Edinburgh, completing 40 years this year. Professor Davies has travelled widely to give invited talks and seminars, participate in applied linguistics conferences,…

  16. Yatarak fizyoterapi alan hastaların yaşam kaliteleri ve maliyet analizi

    OpenAIRE

    AKTAŞ, İlknur; KAPTANOĞLU YILDIRIM, Ayşegül; ÜNLÜ ÖZKAN, Feyza; YILMAZ KAYSIN, Meryem; ŞİLTE, Ayşe Duygu

    2015-01-01

    Amaç: Lokomotor sistem sorunları nedeniyle yatarak fizyoterapi alan hastaların yaşam kaliteleri ve maliyet analizlerini ortaya koymaktır. Hastalar ve Yöntem: Yatarak fizyoterapi alan olguların demografik verileri kaydedildi ve 15 D yaşam kalite sorgulaması yapıldı. Maliyetleri hesaplandı. Yaşam kalitesi ölçeği verilerini kullanarak hesaplanan, kaliteye ayarlanmış yaşam yılı (KAYY) sayısını kullanarak ekonomik analiz yapılmıştır. Bulgular: Doksan üç olgunun 75’i (%80,64) kadın, 18’i (%19,35) e...

  17. Freedom 7 the historic flight of Alan B. Shepard, Jr.

    CERN Document Server

    Burgess, Colin

    2014-01-01

    Inevitably, there are times in a nation’s history when its hopes, fears and confidence in its own destiny appear to hinge on the fate of a single person. One of these pivotal moments occurred on the early morning of May 5, 1961, when a 37-year-old test pilot squeezed himself into the confines of the tiny Mercury spacecraft that he had named Freedom 7. On that historic day, U.S. Navy Commander Alan Shepard carried with him the hopes, prayers, and anxieties of a nation as his Redstone rocket blasted free of the launch pad at Cape Canaveral, hurling him upwards on a 15-minute suborbital flight that also propelled the United States into the bold new frontier of human space exploration. This book tells the enthralling story of that pioeering flight as recalled by many of the participants in the Freedom 7 story, including Shepard himself, with anecdotal details and tales never before revealed in print. Although beaten into space just three weeks earlier by the Soviet cosmonaut Yuri Gagarin, Alan Shepard’s h...

  18. Alan Alda visits the ATLAS Experiment cavern at CERN

    CERN Multimedia

    Claudia Marcelloni

    2012-01-01

    Alan Alda, is an American actor, director, screenwriter, and author. A six-time Emmy Award and Golden Globe Award winner, he is best known for his role as Hawkeye Pierce in the TV series M*A*S*H. He is currently a Visiting Professor at the State University of New York at Stony Brook School of Journalism and a member of the advisory board of The Center for Communicating Science.[1

  19. Mendoza : Rahvuslike huvide eiramine toob Euroliidule kollapsi / Alan Mendoza ; interv. Indrek Veiserik

    Index Scriptorium Estoniae

    Mendoza, Alan

    2008-01-01

    Intervjuu Henry Jacksoni Ühingu presidendiga, kes vastab küsimustele, mis puudutavad NATO laienemist, Lissaboni lepet, Euroopa Liidu kaitse- ja välispoliitikat, Eesti välispoliitikat ja suhteid Venemaaga. Vt. samas: Alan Mendoza ja Henry Jacksoni ühing

  20. Fraturas expostas: uma análise das pinturas de "Desconstruções," de Alan Fontes

    OpenAIRE

    Costa, Alexandre Rodrigues da

    2015-01-01

    Este artigo se propõe a analisar as pinturas da série Desconstruções, de 2014, do artista mineiro Alan Fontes, a partir dos conceitos de informe e heterogenia de Georges Bataille. Tais conceitos nos permitirão pensar em uma pintura que se detém de maneira crítica sobre a arquitetura, ao tratar a casa como lugar precário, aberto aos acidentes. A casa se constitui, nas pinturas de Alan Fontes, como um espaço de proliferação de sentidos, que se abre, através do dilaceramento, para a desordem, a ...

  1. "Objects and Places” – Photographs by Alan Trachtenberg


    Directory of Open Access Journals (Sweden)

    Géraldine Chouard

    2011-04-01

    Full Text Available  “Black-and-white images of diverse scenes in America—ranging from a Mississippi ���ghost” town to rooftops in Pennsylvania to an upper New York state racetrack—are featured in a new exhibition of photographs by Yale professor Alan Trachtenberg at the Henry Koerner Center for Emeritus Faculty. The exhibit, titled “Objects and Places,” is a selection of 22 photographs that Trachtenberg made over the past 30 years using a large-format (8×10 camera.” [Excerpt from the Yale Daily Bulletin]The foll...

  2. From movement to models: a tribute to professor Alan G. Hannam

    NARCIS (Netherlands)

    Hylander, W.L.; McMillan, A.S.; Lam, E.W.N.; Watanabe, M.; Langenbach, G.E.J.; Stavness, I.; Peck, C.C.; Palla, S.

    2008-01-01

    This tribute article to Professor Alan G. Hannam is based on 7 presentations for him at the July 1, 2008 symposium honoring 3 "giants" in orofacial neuroscience: Professors B.J. Sessle, J.P. Lund, and A.G. Hannam. This tribute to Hannam’s outstanding career draws examples from his 40-year academic

  3. Computational study of pristine and titanium-doped sodium alanates for hydrogen storage applications

    Science.gov (United States)

    Dathar, Gopi Krishna Phani

    The emphasis of this research is to study and elucidate the underlying mechanisms of reversible hydrogen storage in pristine and Ti-doped sodium aluminum hydrides using molecular modeling techniques. An early breakthrough in using complex metal hydrides as hydrogen storage materials is from the research on sodium alanates by Bogdanovic et al., in 1997 reporting reversible hydrogen storage is possible at moderate temperatures and pressures in transition metal doped sodium alanates. Anton reported titanium salts as the best catalysts compared to all other transition metal salts from his further research on transition metal doped sodium alanates. However, a few questions remained unanswered regarding the role of Ti in reversible hydrogen storage of sodium alanates with improved thermodynamics and kinetics of hydrogen desorption. The first question is about the position of transition metal dopants in the sodium aluminum hydride lattice. The position is investigated by identifying the possible sites for titanium dopants in NaAlH4 lattice and studying the structure and dynamics of possible compounds resulting from titanium doping in sodium alanates. The second question is the role of titanium dopants in improved thermodynamics of hydrogen desorption in Ti-doped NaAlH4. Though it is accepted in the literature that formation of TiAl alloys (Ti-Al and TiAl3) is favorable, reaction pathways are not clearly established. Furthermore, the source of aluminum for Ti-Al alloy formation is not clearly understood. The third question in this area is the role of titanium dopants in improved kinetics of hydrogen absorption and desorption in Ti-doped sodium alanates. This study is directed towards addressing the three longstanding questions in this area. Thermodynamic and kinetic pathways for hydrogen desorption in pristine NaAlH4 and formation of Ti-Al alloys in Ti-doped NaAlH 4, are elucidated to understand the underlying mechanisms of hydrogen desorption. Density functional theory

  4. CRM-järjestelmän hyödyt ja haitat: Case ICT-alan yritys

    OpenAIRE

    Äikäs, Kasperi

    2014-01-01

    Tämän tutkimuksellisen opinnäytetyön aiheena on tutkia CRM-järjestelmän hyötyjä ja haittoja ICT- alan pienyrityksessä. Työn tarkoituksena on perehtyä suomalaisen ICT-alan yrityksen käyttämään CRM- eli asiakkuudenhallintajärjestelmään, ja erityisesti tutkia CRM-järjestelmän hyötyjä ja haittoja yrityksen liiketoiminnan toteuttamisen työkaluna. Lisäksi opinnäytetyössä tehdään katselmus kohdeyrityksen CRM-järjestelmään. CRM on liiketoiminnan asiakkuudenhal-linnan tietojärjestelmä. CRM nimitys tul...

  5. Once again about a historiography of the Alans-Ossetians

    Directory of Open Access Journals (Sweden)

    Chibirov

    2016-09-01

    Full Text Available in recent years in the North Caucasus there is a tendency to review the question of ethnogenesis and the past of the Ossetian people. Attempts to falsify history have always existed and the prerequisites for this were very different. Basically it is is stipulated by the current political situation, which requires the corresponding mythological support. Modern falsifiers of history unnecessarily politicize the issue of linguistic and cultural heritage of the Alans while trying to erase more than two centuries of historiography problems.

  6. Manyetik alanın organizma üzerindeki biyolojik etkileri

    OpenAIRE

    Özgüner, Fehmi; Mollaoğlu, Hakan

    2009-01-01

    SüleymanDemirel Üniversitesi TIP FAKÜLTESİ DERGİSİ: 2006 Mart; 13(1) Manyetik alanın organizma üzerindeki biyolojik etkileri M. Fehmi Özgüner, Hakan Mollaoğlu Özet Son yirmi yıldır manyetik dalgaların insan sağlığına zararlı etkilerinin olup olmadığı tartışılmaktadır. Radyofrekans dalgası oluşturan kaynaklar arasında radarlar, mobil telefonlar, radyo ve televizyon yayınları, tıbbi ve endüstriyel uygulamalarda ku...

  7. Luomu- ja lähiruoka opintojakso hotelli- ja ravintola- alan ammattioppilaitoksiin

    OpenAIRE

    Nurminen, Jessica

    2007-01-01

    Tämä toimintaympäristön kehittämisen opintokokonaisuuteen kuuluva kehittämishanke on tehty Jyväskylän ammattikorkeakoulun opettajakoulussa talvella 2006- 2007. Kehittämishankkeessa olen suunnitellut uuden opintojakson ammatillisiin hotelli- ja ravintola- alan oppilaitoksiin. Kehittämishankkeeni tavoitteena on luoda oppilaitoksiin uusi opintojakso, joka avartaa opiskelijoiden näkemystä ja tietoa luomu- ja lähiruoasta. Kehittämishankkeessani olen suunnitellut 10 opintoviikon mittaisen vapaasti ...

  8. A Semiotic Analysis of Visual Elements Particular to the Medium of Comics in Alan Ford by Max Bunker and Magnus

    Directory of Open Access Journals (Sweden)

    Hrvoje Gržina

    2014-12-01

    Full Text Available This paper presents the results of a semiotic analysis of visual elements characteristic for the medium of comic books applied to the first seventy-five issues of the Croatian edition of Alan Ford. After a description of the cultural and historical framework, it analyzes individual signs in comics and different elements specific for expression in comic books in Western culture with the aim of exploring which of these signs are present in Alan Ford, and to what extent. The results show that the analyzed comic book is deeply rooted in the visual and literary Western tradition, and that it contains virtually all the characteristic elements of representation in comic books. However, the paper also concludes that certain iconic elements of the vocabulary of comics – i.e. onomatopoeic neologisms – are to a certain extent specific and typical only for Alan Ford.

  9. Työtyytyväisyys media-alan yrityksessä

    OpenAIRE

    Tolonen, Johanna; Niittyjoki, Noora

    2014-01-01

    Henkilöstön työtyytyväisyydellä on suuri vaikutus yrityksen menestymiseen ja kilpailukykyyn. Työtyytyväisyyttä pitäisi tutkia säännöllisesti, koska se ylläpitää ja edistää työntekijöiden terveyttä, hyvinvointia, motivoituneisuutta ja innovatiivisuutta. Opinnäytetyön tavoitteena oli selvittää kansainvälisen media-alan yrityksen työntekijöiden yleistä työtyytyväisyyden tilaa. Tutkimusongelmaa pyrittiin selvittämään empiirisen tutkimuksen avulla ja saamaan vastauksia kysymykseen, millä työt...

  10. Susan And Lucy: Two Outstanding Heroines Of Alan Ayckbourn / Susan ve Lucy: Alan Ayckbourn’un İki Sıradışı Kadın-Kahramanı

    OpenAIRE

    Parlak, Erdinç

    2012-01-01

    Alan Ayckbourn (1939-     ) has an important place among the twentieth century British playwrights. The playwright handles some present-day social problems such as insensitiveness, lack of communication, lack of love, collision, alienation, moral degeneration especially around his heroines. Susan, the protagonist of Woman in Mind, and Lucy, the little heroine in Invisible Friends, are among the outstanding heroines of the playwright. The life experiences of Susan and Lucy reflected from the s...

  11. On the record: Benefits of a progressive consumption tax: a conversation with Alan D. Viard

    OpenAIRE

    anonymous

    2012-01-01

    Alan D. Viard, a resident scholar at the American Enterprise Institute, reviews the budget outlook, the need for tax reform and the benefits of moving to a progressive consumption tax. He also discusses his forthcoming book, Progressive Consumption Taxation: The X Tax Revisited, which he coauthored with Robert Carroll of Ernst & Young.

  12. Yazma Eğitimi Alanında Yapılan Akademik Çalışmaların Eğilimleri (2010 - 2014 Yılları

    Directory of Open Access Journals (Sweden)

    Mehmet TOK

    2015-10-01

    Full Text Available Yazma becerisinin birçok bilişsel işlemleri içerisinde barındırması, süreç içermesi, öğrencinin psikolojik durumu, motivasyon ve tutumu, öğretmenlerin yazma alanındaki konumu vb. unsurlar yazma alanında birçok sorunun yaşanmasını beraberinde getirmektedir. Bu nedenle, alan yazında yer alan birçok çalışmada, yazma sorunları doğrudan ele alınmış ya da sıkça bu sorunlara değinilmiştir. Yazma alanındaki sorunların çok olması, alanda yapılan çalışmaların önemini bir kat daha arttırmıştır. Bu çalışmada, yazma eğitimi konusunda 2010-2014 yılları arasında yapılan 126 yüksek lisans, 38 doktora tezinin yanı sıra düzenli bir şekilde yayınlanan 16 ulusal ve uluslararası bilimsel dergide yer alan 127 makale taranmıştır. Ele alınan akademik çalışmalar; hedef kitle, ilişkili olduğu alan, kullanılan yöntem ve yazma eğitimindeki eğilimleri bakımından değerlendirilmiştir. Araştırmada meta-analiz yöntemi kullanılmıştır. Yapılan araştırmalarda hedef kitle bakımından en fazla ortaokul öğrencilerinin seçildiği, yazmanın daha çok okuma ve ilk okuma ile ilişkilendirilerek ele alındığı, yöntem olarak nicel araştırmaların (f=152 nitel araştırmalardan (f=114 daha çok tercih edildiği görülmüştür. En çok kullanılan yöntem tarama modeli olurken doktora tezlerinde deneysel çalışmalar ön plana çıkmıştır. Yazma araştırmaları incelendiğinde araştırmacı eğilimlerinin, yazma yöntemleri ve farklı türlerde metin yazmaya yönelik olduğu görülmüştür.

  13. Työaikaergonomia eräässä hoiva-alan yrityksessä

    OpenAIRE

    Airaksinen, Riikka

    2012-01-01

    Vuorotyön haitallisista vaikutuksista ihmisen terveyteen ja hyvinvointiin on laajaa tutkimusnäyttöä, mutta terveydenhuoltoalalla epäsäännöllinen vuorotyö on edelleen erittäin yleistä. Vuorotyön haitallisia vaikutuksia on mahdollista vähentää huomioimalla työaikaergonomia työvuorosuunnittelussa. Tämän tapaustutkimuksen tarkoituksena oli kartoittaa erään hoiva-alan yrityksen hoitohenkilöstön työaikaergonomiaa, siihen vaikuttavia tekijöitä sekä hoitohenkilöstön mielipiteitä työaikaergonomias...

  14. Alan Saville (31 December 1946 – 19 June 2016: One of Britain’s finest lithics specialists

    Directory of Open Access Journals (Sweden)

    Torben Bjarke Ballin

    2016-07-01

    Full Text Available Alan Saville had a long and distinguished career in British archaeology, and following his education and early archaeological background in England, he has latterly been associated mainly with Scottish archaeology, where he held the post of Senior Curator at the Department of Scottish Archaeology and History, National Museums Scotland, Edinburgh.

  15. The iconic image in a digital age: Editorial mediations over the Alan Kurdi photographs

    DEFF Research Database (Denmark)

    Mortensen, Mette; Allan, Stuart; Peters, Chris

    2017-01-01

    This article investigates selected newspapers’ editorial mediations over contrasting perceptions regarding the significance of a controversial set of “iconic” news photographs, namely images of Alan Kurdi, a three-year-old Syrian refugee, whose drowned corpse washed ashore in September, 2015. Spe......-reflexivity within a convergent digital media ecology, this article offers original insights into how and why the epistemic values governing visual communication are being reconsidered and redrawn under pressure from institutional imperatives....

  16. Function of RSKS-1-AAK-2-DAF-16 signaling cascade in enhancing toxicity of multi-walled carbon nanotubes can be suppressed by mir-259 activation in Caenorhabditis elegans

    Science.gov (United States)

    Zhuang, Ziheng; Li, Min; Liu, Hui; Luo, Libo; Gu, Weidong; Wu, Qiuli; Wang, Dayong

    2016-08-01

    Caenorhabditis elegans is an important non-mammalian alternative assay model for toxicological study. Previous study has indicated that exposure to multi-walled carbon nanotubes (MWCNTs) dysregulated the transcriptional expression of mir-259. In this study, we examined the molecular basis for mir-259 in regulating MWCNTs toxicity in nematodes. Mutation of mir-259 induced a susceptible property to MWCNTs toxicity, and MWCNTs exposure induced a significant increase in mir-259::GFP in pharyngeal/intestinal valve and reproductive tract, implying that mir-259 might mediate a protection mechanisms for nematodes against MWCNTs toxicity. RSKS-1, a putative ribosomal protein S6 kinase, acted as the target for mir-259 in regulating MWCNTs toxicity, and mutation of rsks-1 suppressed the susceptible property of mir-259 mutant to MWCNTs toxicity. Moreover, mir-259 functioned in pharynx-intestinal valve and RSKS-1 functioned in pharynx to regulate MWCNTs toxicity. Furthermore, RSKS-1 regulated MWCNTs toxicity by suppressing the function of AAK-2-DAF-16 signaling cascade. Our results will strengthen our understanding the microRNAs mediated protection mechanisms for animals against the toxicity from certain nanomaterials.

  17. Influence of the dopant during the one step mechano-chemical synthesis of sodium alanate

    International Nuclear Information System (INIS)

    Rongeat, C; Geipel, C; Llamas-Jansa, I; Schultz, L; Gutfleisch, O

    2009-01-01

    High-pressure reactive milling under hydrogen atmosphere is used for the one-step synthesis of doped sodium alanate. In-situ monitoring of the pressure and the temperature inside the vial gives a direct feedback about the reactions occurring during the milling. This information is used to study the influence of the dopant during synthesis, e.g. the amount of dopant added. The study of the pressure variations during milling is a reliable tool for screening the efficiency of different dopants.

  18. KONTROLÖR ALAN AĞI ESASLI BİR ATM ALAN TAŞITININ TASARLANMASI

    Directory of Open Access Journals (Sweden)

    Mahmut TENRUH

    2006-03-01

    Full Text Available Kontrolör Alan Ağı (KAA taşıtı başlangıçta otomotiv uygulamaları için önerilmiş fakat düşük maliyeti yüksek hızı ve güvenilirliği sayesinde endüstriyel dağılımlı gerçek zamanlı kontrol uygulamalarında da bir standart haline gelmiştir. ATM veri, ses ve görüntü gibi tüm haberleşme türlerini bir network yapısı içerisinde birleştirmeyi hedefleyen hızlı bir ağ teknolojisidir. Ethernet ve Token Ring gibi mevcut ağ türlerinin ATM ile bağlanması için çeşitli çalışmalar sürdürülmüştür. Kontrol Taşıtı haberleşmesinin de bu çerçevede ele alınması önem taşımaktadır. Bu çalışma ATM teknolojisinin Kontrol Taşıtı haberleşmesi ile birlikte kullanılmasını amaçlamaktadır. Bu kapsamda KAA esaslı ATM Taşıt yapısı sunulmaktadır. Bu yapı aynı zamanda Kontrol Taşıt ağlarının ATM ağları ile doğrudan bağlanabilmesi için de bir imkan sunmaktadır. Önerilen modelin geçerliliğini görmek amacıyla simülasyon çalışmaları yürütülmüş ve sonuçlar sistemin ek avantajlarla uygulanabilir olduğunu göstermiştir.

  19. Alan Paton’s unpublished fiction (1922- 1934: an initial appraisal

    Directory of Open Access Journals (Sweden)

    D. Levey

    2007-07-01

    Full Text Available This article considers selected issues in the early fiction of Alan Paton, which is in manuscript form: three novels or parts of novels namely, “Ship of Truth” (1922-1923, “Brother Death” (1930, “John Henry Dane” (1934b, the novel/novella “Secret for seven” (1934d, and the short stories “Little Barbee”, (1928? and “Calvin Doone” (1930a. Attention is given to the first novel. A summary of the findings follows: even though Paton’s longer unpublished fiction is religiously earnest and at times rhetorically effective, it is simplistic and tends to perpetuate the white, English-speaking patriarchal hegemony of Natal, rather than offer any sustained critique of it. These works are set against the background of the Natal Midlands in the 1920s and 1930s. The shorter fiction is slightly different in nature.

  20. Robots testing robots: ALAN-Arm, a humanoid arm for the testing of robotic rehabilitation systems.

    Science.gov (United States)

    Brookes, Jack; Kuznecovs, Maksims; Kanakis, Menelaos; Grigals, Arturs; Narvidas, Mazvydas; Gallagher, Justin; Levesley, Martin

    2017-07-01

    Robotics is increasing in popularity as a method of providing rich, personalized and cost-effective physiotherapy to individuals with some degree of upper limb paralysis, such as those who have suffered a stroke. These robotic rehabilitation systems are often high powered, and exoskeletal systems can attach to the person in a restrictive manner. Therefore, ensuring the mechanical safety of these devices before they come in contact with individuals is a priority. Additionally, rehabilitation systems may use novel sensor systems to measure current arm position. Used to capture and assess patient movements, these first need to be verified for accuracy by an external system. We present the ALAN-Arm, a humanoid robotic arm designed to be used for both accuracy benchmarking and safety testing of robotic rehabilitation systems. The system can be attached to a rehabilitation device and then replay generated or human movement trajectories, as well as autonomously play rehabilitation games or activities. Tests of the ALAN-Arm indicated it could recreate the path of a generated slow movement path with a maximum error of 14.2mm (mean = 5.8mm) and perform cyclic movements up to 0.6Hz with low gain (<1.5dB). Replaying human data trajectories showed the ability to largely preserve human movement characteristics with slightly higher path length and lower normalised jerk.

  1. The U.S. Navy in Operation Overlord Under the Command of Rear Admiral Alan G. Kirk

    Science.gov (United States)

    1994-05-19

    assault on the beaches. 14. SUBJECT TERMS 15. NUMBER OF PAGES Operation Overlord, COSSAC, Admiral Alan G. Kirk, U.S. Navy 16. PRICE CODE 17. SECUriLY ...Allies’ smal2 but growing forces. 5 Although reluctant to confront the German Army in France, Brooke admitted that reasons existed to take the Qamble; the...After Kirk took command of TF122, the pace of American landing craft and personnel arrival into Britain rapidly increased. Kirk told Stark that the

  2. Alan Turing's Automatic Computing Engine The Master Codebreaker's Struggle to build the Modern Computer

    CERN Document Server

    Copeland, B Jack

    2005-01-01

    The mathematical genius Alan Turing (1912-1954) was one of the greatest scientists and thinkers of the 20th century. Now well known for his crucial wartime role in breaking the ENIGMA code, he was the first to conceive of the fundamental principle of the modern computer-the idea of controlling a computing machine's operations by means of a program of coded instructions, stored in the machine's 'memory'. In 1945 Turing drew up his revolutionary design for an electronic computingmachine-his Automatic Computing Engine ('ACE'). A pilot model of the ACE ran its first program in 1950 and the product

  3. Equus: a construção do personagem Alan Strang na tradução cinematográfica.

    Directory of Open Access Journals (Sweden)

    Lucyana do Amaral Brilhante

    2005-01-01

    Full Text Available Peter Shaffer is a British playwright of the second half of the twentieth century. One of his major works is the play Equus, that tells the story of a young man, Alan Strang, who is in psychiatric treatment. The film director Sidney Lumet, with the script of Shaffer, translated the play to the screen. Based on the concept of intersemiotic translation of Jackobson (1995, it may be said that a film adaptation is, in fact, an intersemiotic translation, which in turn is a kind of audiovisual translation. It is then natural that, in the translation of a play to the screen, the original changes because the translations become different texts, normally unattached to the original work. This work’s objective is to analyze the differences between the play and the film. This paper aims at looking at differences between the screenplay and the film, paying special attention to those that affect the character Alan Strang. So, the corpus of the research consists of the film and the play by Schaffer. The analysis of the character was based on translation and literary theories. Keywords: Audiovisual translation, intersemiotic translation, literature and cinema.

  4. TARİH ÖĞRETMENİ ÖZEL ALAN YETERLİKLERİNİN HAZIRLANMASI

    Directory of Open Access Journals (Sweden)

    Ümmügülsüm CANDEĞER

    2014-12-01

    Full Text Available Tarih Öğretmeni Özel Alan Yeterliklerinin hazırlanma süreci, veri toplama yöntem ve analizleri, karşılaşılan sorunlar ve çözümlerinin anlatılması ve hazırlanan yeterliklerin kısa bir açıklamasının yapılması bu çalışmanın konusudur. Adı geçen yeterlikler Millî Eğitim Bakanlığı (MEB, Öğretmen Yetiştirme ve Geliştirme Genel Müdürlüğü (ÖYGGM tarafından oluşturulan bir komisyon tarafından yapılmıştır.Komisyon çalıştığı sürece gelen bütün yorum ve fikirlere açık olmuş hatta konuyla ilgili kişilere bizzat düşünceleri anketler ve görüşmeler vasıtasıyla sorulmuştur. Yeterlik taslağımız iki kez anket haline getirilip sorgulanmıştır. Anketlerimiz birinci de 357 kişi, ikincide ise 85 kişiye ulaştırılmıştır. Sonuç olarak ilk anketimizde 155 kişiden geri bildirim alınmış. 2. Anketimiz ise 85 kişinin ortak çalışması ile rapor haline getirilmiştir. Tarih Öğretmeni Özel Alan Yeterliklerinin taslağı son aşamada yine ÖYGGM tarafından 166 kurum ve kuruluşa gönderilerek paydaş görüşleri istenmiş ve bu kurum ve kuruluşların 127’sinden geri bildirim alınabilmiştir.Tarih Öğretmeni Özel Alan Yeterlikleri Millî Eğitim Bakanlığı’na bağlı okullarda çalışan toplam 15700 tarih öğretmenini ve yükseköğretim kurumlarının öğretmen yetiştiren programlarındaki öğrenci ve akademisyenleri ilgilendirmektedir. Eğitim hizmetinden yararlanan öğrencileri ve velilerini de hesaplarsak oldukça geniş bir kitleyi ilgilendiren bir konudur. Konuyla ilgili olarak farkındalık oluşturulması önemlidir. Ayrıca öğretmen seçimleri yapılan KPSS sınav sisteminde de tarih öğretmeni seçiminde hazırlanan bu yeterliklerin esas alınması gereklidir. Bunun yanı sıra Kariyer Basamaklarını belirleyecek sınavların yapılması durumunda da Tarih Öğretmeni Özel Alan Yeterlikleri kriter olarak göz önünde bulundurulmal

  5. Moral absolutism and abortion: Alan Donagan on the hysterectomy and craniotomy cases.

    Science.gov (United States)

    Reynolds, Terrence

    1985-07-01

    Reynolds argues that the nonconsequentialist moral theory proposed by Alan Donagan in his book The Theory of Morality (University of Chicago Press; 1977) does not resolve the cases in which craniotomy or removal of a cancerous uterus appears necessary to save the life of a pregnant woman. Donagan's absolute prohibition against the murder of the innocent and his rejection of the principle of double effect have led him to view the fetus as a pursuer or assailant or to assert the theory of proleptic agreement--that in risk taking ventures the parties may agree that killing one person to save the lives of the others will be accepted. Reynolds holds these arguments to be inapplicable in therapeutic abortions involving craniotomy or hysterectomy and concludes that Donagan's absolutist theory must be reexamined.

  6. Multiple Myeloma Research Foundation

    Science.gov (United States)

    ... MMRF Founder Kathy Giusti named 1 of 100 Visionaries of our time by the Einstein Foundation Learn More September 8, 2017 Tom Brokaw gives inspiring speech at MMRF Leadership Circle Summit on how his life was changed, ...

  7. Loss of a neural AMP-activated kinase mimics the effects of elevated serotonin on fat, movement, and hormonal secretions.

    Directory of Open Access Journals (Sweden)

    Katherine A Cunningham

    2014-06-01

    Full Text Available AMP-activated protein kinase (AMPK is an evolutionarily conserved master regulator of metabolism and a therapeutic target in type 2 diabetes. As an energy sensor, AMPK activity is responsive to both metabolic inputs, for instance the ratio of AMP to ATP, and numerous hormonal cues. As in mammals, each of two genes, aak-1 and aak-2, encode for the catalytic subunit of AMPK in C. elegans. Here we show that in C. elegans loss of aak-2 mimics the effects of elevated serotonin signaling on fat reduction, slowed movement, and promoting exit from dauer arrest. Reconstitution of aak-2 in only the nervous system restored wild type fat levels and movement rate to aak-2 mutants and reconstitution in only the ASI neurons was sufficient to significantly restore dauer maintenance to the mutant animals. As in elevated serotonin signaling, inactivation of AAK-2 in the ASI neurons caused enhanced secretion of dense core vesicles from these neurons. The ASI neurons are the site of production of the DAF-7 TGF-β ligand and the DAF-28 insulin, both of which are secreted by dense core vesicles and play critical roles in whether animals stay in dauer or undergo reproductive development. These findings show that elevated levels of serotonin promote enhanced secretions of systemic regulators of pro-growth and differentiation pathways through inactivation of AAK-2. As such, AMPK is not only a recipient of hormonal signals but can also be an upstream regulator. Our data suggest that some of the physiological phenotypes previously attributed to peripheral AAK-2 activity on metabolic targets may instead be due to the role of this kinase in neural serotonin signaling.

  8. Türkiye’de Franchising Sisteminin Gelişimi ve Franchise Alan Girişimcilerin İş Memnuniyeti Belirleyicilerinin Analizi Üzerine Bir Araştırma

    OpenAIRE

    Nart, Sima

    2005-01-01

    Bu çalışmada, Türkiye’de Franchising sisteminin gelişimi ve bugünkü konumu incelendikten sonra Ulusal Franchising Derneği (UFRAD) üyesi Franchise-veren firmalardan Franchise-alan girişimcilerin iş memnuniyetlerini belirleyen etkenler üzerine bir anket çalışması yapılmıştır. Bulgular, franchise-alan işletmelerin memnuniyetlerinde sistem motivasyonu, işbirliği, güç dengesi, beklentiler ve franchise veren firmanın imajının belirleyici rol oynadığını göstermektedir. Araştırma sonuçları franchisev...

  9. Ravintola-alan franchising-yrittäjyys Suomessa yrittäjän näkökulmasta

    OpenAIRE

    Mäki-Arvela, Aki

    2012-01-01

    Tämän opinnäytetyön tarkoitus on tutkia millaista ravintola-alan franchising- yrittäjyys on tänä päivänä Suomessa yrittäjän näkökulmasta. Tavoitteena on saada käsitys yrittäjyydestä ja tutustua siihen millaista on franchising-yrittäjyys Suomessa. Tutkimus toteutetaan kvalitatiivisena tutkimuksena haastattelemalla eri franchising-ketjujen yrittäjiä Etelä-Suomessa. Työn toimeksiantajana toimii HAAGA-HELIA Ammattikorkeakoulu. Franchising on yleistyvä liiketoiminnan muoto, jossa franchising-...

  10. The Society of Brains: How Alan Turing and Marvin Minsky Were Both Right

    Science.gov (United States)

    Struzik, Zbigniew R.

    2015-04-01

    In his well-known prediction, Alan Turing stated that computer intelligence would surpass human intelligence by the year 2000. Although the Turing Test, as it became known, was devised to be played by one human against one computer, this is not a fair setup. Every human is a part of a social network, and a fairer comparison would be a contest between one human at the console and a network of computers behind the console. Around the year 2000, the number of web pages on the WWW overtook the number of neurons in the human brain. But these websites would be of little use without the ability to search for knowledge. By the year 2000 Google Inc. had become the search engine of choice, and the WWW became an intelligent entity. This was not without good reason. The basis for the search engine was the analysis of the ’network of knowledge’. The PageRank algorithm, linking information on the web according to the hierarchy of ‘link popularity’, continues to provide the basis for all of Google's web search tools. While PageRank was developed by Larry Page and Sergey Brin in 1996 as part of a research project about a new kind of search engine, PageRank is in its essence the key to representing and using static knowledge in an emergent intelligent system. Here I argue that Alan Turing was right, as hybrid human-computer internet machines have already surpassed our individual intelligence - this was done around the year 2000 by the Internet - the socially-minded, human-computer hybrid Homo computabilis-socialis. Ironically, the Internet's intelligence also emerged to a large extent from ‘exploiting’ humans - the key to the emergence of machine intelligence has been discussed by Marvin Minsky in his work on the foundations of intelligence through interacting agents’ knowledge. As a consequence, a decade and a half decade into the 21st century, we appear to be much better equipped to tackle the problem of the social origins of humanity - in particular thanks to the

  11. Reaction paths of alane dissociation on the Si(0 0 1) surface

    Science.gov (United States)

    Smith, Richard; Bowler, David R.

    2018-03-01

    Building on our earlier study, we examine the kinetic barriers to decomposition of alane, AlH3, on the Si(0 0 1) surface, using the nudged elastic band approach within density functional theory. We find that the initial decomposition to AlH with two H atoms on the surface proceeds without a significant barrier. There are several pathways available to lose the final hydrogen, though these present barriers of up to 1 eV. Incorporation is more challenging, with the initial structures less stable in several cases than the starting structures, just as was found for phosphorus. We identify a stable route for Al incorporation following selective surface hydrogen desorption (e.g. by scanning tunneling microscope tip). The overall process parallels PH3, and indicates that atomically precise acceptor doping should be possible.

  12. Dopady dočasných změn valorizace důchodů

    Czech Academy of Sciences Publication Activity Database

    Janský, Petr

    -, č. 3 (2014), s. 67-78 ISSN 1212-415X Institutional support: RVO:67985998 Keywords : pension indexation * impact evaluation * Czech Republic Subject RIV: AH - Economics http://www.slu.cz/opf/cz/informace/acta-academica-karviniensia/casopisy-aak/aak-rocnik-2014/docs-3-2014/Jansky.pdf

  13. NCBI nr-aa BLAST: CBRC-MMUS-02-0385 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-02-0385 gb|AAK56078.1|AF332049_1 adrenergic receptor alpha 2B [Mus muscul...us] gb|AAA37131.1| alpha-2 adrenergic receptor gb|EDL28187.1| adrenergic receptor, alpha 2b [Mus musculus] AAK56078.1 0.0 99% ...

  14. NCBI nr-aa BLAST: CBRC-OLAT-12-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-12-0001 gb|AAK56078.1|AF332049_1 adrenergic receptor alpha 2B [Mus muscul...us] gb|AAA37131.1| alpha-2 adrenergic receptor gb|EDL28187.1| adrenergic receptor, alpha 2b [Mus musculus] AAK56078.1 1e-102 49% ...

  15. Coğrafya Öğretmenlerinin Teknolojik Pedagojik Alan Bilgisi İle İlgili Yeterliliklerinin İncelenmesi / Examining the Skills of Geography Teachers’ Technological Pedagogical Content Knowledge

    Directory of Open Access Journals (Sweden)

    Esengül Doğru

    2017-04-01

    Full Text Available Abstract The main purpose of this research was to determine the competencies of technological pedagogical content knowledge (TPCK of geography teachers and to examine whether these competencies differed significantly according to various variables. The study included a total of a total of 42 geography teachers employed in Karabuk city centre and its districts in 20015-2015 education year. The data of the study was gathered though Technological Pedagogical Content Knowledge (TPCK developed by Pamuk, Ergun, Çakır, Yılmaz ve Ayas (2012. Frequency and percentage values along with Kolmogorov-Smirnov (K-S test, Mann Whitney U test and Kruskal Wallis H test were used to analyse the data of the current study. The results of the study revealed that the technological pedagogical content knowledge of geography teachers was not enough. Results also demonstrated the level of geography teachers’ technological pedagogical content knowledge did not differ significantly according to their skills and knowledge at using technology, seniority, education level and gender. Content Knowledge is one of the subscales of TPCK that geography teachers had the highest level of knowledge. Furthermore, the level of technological content knowledge of geography teachers was higher than that of technological pedagogical knowledge. The results of the study were discussed in line with the related literature and some suggestions were made.  Öz Bu araştırmanın temel amacı, Coğrafya öğretmenlerinin Teknolojik Pedagojik Alan Bilgisi (TPAB yeterliliklerinin tespit edilmesi ve bu yeterliliklerin çeşitli değişkenlere göre farklılık gösterip göstermediğinin incelenmesidir. Çalışmaya, 2015-2016 eğitim öğretim yılında Karabük il merkezi ve ilçelerinde görev yapmakta olan toplam 42 Coğrafya öğretmeni katılmıştır. Veri toplama aracı olarak, araştırmanın nicel kısmı için ölçme aracı olarak Pamuk, Ergun, Çakır, Yılmaz ve Ayas (2012 taraf

  16. How Alan Hirsig plans to play Arco chemical's strong hand

    International Nuclear Information System (INIS)

    Hunter, D.

    1993-01-01

    With 1992 net income up 4%, to $195 million. Arco Chemical (Newtown Square, PA) held its own in a year when many of its petrochemical industry peers were mauled again. Arco Chemical president and CEO Alan R. Hirsig talked recently with CW about his growth strategies for the company, and about progress with his Manufacturing Excellence initiative, lauched in the wake of the 1990 Channelview, TX tragedy. Riding on faster growth in the Asia region, Hirsig expects to see Arco's regional sales mix shift in the next three years and sales to grow from 1992's $3.1 billion to $4 billion/year. The foundation for that growth continues to be Arco's core proprietary technology competence for making propylene oxide (PO) with coproduction and tert-butyl alcohol (TBA) - the key methyl tert-butyl ether (MTBE) feedstock, or styrene monomer. Arco claims a 28% share of world MTBE capacity, its 78,500-bbl/day capacity. He cites Jakarta, Bangkok, Mexico City, Milan, Turin, and Athens as examples of major cities where MTBE use in reformulated fuels is getting interest. Given what he views as Europe's traditional 10-year lag on the US in areas like catalytic mufflers and unleaded gasoline, he sees significant prospects in reformulated gasoline in that region in the coming years. Arco is also testing a proprietary TBA-based hydroperoxide in diesel fuels, which improves the cetane number and cleans up exhaust emissions, winning great interest in Tokyo. Also in the fuels area, Hirsig notes interest in ethyl tert-butyl ether production - which Arco launched in the US in December on a commercial scale - in France

  17. Insight on an arginine synthesis metabolon from the tetrameric structure of yeast acetylglutamate kinase.

    Science.gov (United States)

    de Cima, Sergio; Gil-Ortiz, Fernando; Crabeel, Marjolaine; Fita, Ignacio; Rubio, Vicente

    2012-01-01

    N-acetyl-L-glutamate kinase (NAGK) catalyzes the second, generally controlling, step of arginine biosynthesis. In yeasts, NAGK exists either alone or forming a metabolon with N-acetyl-L-glutamate synthase (NAGS), which catalyzes the first step and exists only within the metabolon. Yeast NAGK (yNAGK) has, in addition to the amino acid kinase (AAK) domain found in other NAGKs, a ~150-residue C-terminal domain of unclear significance belonging to the DUF619 domain family. We deleted this domain, proving that it stabilizes yNAGK, slows catalysis and modulates feed-back inhibition by arginine. We determined the crystal structures of both the DUF619 domain-lacking yNAGK, ligand-free as well as complexed with acetylglutamate or acetylglutamate and arginine, and of complete mature yNAGK. While all other known arginine-inhibitable NAGKs are doughnut-like hexameric trimers of dimers of AAK domains, yNAGK has as central structure a flat tetramer formed by two dimers of AAK domains. These dimers differ from canonical AAK dimers in the -110° rotation of one subunit with respect to the other. In the hexameric enzymes, an N-terminal extension, found in all arginine-inhibitable NAGKs, forms a protruding helix that interlaces the dimers. In yNAGK, however, it conforms a two-helix platform that mediates interdimeric interactions. Arginine appears to freeze an open inactive AAK domain conformation. In the complete yNAGK structure, two pairs of DUF619 domains flank the AAK domain tetramer, providing a mechanism for the DUF619 domain modulatory functions. The DUF619 domain exhibits the histone acetyltransferase fold, resembling the catalytic domain of bacterial NAGS. However, the putative acetyl CoA site is blocked, explaining the lack of NAGS activity of yNAGK. We conclude that the tetrameric architecture is an adaptation to metabolon formation and propose an organization for this metabolon, suggesting that yNAGK may be a good model also for yeast and human NAGSs.

  18. Insight on an arginine synthesis metabolon from the tetrameric structure of yeast acetylglutamate kinase.

    Directory of Open Access Journals (Sweden)

    Sergio de Cima

    Full Text Available N-acetyl-L-glutamate kinase (NAGK catalyzes the second, generally controlling, step of arginine biosynthesis. In yeasts, NAGK exists either alone or forming a metabolon with N-acetyl-L-glutamate synthase (NAGS, which catalyzes the first step and exists only within the metabolon. Yeast NAGK (yNAGK has, in addition to the amino acid kinase (AAK domain found in other NAGKs, a ~150-residue C-terminal domain of unclear significance belonging to the DUF619 domain family. We deleted this domain, proving that it stabilizes yNAGK, slows catalysis and modulates feed-back inhibition by arginine. We determined the crystal structures of both the DUF619 domain-lacking yNAGK, ligand-free as well as complexed with acetylglutamate or acetylglutamate and arginine, and of complete mature yNAGK. While all other known arginine-inhibitable NAGKs are doughnut-like hexameric trimers of dimers of AAK domains, yNAGK has as central structure a flat tetramer formed by two dimers of AAK domains. These dimers differ from canonical AAK dimers in the -110° rotation of one subunit with respect to the other. In the hexameric enzymes, an N-terminal extension, found in all arginine-inhibitable NAGKs, forms a protruding helix that interlaces the dimers. In yNAGK, however, it conforms a two-helix platform that mediates interdimeric interactions. Arginine appears to freeze an open inactive AAK domain conformation. In the complete yNAGK structure, two pairs of DUF619 domains flank the AAK domain tetramer, providing a mechanism for the DUF619 domain modulatory functions. The DUF619 domain exhibits the histone acetyltransferase fold, resembling the catalytic domain of bacterial NAGS. However, the putative acetyl CoA site is blocked, explaining the lack of NAGS activity of yNAGK. We conclude that the tetrameric architecture is an adaptation to metabolon formation and propose an organization for this metabolon, suggesting that yNAGK may be a good model also for yeast and human NAGSs.

  19. Una nueva aportación al catálogo del pintor Vicente Alanís.

    Directory of Open Access Journals (Sweden)

    Álvaro Cabezas García

    2016-01-01

    Full Text Available Recientemente pude estudiar con detenimiento la pintura que remata el retablo de ánimas ubicado en la nave del Evangelio de la iglesia de San Juan de la Palma de Sevilla. Se trata de una pieza de mediano tamaño, ejecutada con la técnica del óleo sobre lienzo, que presenta actualmente un estado de conservación muy deficiente –en la fotografía pueden apreciarse tres roturas en la tela, siendo una de ellas de considerables proporciones–, y que representa a San Lorenzo Mártir con sus atributos característicos. Por las amplias similitudes que presenta su forma considero justificado incluirla en el catálogo pictórico de Vicente Alanís Espinosa. A este autor he dedicado parte de mis estudios, pero, como es habitual en tantos artistas, la investigación científica sigue ofreciendo caminos de exploración que hacen posible proponer nuevas aportaciones a la nómina de las pinturas ya conocidas.

  20. C. elegans AMPKs promote survival and arrest germline development during nutrient stress

    Directory of Open Access Journals (Sweden)

    Masamitsu Fukuyama

    2012-08-01

    Mechanisms controlling development, growth, and metabolism are coordinated in response to changes in environmental conditions, enhancing the likelihood of survival to reproductive maturity. Much remains to be learned about the molecular basis underlying environmental influences on these processes. C. elegans larvae enter a developmentally dormant state called L1 diapause when hatched into nutrient-poor conditions. The nematode pten homologue daf-18 is essential for maintenance of survival and germline stem cell quiescence during this period (Fukuyama et al., 2006; Sigmond et al., 2008, but the details of the signaling network(s in which it functions remain to be elucidated. Here, we report that animals lacking both aak-1 and aak-2, which encode the two catalytic α subunits of AMP-activated protein kinase (AMPK, show reduced viability and failure to maintain mitotic quiescence in germline stem cells during L1 diapause. Furthermore, failure to arrest germline proliferation has a long term consequence; aak double mutants that have experienced L1 diapause develop into sterile adults when returned to food, whereas their continuously fed siblings are fertile. Both aak and daf-18 appear to maintain germline quiescence by inhibiting activity of the common downstream target, TORC1 (TOR Complex 1. In contrast, rescue of the lethality phenotype indicates that aak-2 acts not only in the intestine, as does daf-18, but also in neurons, likely promoting survival by preventing energy deprivation during L1 diapause. These results not only provide evidence that AMPK contributes to survival during L1 diapause in a manner distinct from that by which it controls dauer diapause, but they also suggest that AMPK suppresses TORC1 activity to maintain stem cell quiescence.

  1. An Examination of Mathematically Gifted Students' Learning Styles by Decision Trees/Matematik Alanında Üstün Yetenekli Öğrencilerin Öğrenme Stillerinin Karar Ağaçları Kullanılarak İncelenmesi

    Directory of Open Access Journals (Sweden)

    Esra Aksoy

    2015-12-01

    Full Text Available Abstract The aim of this study was to examine mathematically gifted students' learning styles through data mining method. ‘Learning Style Inventory’ and ‘Multiple Intelligences Scale’ were used to collect data. The sample included 234 mathematically gifted middle school students. The construct decision tree was examined predicting mathematically gifted students’ learning styles according to their multiple intelligences and gender and grade level. Results showed that all the variables used in the study had a significant effect on mathematically gifted students’ learning styles, but the most effective attribute found was intelligence type. Key Words: mathematically gifted students, educational data mining, learning style, multiple intelligences Öz Bu çalışmanın amacı, matematik alanında üstün yetenekli öğrencilerin öğrenme stillerini veri madenciliği yöntemini kullanarak incelemektir. Veri toplama aracı olarak ‘Öğrenme Stili Envanteri’ ve ‘Çoklu Zeka Ölçeği’ kullanılmıştır. Araştırmanın örneklemi, 234 matematik alanında üstün yetenekli ortaokul öğrencisinden oluşmaktadır. Matematik alanında üstün yetenekli öğrencilerin öğrenme stillerini çoklu zeka alanları, cinsiyetleri ve sınıf seviyelerine göre tahmin etmek için oluş- turulan karar ağacı incelenmiştir. Sonuç olarak tüm değişkenlerin üstün yetenekli öğrencilerin öğrenme stilleri üzerinde etkisi olduğu fakat en etkili değişkenin çoklu zeka alanı olduğu gözlenmiştir. Anahtar Sözcükler: matematikte üstün yetenekli öğrenciler, eğitimsel veri madencili- ği, öğrenme stili, çoklu zeka

  2. Cambio dirigido por la acción cívica : el poder de la imaginación ciudadana. El poder de la imaginación ciudadana / Alan Fowler & Kees Biekart (eds)

    NARCIS (Netherlands)

    K. Biekart (Kees); A.F. Fowler (Alan)

    2011-01-01

    textabstractContents: Alan Fowler y Kees Biekart / El cambio dirigido por la acción cívica: el poder de la imaginación ciudadana -- Evelina Dagnino / El cambio dirigido por la acción cívica y los proyectors políticos -- Philomena Mwaura / El cambio dirigido por la acción cívica:

  3. Top man: Mathematician, geographer, vice chancellor , Sir Alan Wilson the new director general of higher education at the DfES, has a reputation for solving complicated problems. He talks to Jim Kelly

    CERN Multimedia

    Kelly, J

    2003-01-01

    "Sir Alan Wilson, vice-chancellor of Leeds University, has made a career out of solving big problems. This week he landed himself one of the biggest. Appointed the government's first ever director general of higher education, he becomes responsible for advising Charles Clarke at a pivotal moment in the history of the sector" (1 page).

  4. NCBI nr-aa BLAST: CBRC-ATHA-03-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-03-0002 ref|NP_186955.1| CSLD3 (CELLULOSE SYNTHASE-LIKE 3); cellulose syn...thase/ transferase, transferring glycosyl groups [Arabidopsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose... synthase catalytic subunit [Arabidopsis thaliana] gb|AAG60543.1|AF232907_1 cellulose synthase-like ...CSLD3 [Arabidopsis thaliana] gb|AAK25890.1|AF360180_1 putative cellulose synthase... catalytic subunit [Arabidopsis thaliana] gb|AAK64073.1| putative cellulose synthase catalytic subunit [Arab

  5. NCBI nr-aa BLAST: CBRC-OSAT-10-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OSAT-10-0021 ref|NP_186955.1| CSLD3 (CELLULOSE SYNTHASE-LIKE 3); cellulose syn...thase/ transferase, transferring glycosyl groups [Arabidopsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose... synthase catalytic subunit [Arabidopsis thaliana] gb|AAG60543.1|AF232907_1 cellulose synthase-like ...CSLD3 [Arabidopsis thaliana] gb|AAK25890.1|AF360180_1 putative cellulose synthase... catalytic subunit [Arabidopsis thaliana] gb|AAK64073.1| putative cellulose synthase catalytic subunit [Arab

  6. NCBI nr-aa BLAST: CBRC-OSAT-12-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OSAT-12-0025 ref|NP_186955.1| CSLD3 (CELLULOSE SYNTHASE-LIKE 3); cellulose syn...thase/ transferase, transferring glycosyl groups [Arabidopsis thaliana] gb|AAF26119.1|AC012328_22 putative cellulose... synthase catalytic subunit [Arabidopsis thaliana] gb|AAG60543.1|AF232907_1 cellulose synthase-like ...CSLD3 [Arabidopsis thaliana] gb|AAK25890.1|AF360180_1 putative cellulose synthase... catalytic subunit [Arabidopsis thaliana] gb|AAK64073.1| putative cellulose synthase catalytic subunit [Arab

  7. ORF Alignment: NC_002505 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002505 gi|15640861 >1bxwA 8 146 21 199 4e-04 ... gb|AAF94007.1| accessory colonization... factor AcfA [Vibrio cholerae O1 biovar eltor ... str. N16961] ref|NP_230492.1| accessory colonization... ... factor AcfA [Vibrio cholerae O1 biovar eltor str. ... N16961] gb|AAK20801.1| accessory colonization... factor ... AcfA [Vibrio cholerae] gb|AAK20771.1| accessory ... colonization... factor AcfA [Vibrio cholerae] pir||JC4087 ... accessory colonization factor

  8. Scientific familial lessons in ingestive behavior research: 2016 Alan N. Epstein research award.

    Science.gov (United States)

    Hayes, Matthew R

    2017-07-01

    While energy balance is under the control of the central nervous system (CNS), a major source of neural regulation for the behavioral, physiological and endocrine processes governing energy balance originates in the periphery. Indeed, the organs of the gastrointestinal (GI) tract, supporting organs of the peritoneal cavity and adipose tissue are the source of numerous neurotransmitter and neuroendocrine signals released from non-neuronal peripheral tissue that signal in a paracrine and endocrine fashion to regulate the physiological and behavioral processes that affect energy balance. Given the ever increasing appreciation that chronic hyperphagia of highly-palatable/rewarding food is a major contributing factor to the obesity epidemic, it is not surprising that the field has increased research efforts focusing on understanding what role peripherally-derived neuroendocrine signals play in modulating food reward and motivated behaviors. Research throughout my career has focused on understanding gut-to-brain communication of relevance to energy balance control. Through very fortuitous opportunities and amazing collaborations, my research program has also expanded widely to include analyses of multiple GI-, pancreatic- and adipose tissue-derived anorectic signals involved in food intake and energy balance control, as well as analyses of higher-order determinants of food reward, nausea, aversion and maladaptive motivated behaviors. I am honored to be the recipient of the 2016 Alan N. Epstein Research Award from the Society for the Study of Ingestive Behavior, and express much appreciation for the amazing collaborations I have had with my mentors, colleagues and trainees. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Sosyal Medyada Yer Alan Markalara İlişkin Marka İmajının Güven Üzerindeki Etkisi

    OpenAIRE

    HACIEFENDİOĞLU, Şenol; FIRAT, Duygu

    2014-01-01

    İşletmeler, bugün çok önemli bir pazarlama ortamı haline gelen sosyal medyayı etkin bir şekilde kullanma çabası içindedirler. Bu çalışmada, sosyal medyada yer alan markaların marka imajının marka güveni oluşturmadaki etkisi araştırılmıştır. Araştırma, sosyal paylaşım sitelerine üye olan ve bu siteleri kullanan 483 kullanıcı üye ile yüzyüze anket yöntemi kullanılarak yapılmış ve elde edilen veriler değerlendirilmiştir. Marka imajı boyutları ile marka güveni arasındaki birebir ilişkiler korelas...

  10. Acariciando a contrapelo los 70. El archivo en Historia del Llanto de Alan Pauls

    Directory of Open Access Journals (Sweden)

    María José Sabo

    2015-11-01

    Full Text Available El artículo aborda desde una mirada ensayística y analítica la novela de Alan Pauls, Historia del llanto. Un testimonio (2007, pensándola como una novela-laboratorio en la que se indagan y proponen otras formas de escribir la memoria. Por un lado, desde el protagonismo del cuerpo, particularmente aquí las lágrimas y la piel; por otro, en confrontación a la idea de una reconstrucción del pasado como mecanismo de reparación del trauma social y, asimismo, interpelando la concepción de un arte al servicio de la representación y la conciliación de sentidos. Para ello, la hipótesis de lectura propone leer la novela como texto que opera una continua desestabilización del archivo de formas de representación del pasado, efectuando un extrañamiento incómodo de las lecturas con que la discursividad social del presente ha consensuado medianamente un relato de los años 60 y 70. La novela busca escribirse desde el encuentro con aquellos otros materiales que el archivo, para su constitución y eficacia, ha borrado, olvidado o no dicho. A través de los aportes de Jacques Rancière y Jean-Luc Nancy a la indagación estética, como también haciendo referencia a los aportes de Michel Foucault y Hal Foster, entre otros, a la problemática del archivo, es posible inscribir la novela en un trabajo con los materiales del pasado renuente a la clausura de sentidos: una escritura que busca mantener el relato de la memoria como un ejercicio siempre en proceso y atravesado por la poética de los cuerpos en contacto, por ende, sujeto a pugnas que lo reinscriben en la arena política. The aim of this paper is to address Alan Paul´s 2007 Historia del llanto. Un testimonio from an essayistic an analytical perspective, considering it as a laboratory-novel that enquires and suggests other means for memory writing. On one hand, we look into the relevance of the body, particularly of tears and skin. On the other, re-writing memory is viewed as a form that

  11. Who translates the translation? (Retraduire les héros marginaux d'Alan Moore

    Directory of Open Access Journals (Sweden)

    Alice RAY

    2016-11-01

    Full Text Available The retranslation phenomenon is essential to the translation process. It is considered as the logical progression of this process which allows the translated literary work to regenerate in a restless cultural and language space. To a lesser extent, we can observe the same phenomenon in the translation of comics. However, this specific translation requires other competencies and a translating approach somehow different from the ones required to translate fiction literature, especially because of the presence of the visual system of drawings which is strongly bound to its own culture and the endless mutations it goes through. The comic book Watchmen (Les Gardiens, in the first French translation by Alan Moore and Dave Gibbons, is known in the whole world as the comic which had not only remodeled the vision we had of super-heroes, but had also given the comic books another voice. Watchmen was published between 1986 and 1987 in the United States and translated in French from 1987 to 1988. Fifteen years after this first translation by Jean-Patrick Manchette, Panini publishing decided to retranslate this famous comic in 2007. However, if the reviews of the first translation were laudatory, the retranslation did not enjoy a great reception from the readers or from the reviewers. This paper proposes a comparative analysis of both these translations and of their original version as well as an experiment on the readers, comic books readers or not, in order to establish why the first translation was a success and the retranslation a failure. Thus, we could withdraw the elements which allow us to understand the reception of comic translation.

  12. Bazı Adi Fiğ Çeşitlerinde Farklı Ekim Tarihlerinin Yaprak Alan İndeksine Etkisi

    Directory of Open Access Journals (Sweden)

    Süleyman TEMEL

    2015-12-01

    Full Text Available Bu makalenin amacı kurak şartlarda yetiştirilen adi fiğ çeşitlerinin yaprak alan indeksi (YAI üzerine farklı ekim tarihlerinin etkisini incelemektir. Deneme 2014 - 2015 yetiştirme döneminde kurak iklim özelliği gösteren Iğdır ilinde yürütülmüştür. Araştırmada Bakır-2001, Dicle, Emir, Gülhan-2005 ve Nilüfer çeşitleri, 6 farklı ekim döneminde (E1:1 Ekim 2014, E2: 16 Ekim 2014, E3: 31 Ekim 2014, E4: 15 Mart 2015, E5: 1 Nisan 2015 ve E6: 16 Nisan 2015 ekilmiş ve ot için hasat dönemi olan bitkilerdeki alt baklaların tamamen dolduğu devrede yaprak alan ölçer cihazı ile (CI-202 YAI’leri belirlenmiştir. Sonuçlar YAI üzerine çeşit, ekim tarihi ve çeşit x ekim tarihi interaksiyonun önemli etkisi olduğunu göstermiştir. Çeşitler arasında en yüksek YAI Dicle ve Nilüfer çeşidinde, en düşük değerler Emir ve Bakır-2001 çeşidinde belirlenmiştir. Ekim zamanları arasında maksimum YAI, E1 döneminde (6.22, minimum değerler E6 (0.87 döneminde ölçülmüştür. Çeşit x ekim tarihi interaksiyonu açısından ise en yüksek YAI, erken güz döneminde ekilen (E1 Nilüfer ve Dicle çeşitlerinde tespit edilmiştir. Oysa en düşük YAI değerleri tüm çeşitlerde E6 dönemi olan yazlık ekimlerde gerçekleşmiştir. Bu sonuçlara göre, çevresel koşullara bağlı olarak ekim tarihlerinin gecikmesi ile (özellikle yazlık ekimlerde YAI’lerinde önemli düşüşler görülmüş, Dicle ve Nilüfer YAI açısından düşük yağış ve yüksek sıcaklıktan en az etkilenen çeşitler olmuştur.

  13. Türkiye’de Vergi Gelirleri ile Ekonomik Kalkınma Arasındaki İlişki: Frekans Alanı Nedensellik Analizi

    Directory of Open Access Journals (Sweden)

    Mehmet Vahit EREN

    2018-01-01

    Full Text Available Çalışmanın amacı, Türkiye’de 1975-2013 dönemine ait yıllık verilerle vergi gelirleri ile kalkınma arasındaki ilişkinin varlığını araştırmakla beraber söz konusu ilişkinin yönünü farklı ekonometrik testlerle analiz etmektir. Hacker ve Hatemi nedensellik testi bulgularına göre, dolaylı vergi gelirlerinden kalkınmaya doğru tek yönlü; Breitung ve Caldelon frekans alanı nedensellik testi ise toplam vergi gelirlerinden kalkınmaya, dolaysız vergi gelirlerinden kalkınmaya ve kalkınmadan dolaylı vergi gelirlerine doğru tek yönlü ilişkiler tespit edilmiştir.

  14. Augmented kludge waveforms for detecting extreme-mass-ratio inspirals

    Science.gov (United States)

    Chua, Alvin J. K.; Moore, Christopher J.; Gair, Jonathan R.

    2017-08-01

    The extreme-mass-ratio inspirals (EMRIs) of stellar-mass compact objects into massive black holes are an important class of source for the future space-based gravitational-wave detector LISA. Detecting signals from EMRIs will require waveform models that are both accurate and computationally efficient. In this paper, we present the latest implementation of an augmented analytic kludge (AAK) model, publicly available at https://github.com/alvincjk/EMRI_Kludge_Suite as part of an EMRI waveform software suite. This version of the AAK model has improved accuracy compared to its predecessors, with two-month waveform overlaps against a more accurate fiducial model exceeding 0.97 for a generic range of sources; it also generates waveforms 5-15 times faster than the fiducial model. The AAK model is well suited for scoping out data analysis issues in the upcoming round of mock LISA data challenges. A simple analytic argument shows that it might even be viable for detecting EMRIs with LISA through a semicoherent template bank method, while the use of the original analytic kludge in the same approach will result in around 90% fewer detections.

  15. Kadın Çalışanların Yöneticilere İlişkin Algıları: Bir Alan Çalışması

    Directory of Open Access Journals (Sweden)

    İsmail BAKAN

    2013-09-01

    Full Text Available İşletmelerde yönetim kademesinde yer alan kişilerin ne tür bir liderlik tarzına sahip oldukları çalışanların davranışları ve işletmeye ilişkin tutumları üzerinde önemli etkiye sahiptir. Bu nedenle işletmelerdeki yöneticilerin liderlik tarzlarının çalışanlar açısından nasıl algılandığının tespit edilerek ortaya konulması yöneticiler tarafından başarılı bir yönetim sergilenmesinde yol gösterici olacaktır. Literatürde liderlik tarzlarına ilişkin çeşitli ayrımlar bulunmakta olup bu çalışmada öncelikle liderlik kavramı ve liderlik tarzlarına ilişkin genel bilgiler verilerek, daha sonra otokratik, demokratik ve serbest bırakıcı liderlik tarzları açıklanacaktır. Çalışmanın ikinci bölümünde ise Kahramanmaraş’ta lokomotif sektör olarak görülen tekstil sektöründe, kadın çalışanların çalıştıkları işletmelerde bulunan yöneticilerin, liderlik tarzlarına ilişkin algılarını ölçmek amacıyla yapılan bir alan araştırmasına yer verilecektir.

  16. An exploratory phase 2 study of investigational Aurora A kinase inhibitor alisertib (MLN8237 in acute myelogenous leukemia and myelodysplastic syndromes

    Directory of Open Access Journals (Sweden)

    Stuart L. Goldberg

    2014-01-01

    Full Text Available Alisertib (MLN8237 is an investigational, oral, selective, Aurora A kinase (AAK inhibitor. In this phase 2 trial, 57 patients with acute myeloid leukemia (AML or high-grade myelodysplastic syndrome received alisertib 50 mg BID for 7 days in 21-day cycles. Responses in 6/35 AML patients (17% response rate with an additional 49% stable disease, 34% transfusion independence included 1 complete response lasting >1 year. No responses were observed in MDS patients. Adverse events >30% included diarrhea, fatigue, nausea, febrile neutropenia, and stomatitis. Results suggest modest activity in AML, supporting further research to better understand how AAK inhibition may induce leukemic cell senescence.

  17. ALTERNATIVE FORMS OF COMMUNICATION AMONG PERSONS WITH APHASIA

    Directory of Open Access Journals (Sweden)

    Elena TASHKOVA

    2012-03-01

    Full Text Available The aphasia is the most complicated and the most difficult form of disorder of speaking and language. Most often it appears as a consequence of a brain stroke. The occurrence of aphasias is in about one third of the patients suffering from a brain stroke in an acute phase, or from 21% to 24%, and there are data for even bigger frequency. In a certain number of patients the aphasia withdraws spontaneously, but in a bigger number of patients it takes over all four models of language activity; phoneme pronunciation, carrying out a discussion, writing a letter of a full text. It spreads from the automatic to the creative expression. The process of rehabilitation of the spoken communication at the persons with aphasia is complicated, multidisciplinary and long lasting.Around the World, a big accent is placed on the use of methods and strategies of alternative communication methods (AAK for the persons with aphasia. Although the augmentative and the AAK methods for the persons with aphasia are relatively novel in the speech therapy, their applicability deserves an attention as well as the fact that they are promising new paths for researching.The master thesis is written on 104 pages, which include 35 tables and 48 graphics, as well as a glossary with 114 biographical units. The content is divided into introduction, grounding theory and methodology of research. The introduction shows the meaning and the necessity for research of alternative methods in the therapy and the treatment of persons with aphasia. The section with the theoretical grounds contains several mutually connected chapters (parts. In methodology of research section are described the subject of the research, the aim and the character of the research. Further the text contains the tasks, hypothesis, research variables, methods and techniques of the research, as well as the sample and the organization of the research. The end of the section consist the analysis and interpretation of the

  18. ORF Alignment: NC_002662 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available eptidase [Lactococcus lactis subsp. lactis Il1403] ... gb|AAK04710.1| mathionine aminopeptidase [Lact...ococcus ... lactis subsp. lactis Il1403] pir||D86701 mathionine ... aminopeptidase [imported

  19. Psikolojik Sermaye ve Çalışanlar Üzerinde Etkisi: Banka Sektöründe Bir Alan Çalışması

    OpenAIRE

    YEŞİL, Salih; YETİŞ, Emirhan; TELLİ, Sümeyra

    2016-01-01

    Bu çalışmanın amacı psikolojik sermayenin çalışanlar üzerinde etkilerini (bilgi paylaşımı, iş tatmini, işten ayrılma eğilimi ve yenilikçi davranış) belirlemeye yöneliktir. Araştırmanın alan çalışması, bir banka çalışanları üzerinde yapılmış, analiz edilmiş ve yorumlanmıştır. Araştırma sonucunda psikolojik sermayenin çalışanlar açısından bilgi paylaşımı, iş tatmini, işten ayrılma niyeti, performans ve yenilikçi davranış üzerinde farklı düzeylerde etkileri olduğu belirlenmiştir. Bu sonuç psiko...

  20. Asi Nehri (Antakya Kıyı Bandı Rekreasyon Alanı Donatı Elemanları ve Kullanıcı Memnuniyetinin Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Elif Bozdoğan

    2014-09-01

    Full Text Available Bir kentin kimlik kazanmasında önem taşıyan su yüzeyleri, kentin gelişimini yönlendiren, rekreasyonel aktivitelere olanak sağlayan, kentte yaşayanlar üzerinde görsel ve psikolojik etkiler yaratan unsurlardır. Bu çalışmanın amacı, Asi Nehri kıyı bandının donatı elemanları bakımından kullanıcı memnuniyetinin belirlenmesidir. Bu alan yerleşim bölgelerini ayırması, çeşitli aktivitelere imkan sağlaması ve kent kimliği için önemli olması nedeniyle seçilmiştir. Çalışma Asi Nehri kıyı bandında 2012 Nisan-Temmuz ayları arasında 3 aşamada gerçekleştirilmiştir. Çalışmanın birinci aşamasında alanda mevcut donatı elemanlarının miktar ve yapım malzemeleri tespit edilmiştir. İkinci aşama kullanıcıya ve kullanıma yönelik bilgiler ile halkın memnuniyet düzeyinin belirlendiği soruları içeren anket çalışmasından oluşmaktadır. Sonuç olarak, çalışma alanındaki donatı elemanlarından en yüksek düzeydeki memnuniyetin ele alınan tüm parametreler bakımından köprüler, en düşük düzeydeki memnuniyetin ise estetik ve fonksiyonel özellikler bakımından işaret/bilgi levhaları ile miktar bakımından çöp kutuları olduğu belirlenmiştir. Çalışma kapsamında, donatı elemanları kullanıcı memnuniyet düzeyinin arttırılmasında kentin tarihi ve kültürel değerleri ile bütünlük sağlanmasının gerekliliği önemli bulunmuştur. Çalışmanın yerel yönetimlere bir veri tabanı oluşturulmasında katkı sağlayacağı düşünülmektedir.

  1. NCBI nr-aa BLAST: CBRC-LAFR-01-0236 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0236 ref|NP_336748.1| hypothetical protein MT2277 [Mycobacterium tuberculosis... CDC1551] gb|AAK46562.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] NP_336748.1 2.0 34% ...

  2. NCBI nr-aa BLAST: CBRC-GACU-08-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-08-0028 ref|NP_336316.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46130.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336316.1 0.021 33% ...

  3. Türkiye’de Yaygın Gelişimsel Bozukluklar Alanında Gerçekleştirilen Lisansüstü Tez Çalışmalarının Gözden Geçirilmesi

    Directory of Open Access Journals (Sweden)

    Özge Eliçin

    2011-07-01

    Full Text Available Bu araştırmada, Türkiye’de yaygın gelişimsel bozukluklar alanında 1990-2011 yılları arasında lisansüstü düzeyde gerçekleştirilen tez çalışmalarının gözden geçirilmesi amaçlanmıştır. Bu araştırma için kaynaklara Yüksek Öğretim Kurulu’nun internet sitesinden ulaşılmıştır. Taramada anahtar kelime olarak “otizm”, “otistik bozukluk”, “otizm spektrum bozukluğu/yaygın gelişimsel bozukluk”, “Asperger” kelimeleri kullanılmıştır. Bunun yanında Zihinsel Yetersizlik ve Gelişimsel Bozukluk Alanlarında Lisansüstü Tez Bibliyografyası (Diken, Ünlü ve Karaaslan, 2008 kitabından “otizm”, “otistik bozukluk” ve “yaygın gelişimsel bozukluk”, “Asperger” kelimelerini içeren tezler araştırmaya dâhil edilmiştir. Araştırmaya dâhil edilen tezlerde a yaygın gelişimsel bozukluklar alanından bir tanı almış çocuklarla ya da bu tanı kriterlerine sahip çocukların aileleriyle yürütülmüş olması b incelenen durumların (görüş, olgu, karşılaştırma, etki yaygın gelişimsel bozukluklar alanından bir tanı almış çocuklar için yapılmış olması c çalışmaların yüksek lisans ve doktora tezi olması özellikleri aranmıştır. Araştırmada bu amaçla gerçekleştirilen toplam 79 teze ulaşılmıştır. Tezlerin analizi aşamasında, tezler konularına göre 6 kategoriye ayrılmıştır. Her bir kategoride yer alan tezler karşılaştırmalı olarak incelenmiştir. The purpose of this study is to review graduate studies (master thesis and doctoral dissertations regarding pervasive developmental disorders (PDD carried out between 1990-2011 in Turkey. Graduate studies were reached through website of Higher Education Council of Turkey by using keywords of “autism, autistic disorder, and pervasive developmental disorder/autism spectrum disorders”. In addition, graduate studies listed in the book (Diken, Ünlü and Karaaslan, 2008 entitled “Bibliography of

  4. NCBI nr-aa BLAST: CBRC-OLAT-26-0215 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0215 ref|NP_335197.1| PE_PGRS family protein [Mycobacterium tuberculosis... CDC1551] gb|AAK45011.1| PE_PGRS family protein [Mycobacterium tuberculosis CDC1551] NP_335197.1 0.001 29% ...

  5. NCBI nr-aa BLAST: CBRC-CJAC-01-0354 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0354 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-11 28% ...

  6. NCBI nr-aa BLAST: CBRC-CJAC-01-1302 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1302 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 2e-08 26% ...

  7. NCBI nr-aa BLAST: CBRC-CJAC-01-1522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1522 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 7e-07 25% ...

  8. NCBI nr-aa BLAST: CBRC-PTRO-08-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-08-0000 ref|NP_337168.1| PE_PGRS family protein [Mycobacterium tuberculosis... CDC1551] gb|AAK46982.1| PE_PGRS family protein [Mycobacterium tuberculosis CDC1551] NP_337168.1 0.002 32% ...

  9. NCBI nr-aa BLAST: CBRC-TTRU-01-0284 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0284 ref|NP_112431.1| NADH dehydrogenase subunit 6 [Tetrodontophora bi...elanensis] gb|AAK30950.1|AF272824_11 NADH dehydrogenase subunit 6 [Tetrodontophora bielanensis] NP_112431.1 0.009 22% ...

  10. NCBI nr-aa BLAST: CBRC-CJAC-01-1092 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1092 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-05 27% ...

  11. NCBI nr-aa BLAST: CBRC-CJAC-01-1176 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1176 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-05 29% ...

  12. NCBI nr-aa BLAST: CBRC-CJAC-01-0299 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0299 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-19 29% ...

  13. NCBI nr-aa BLAST: CBRC-CJAC-01-0065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0065 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 7e-07 25% ...

  14. NCBI nr-aa BLAST: CBRC-GGAL-35-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0026 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 6e-16 27% ...

  15. NCBI nr-aa BLAST: CBRC-GGAL-35-0335 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0335 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-18 29% ...

  16. NCBI nr-aa BLAST: CBRC-CJAC-01-1056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1056 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 7e-15 27% ...

  17. NCBI nr-aa BLAST: CBRC-CJAC-01-1306 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1306 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 5e-15 29% ...

  18. NCBI nr-aa BLAST: CBRC-XTRO-01-2803 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2803 ref|NP_338156.1| PE_PGRS family protein [Mycobacterium tuberculosis... CDC1551] gb|AAK47970.1| PE_PGRS family protein [Mycobacterium tuberculosis CDC1551] NP_338156.1 9e-35 37% ...

  19. NCBI nr-aa BLAST: CBRC-CREM-01-1284 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1284 ref|NP_337963.1| sugar transporter family protein [Mycobacterium tuberculosis... CDC1551] gb|AAK47777.1| sugar transporter family protein [Mycobacterium tuberculosis CDC1551] NP_337963.1 3e-78 52% ...

  20. NCBI nr-aa BLAST: CBRC-CFAM-08-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-08-0030 ref|NP_336612.1| hypothetical protein MT2144 [Mycobacterium tuberculosis... CDC1551] gb|AAK46426.1| hypothetical protein MT2144 [Mycobacterium tuberculosis CDC1551] NP_336612.1 1e-04 29% ...

  1. ORF Alignment: NC_002737 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

  2. ORF Alignment: NC_002737 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

  3. NCBI nr-aa BLAST: CBRC-OANA-01-0199 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0199 ref|NP_115455.1| putative movement protein [Maize rayado fino vir...us] gb|AAK52839.1|AF265566_2 putative movement protein [maize rayado fino virus] NP_115455.1 0.086 27% ...

  4. NCBI nr-aa BLAST: CBRC-BTAU-01-3007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-3007 ref|NP_334965.1| PE_PGRS family protein [Mycobacterium tuberculosi...s CDC1551] gb|AAK44779.1| PE_PGRS family protein [Mycobacterium tuberculosis CDC1551] NP_334965.1 3e-35 36% ...

  5. NCBI nr-aa BLAST: CBRC-TSYR-01-1466 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1466 ref|NP_335195.1| PE_PGRS family protein [Mycobacterium tuberculosi...s CDC1551] gb|AAK45009.1| PE_PGRS family protein [Mycobacterium tuberculosis CDC1551] NP_335195.1 6e-21 35% ...

  6. NCBI nr-aa BLAST: CBRC-PHAM-01-1757 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1757 ref|NP_001003095.1| bradykinin receptor B2 [Canis lupus familiari...s] gb|AAK21217.1|AF334948_1 B2 bradykinin receptor [Canis lupus familiaris] NP_001003095.1 0.0 80% ...

  7. Yüksek Hidrostatik Basinç ve Vurgulu Elektriksel Alan İşlemlerinin Maillard Reaksiyonu Üzerine Etkisi

    Directory of Open Access Journals (Sweden)

    E. Feyza Topdaş

    2015-02-01

    Full Text Available Maillard reaksiyonu, çoğunlukla ısıl işleme tabi tutulan ve depolanan ürünlerde görülen, indirgen şekerlerle proteinlerin amino grupları arasında meydana gelen en önemli enzimatik olmayan esmerleşme reaksiyonlarından biridir. Bu reaksiyon, gıdaların renk, tat-aroma ve besin değeri gibi kalite özellikleri üzerine istenen veya istenmeyen etkilere neden olabilmektedir. Bu kompleks reaksiyonun gıdalarda meydana getirdiği olumsuz değişiklikleri azaltmak amacıyla günümüzde ısıl olmayan işlemler üzerine çalışmalar yapılmakta ve ümit verici sonuçlar alınmaktadır. Gıda endüstrisinde ısıl olmayan işlemlerin uygulaması sadece gıdaların raf ömrünün artırılması amacıyla değil, aynı zamanda; daha güvenilir, besinsel ve duyusal açıdan daha kaliteli gıdaların üretilebilmesine olanak sağlamaktadır. Bu yönleri ile ısıl olmayan işlemler, ısıl işlem tekniklerini içeren geleneksel gıda işleme yöntemlerine alternatif olabilecek potansiyele sahiptir. Bu derlemede Maillard reaksiyonu ve geleneksel gıda işleme metotlarına alternatif olarak Yüksek Hidrostatik Basınç ve Vurgulu Elektriksel Alan uygulamalarının Maillard reaksiyonu üzerine olan etkileri anlatılmaktadır.

  8. NCBI nr-aa BLAST: CBRC-OANA-01-0159 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0159 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 6e-11 29% ...

  9. NCBI nr-aa BLAST: CBRC-GGOR-01-0877 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0877 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 1e-16 33% ...

  10. NCBI nr-aa BLAST: CBRC-HSAP-01-0116 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-01-0116 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 3e-05 41% ...

  11. NCBI nr-aa BLAST: CBRC-TGUT-16-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-16-0010 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 1e-12 27% ...

  12. NCBI nr-aa BLAST: CBRC-OANA-01-0514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0514 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 2e-20 34% ...

  13. NCBI nr-aa BLAST: CBRC-OANA-01-1404 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1404 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 5e-04 43% ...

  14. NCBI nr-aa BLAST: CBRC-TNIG-22-0318 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-22-0318 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 4e-12 38% ...

  15. NCBI nr-aa BLAST: CBRC-MMUS-17-0191 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-17-0191 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 2e-16 33% ...

  16. NCBI nr-aa BLAST: CBRC-OANA-01-1145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1145 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosi...s CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 3e-22 34% ...

  17. NCBI nr-aa BLAST: CBRC-TSYR-01-0087 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0087 ref|NP_356664.2| ice nucleation-like protein [Agrobacterium tumef...aciens str. C58] gb|AAK89449.2| ice nucleation-like protein [Agrobacterium tumefaciens str. C58] NP_356664.2 7e-17 20% ...

  18. NCBI nr-aa BLAST: CBRC-TSYR-01-1411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1411 ref|NP_356664.2| ice nucleation-like protein [Agrobacterium tumef...aciens str. C58] gb|AAK89449.2| ice nucleation-like protein [Agrobacterium tumefaciens str. C58] NP_356664.2 9e-39 19% ...

  19. NCBI nr-aa BLAST: CBRC-XTRO-01-0388 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0388 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 2e-19 30% ...

  20. NCBI nr-aa BLAST: CBRC-HSAP-19-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-19-0006 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis... CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 1e-25 34% ...

  1. ORF Alignment: NC_002663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

  2. NCBI nr-aa BLAST: CBRC-DYAK-04-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-04-0007 ref|NP_650652.1| CG7431-PA [Drosophila melanogaster] gb|AAF55463....1| CG7431-PA [Drosophila melanogaster] gb|AAK57748.1| tyramine receptor [Drosophila melanogaster] NP_650652.1 1e-116 42% ...

  3. NCBI nr-aa BLAST: CBRC-TTRU-01-0285 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0285 ref|NP_112432.1| cytochrome b [Tetrodontophora bielanensis] sp|Q9...ull=Complex III subunit III gb|AAK30951.1|AF272824_12 cytochrome B apoenzyme [Tetrodontophora bielanensis] NP_112432.1 8e-04 21% ...

  4. Esnek Hesaplamada Sinirsel Bulanık Sinerjiyi Temel Alan Sistemler ve Yaklaşımlar Üzerine Bir İnceleme

    Directory of Open Access Journals (Sweden)

    Koray Aki

    2014-05-01

    Full Text Available Özet. Yapay Sinir Ağları (Artificial Neural Network, YSA ve Bulanık Mantık (Fuzzy Logic, BM melezleştirmesi gerçek dünya problemlerinin çözümünde uyarlanabilir zeki sistemlere olan ihtiyaç nedeniyle çeşitli bilimsel ve mühendislik alanındaki çalışmalarda araştırmacıların ilgisini çekmektedir. Problemlerin çözümünde sıklıkla eniyileme için Genetik Algoritma (Genetic Algorithm, GA kullanılmaktadır. YSA, insan beyninin çalışma prensibini taklit ederek, eğitim sürecindeki örneklerin kullanımı sayesinde öğrenimini gerçekleştirir. BM, sözel ifadeleri verilen kurallar ve üyelik fonksiyonları kullanarak kural tabanındaki kurallara çevirmektedir. YSA ve BM birbirlerinin eksikliklerini giderdiklerinde başarımı daha yüksek sistemler elde edilmektedir. Bulanık sistemlere sinir ağı ile öğrenme yeteneği kazandırılabilmektedir. Sinirsel bulanık sistemlerde (SBS, BM bileşenine esneklik, hız ve uyarlanabilirlik gibi özellikler YSA bileşeni sayesinde kaynaştırılmaya çalışılmaktadır. Bu çalışmada, YSA ve BM bileşenlerinin melezlenmesiyle elde edilmiş literatürdeki SBS’lerle ilgili 51 adet çalışma sistematik olarak incelenmiştir. Yapılan literatür incelenmesinde Uyarlanabilir Sinirsel Bulanık Çıkarım Sistemini (Adaptive Neural Fuzzy Inference System, ANFIS temel alan yaklaşımların diğer SBS’lere göre daha fazla sayıda çalışmada kullanıldığı görülmektedir. Literatürdeki örnek çalışmalar üzerinden değerlendirme yapılmıştır. Abstract. Hybridization of artificial neural network (ANN and fuzzy logic (FL has drawn the attention of researchers in various studies of scientific and engineering field due to the requirements of adaptive intelligent system for solving of real-world problems. Genetic algorithm (GA has been frequently used to optimize the problem solutions. ANN imitate the work principles of human brain, and realize the learning via using

  5. NCBI nr-aa BLAST: CBRC-OLAT-05-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-05-0026 gb|AAF63529.1|AF247118_1 putative blue sensitive opsin SWS-2B [Metriaclima...b|AAK06661.1|AF317674_1 putative blue sensitive opsin SWS-2B [Metriaclima zebra] AAF63529.1 1e-176 82% ...

  6. NCBI nr-aa BLAST: CBRC-TNIG-11-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-11-0028 gb|AAF63529.1|AF247118_1 putative blue sensitive opsin SWS-2B [Metriaclima...b|AAK06661.1|AF317674_1 putative blue sensitive opsin SWS-2B [Metriaclima zebra] AAF63529.1 1e-166 78% ...

  7. NCBI nr-aa BLAST: CBRC-FRUB-02-0289 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0289 gb|AAF63529.1|AF247118_1 putative blue sensitive opsin SWS-2B [Metriaclima...b|AAK06661.1|AF317674_1 putative blue sensitive opsin SWS-2B [Metriaclima zebra] AAF63529.1 1e-168 79% ...

  8. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  9. NCBI nr-aa BLAST: CBRC-TNIG-09-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-09-0017 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 86% ...

  10. NCBI nr-aa BLAST: CBRC-OLAT-07-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-07-0020 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 86% ...

  11. NCBI nr-aa BLAST: CBRC-DRER-26-0215 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-26-0215 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 87% ...

  12. NCBI nr-aa BLAST: CBRC-DRER-06-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-06-0073 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 87% ...

  13. NCBI nr-aa BLAST: CBRC-FRUB-02-0328 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0328 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 86% ...

  14. NCBI nr-aa BLAST: CBRC-GACU-17-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-17-0012 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 81% ...

  15. NCBI nr-aa BLAST: CBRC-XTRO-01-2371 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2371 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 93% ...

  16. NCBI nr-aa BLAST: CBRC-OLAT-26-0139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0139 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 82% ...

  17. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  18. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003037 gi|16263035 >1nyoA 11 162 8 158 4e-30 ... ref|NP_435828.1| Nex18 Symbiotica...lly induced conserved protein [Sinorhizobium ... meliloti 1021] gb|AAK65240.1| Nex18 Symbiotically ... ... ... induced conserved protein [Sinorhizobium meliloti 1021] ... pir||F95334 Nex18 Symbiotically

  19. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  20. ORF Alignment: NC_003098 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003098 gi|15902282 >1in4A 3 311 20 328 5e-98 ... ref|NP_357832.1| Branch migration of Holliday structures... [Streptococcus pneumoniae ... R6] gb|AAK99042.1| Branch migration of Holliday ... structures... [Streptococcus pneumoniae R6] pir||F97901 ... branch migration of Holliday structures

  1. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  2. Ecospirituality in the Age of Technological Overkill: Body-Time Reclamation in the Fiction of Alan Lightman and Don DeLillo

    Directory of Open Access Journals (Sweden)

    Jonathan Butler

    2011-01-01

    Full Text Available In exploring the link between ecospirituality and the hard sciences, I argue that theformer provides a much-needed complement to the latter. The fragmentation ofdisciplinary pursuits fostered by the Enlightenment and by the continued progress ofunquestioned technological advance as an end in itself finds its ultimate expression inour current disconnection from the natural world, from each other, and even fromourselves. As a corrective to such disconnection, ecospiritual impulses emerge in anattempt to unify a discombobulated subject, a self so fragmented by the multiplenarratival requirements of a communication-obsessed age (where we can be reached bycell phone, regular phone, multiple email addresses, Facebook, and other social mediathat the "contemplative" facet of being human within the rhythms of the natural worldis all but obscured-indeed, is hardly given the requisite environment in which tofunction. Against this over-reliance on technology, on where the hard sciences have ledus, ecospirituality emerges as a balm for the terrorized human spirit. Don DeLillo'srecent novel Point Omega documents this poignantly. His narrator speaks of the "usualterror" of cities with their "endless counting down," with people constantly checkingtheir watches and other time-keeping devices. DeLillo's protagonist moves to the desertwhere "geological time" becomes the paradigm through which a restorative calm isgenerated. Alan Lightman's fiction proves even more relentless in its depiction of thedissociation engendered by an over-reliance on technology. Lightman's protagonist inThe Diagnosis is an information trader who suffers a breakdown and is only restored towell-being through a re-acquaintance with his own natural body rhythms along withthose of the natural world. Many of the characters in the short-story collectionEinstein's Dreams also find that a connection to nature counteracts the senselesscompetition of a consumer-driven, technologically

  3. Interactions between the Hepatitis C Virus Nonstructural 2 Protein and Host Adaptor Proteins 1 and 4 Orchestrate Virus Release

    Directory of Open Access Journals (Sweden)

    Fei Xiao

    2018-03-01

    Full Text Available Hepatitis C virus (HCV spreads via secreted cell-free particles or direct cell-to-cell transmission. Yet, virus-host determinants governing differential intracellular trafficking of cell-free- and cell-to-cell-transmitted virus remain unknown. The host adaptor proteins (APs AP-1A, AP-1B, and AP-4 traffic in post-Golgi compartments, and the latter two are implicated in basolateral sorting. We reported that AP-1A mediates HCV trafficking during release, whereas the endocytic adaptor AP-2 mediates entry and assembly. We demonstrated that the host kinases AAK1 and GAK regulate HCV infection by controlling these clathrin-associated APs. Here, we sought to define the roles of AP-4, a clathrin-independent adaptor; AP-1A; and AP-1B in HCV infection. We screened for interactions between HCV proteins and the μ subunits of AP-1A, AP-1B, and AP-4 by mammalian cell-based protein fragment complementation assays. The nonstructural 2 (NS2 protein emerged as an interactor of these adaptors in this screening and by coimmunoprecipitations in HCV-infected cells. Two previously unrecognized dileucine-based motifs in the NS2 C terminus mediated AP binding and HCV release. Infectivity and coculture assays demonstrated that while all three adaptors mediate HCV release and cell-free spread, AP-1B and AP-4, but not AP-1A, mediate cell-to-cell spread. Live-cell imaging revealed HCV cotrafficking with AP-1A, AP-1B, and AP-4 and that AP-4 mediates HCV trafficking in a post-Golgi compartment. Lastly, HCV cell-to-cell spread was regulated by AAK1 and GAK and thus susceptible to treatment with AAK1 and GAK inhibitors. These data provide a mechanistic understanding of HCV trafficking in distinct release pathways and reveal a requirement for APs in cell-to-cell viral spread.

  4. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  5. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  6. Finantskrahh kasvatas miljonilaenuvõtja kuumakset 1000 krooni võrra / Hindrek Riikoja

    Index Scriptorium Estoniae

    Riikoja, Hindrek

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 1. okt. 2008, lk. 6-7. Uut hoogu saanud rahvusvaheline börsikriis tõstab laenumakseid. Vt. samas: Ameerika Ühendriikide kinnisvarakriis võib võtta ka eestlaselt lõpuks töö ja kodu; Kuidas on reageerinud rahaturgude kokkukukkumisele Euroopa riigid; Kommenteerivad: Toomas Aak ja Meelis Milder

  7. ORF Alignment: NC_003028 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003028 gi|15901711 >1g5aA 110 627 26 540 4e-96 ... ref|NP_346315.1| dextran glucos...idase DexS, putative [Streptococcus pneumoniae TIGR4] ... gb|AAK75955.1| dextran glucosidase DexS, pu...tative ... [Streptococcus pneumoniae TIGR4] pir||B95220 dextran ... glucosidase DexS, probable

  8. NCBI nr-aa BLAST: CBRC-CJAC-01-0074 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0074 ref|NP_336427.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] ref|YP_001287884.1| PPE family protein [Mycobacterium tuberculosis F11] gb|AAK46241.1| PPE family protein [Mycobacterium tube...rculosis CDC1551] gb|ABR06282.1| PPE family protein [Mycobacterium tuberculosis F11] NP_336427.1 0.001 26% ...

  9. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1a320 1 85 35 119 3e-17 ... gb|AAK39926.1| plastidal 30S ribosomal prot...ein S15 [Guillardia theta] pir||G90099 ... plastidal 30S ribosomal protein S15 [imported] - ... ... ... Guillardia theta nucleomorph ref|NP_113370.1| plastidal ... 30S ribosomal protein S15 [Guillardia t

  10. NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0164 ref|NP_001258.2| chondroadherin precursor [Homo sapiens] sp|O15335|CHAD_HUMAN Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAK51556.1|AF371328_1 chondroadher...in [Homo sapiens] gb|AAH36360.1| Chondroadherin [Homo sapiens] gb|AAH73974.1| Chondroadherin [Homo sapiens] gb|EAW94613.1| chondroad

  11. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cetylmuramate-alanine ligase MurC [Mycobacterium ... tuberculosis H37Rv] ref|NP_855825.1| ... ...UDP-N-acetylmuramate-alanine ligase MurC [Mycobacterium ... bovis AF2122/97] gb|AAK46495.1| ... ...ate-alanine ... ligase MurC [Mycobacterium tuberculosis H37Rv] ... ...emb|CAD97029.1| UDP-N-acetylmuramate-alanine ligase MurC ... [Mycobacterium bovis AF2122/97] ...

  12. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cetylmuramate-alanine ligase MurC [Mycobacterium ... tuberculosis H37Rv] ref|NP_855825.1| ... ...UDP-N-acetylmuramate-alanine ligase MurC [Mycobacterium ... bovis AF2122/97] gb|AAK46495.1| ... ...ate-alanine ... ligase MurC [Mycobacterium tuberculosis H37Rv] ... ...emb|CAD97029.1| UDP-N-acetylmuramate-alanine ligase MurC ... [Mycobacterium bovis AF2122/97] ...

  13. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cetylmuramate-alanine ligase MurC [Mycobacterium ... tuberculosis H37Rv] ref|NP_855825.1| ... ...UDP-N-acetylmuramate-alanine ligase MurC [Mycobacterium ... bovis AF2122/97] gb|AAK46495.1| ... ...ate-alanine ... ligase MurC [Mycobacterium tuberculosis H37Rv] ... ...emb|CAD97029.1| UDP-N-acetylmuramate-alanine ligase MurC ... [Mycobacterium bovis AF2122/97] ...

  14. 78 FR 65589 - Leasing of Osage Reservation Lands for Oil and Gas Mining

    Science.gov (United States)

    2013-11-01

    ... DEPARTMENT OF THE INTERIOR Bureau of Indian Affairs 25 CFR Part 226 [BIA-2013-0003; 134/A0A511010/AAK1001000] RIN 1076-AF17 Leasing of Osage Reservation Lands for Oil and Gas Mining AGENCY: Bureau of Indian... oil and gas mining on reservation land of the Osage Nation. The public comment period for that rule...

  15. Alan R. Barton Nuclear Plant Units 1, 2, 3 and 4: Draft environmental statement (Docket Nos. 50-524, 525, 526 and 527)

    International Nuclear Information System (INIS)

    1975-04-01

    The proposed action is the issuance of construction permits to the Alabama Power Company for the construction of the Alan R. Barton Nuclear Plant Units 1, 2, 3 and 4. The Barton Plant, located on the Coosa River in Chilton and Elmore Counties, Alabama, will employ boiling water reactors to produce up to 3579 megawatts thermal (MWt) from each unit. A steam turbine-generator will use the heat to provide 1159 MWe (net) of electrical power capacity. A stretch power level of 3758 MWt (1209 MWe) is anticipated from design data and is considered in the assessments contained in this statement. The exhaust steam will be cooled in a closed cycle mode by mechanical cooling towers with water from the Coosa River. Construction of the plant and adjacent facilities will disturb an area of about 1025 acres. the land presently consists of forest land and some cropland. The impact is considered minor. About 18,460 acres will be required for the transmission line routes. The land presently consists of forest, pasture and cropland. No unique land usage is involved in the routes selected. The impacts are considered minor. Station construction will involve some community impacts. Highway congestion, due to increased traffic associated with construction and commuting activities, will have a moderate adverse impact on the local area. The number of construction workers moving into the area is expected to place a strain on the local school systems, housing and community services. Noise, dust, and odor during construction will have a minor adverse effect upon nearby residents in the sparsely populated area. 125 refs., 25 figs., 56 tabs

  16. Chinese-English Rocketry Dictionary. Volume 1

    Science.gov (United States)

    1977-10-01

    diarnno 9n electrico arc; arc 19 disnhu dianhus inqAAk arc ignition 20 dia22tdiaya tj~1fll~arc voltage 21 diano fagdia 9n11i arcf discharge; arc-over 22...9 A electrical zero 01 dienlingwei ziou bienyaqi f3j Q f .A electrical-zero auto - 02 Sransforer dienliu f1 • electric current; current 03 dianllu

  17. Okul Öncesi Öğretmenliği Lisans Programında Yer Alan Drama Dersi Kapsamında Yapılan Uygulamaların Öğretmen Adaylarının Sosyal Zekâ Alanlarına Etkisi

    OpenAIRE

    Ünver, Naim; Semiz, Selahattin

    2016-01-01

    Eğitim fakülteleri lisans programları, değişen dünya ve toplumların ihtiyaçlarına göreMEB’in amaçları da dikkate alınarak zaman zaman değişmekte ve geliştirilmektedir. Fakatözellikle bazı dersler ve içerik, bütün programlarda yer alması gereken, zamandan veihtiyaçlardan etkilenmeyen, doğrudan ve her zaman çocukların temel gelişimlerini destekleyenözellikler taşıdığı için, bütün programlarda yer almaktadır. Okul öncesi eğitimi lisansprogramındaki dersler içerisinde yer alan Drama dersi de çocu...

  18. Artificial Light at Night Reduces Daily Energy Expenditure in Breeding Great Tits (Parus major

    Directory of Open Access Journals (Sweden)

    Anouk A. M. H. Welbers

    2017-05-01

    Full Text Available The ecological impact of artificial light at night (ALAN is an increasingly recognized process that accompanies expanding urbanization. Yet, we have limited knowledge on the impact of ALAN on wild species, and on the potential to mitigate any negative effects by using different light sources and colors. In birds, effects of ALAN on activity levels are reported for several species and, hence, their daily energy expenditure (DEE may be affected. DEE is a potent mediator of life-history trade-offs and fitness and thus an important aspect to consider when examining the potential long-term ecological effects of ALAN. Previous work has suggested that birds exposed to ALAN show higher levels of provisioning and nocturnal activity, suggesting that white ALAN increases DEE. Other factors regulating DEE, such as provisioning behavior and food availability, might also respond to ALAN and thus indirectly affect DEE. We tested the hypothesis that ALAN increases DEE using an experimental setup where four previously unlit transects were illuminated with either white, green, or red LED light, or left dark as a control treatment. This setup was replicated in eight locations across the Netherlands. We measured DEE of our focal species, the great tit (Parus major, using a novel doubly labeled water technique that uses breath rather than blood samples. Contrary to our expectations, birds feeding their offspring under white and green ALAN showed lower DEE compared to birds in the control dark treatment. Differences in chick provisioning activity did not explain this result, as neither visit rates nor daily activity timing was affected by light treatment. However, food availability under white and green light was much higher compared to red light and the dark control. This difference strongly suggests that the lower DEE under white and green ALAN sites is a consequence of higher food availability in these treatments. This result shows that there can be positive

  19. Disruptive effects of light pollution on sleep in free-living birds: Season and/or light intensity-dependent?

    Science.gov (United States)

    Raap, Thomas; Sun, Jiachen; Pinxten, Rianne; Eens, Marcel

    2017-11-01

    Light pollution or artificial light at night (ALAN) is an increasing anthropogenic environmental pollutant posing an important potential threat for wildlife. Evidence of its effects on animal physiology and behaviour is accumulating. However, in order to effectively mitigate light pollution it is important to determine which factors contribute to the severity of effects of ALAN. In this experimental study we explored whether there are seasonal-dependent effects of ALAN on sleep in free-living great tits (Parus major), an important model species. Additionally, we looked at whether light intensity determined the severity of effects of ALAN on sleep. We therefore exposed animals to artificial light inside the nest box (3lx) in December (winter) and February (pre-breeding season). Results from February were compared with the results from a previous study in February, using a lower light intensity (1.6lx). We found little evidence for a season-dependent response. Effects of ALAN hardly differed between high and low light intensity. ALAN disrupted sleep with as main effect a decrease in sleep duration (≈-40min) as animals woke up earlier (≈-24min). However, compared to a natural dark situation sleep onset was delayed by high but not by low light intensity of ALAN. Our study underlines earlier found disruptive effects of ALAN on sleep of free-living animals. While we found no conclusive evidence for seasonal or light intensity-dependent effects of ALAN, additional experimental work using lower light intensities might show such differences. Examining potential management options is crucial in mitigating disruptive effects of light pollution, which will be an important focus for future studies. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. Seasonal associations with urban light pollution for nocturnally migrating bird populations.

    Science.gov (United States)

    La Sorte, Frank A; Fink, Daniel; Buler, Jeffrey J; Farnsworth, Andrew; Cabrera-Cruz, Sergio A

    2017-11-01

    The spatial extent and intensity of artificial light at night (ALAN) has increased worldwide through the growth of urban environments. There is evidence that nocturnally migrating birds are attracted to ALAN, and there is evidence that nocturnally migrating bird populations are more likely to occur in urban areas during migration, especially in the autumn. Here, we test if urban sources of ALAN are responsible, at least in part, for these observed urban associations. We use weekly estimates of diurnal occurrence and relative abundance for 40 nocturnally migrating bird species that breed in forested environments in North America to assess how associations with distance to urban areas and ALAN are defined across the annual cycle. Migratory bird populations presented stronger than expected associations with shorter distances to urban areas during migration, and stronger than expected association with higher levels of ALAN outside and especially within urban areas during migration. These patterns were more pronounced during autumn migration, especially within urban areas. Outside of the two migration periods, migratory bird populations presented stronger than expected associations with longer distances to urban areas, especially during the nonbreeding season, and weaker than expected associations with the highest levels of ALAN outside and especially within urban areas. These findings suggest that ALAN is associated with higher levels of diurnal abundance along the boundaries and within the interior of urban areas during migration, especially in the autumn when juveniles are undertaking their first migration journey. These findings support the conclusion that urban sources of ALAN can broadly effect migratory behavior, emphasizing the need to better understand the implications of ALAN for migratory bird populations. © 2017 John Wiley & Sons Ltd.

  1. Effects of artificial light at night on human health: A literature review of observational and experimental studies applied to exposure assessment.

    Science.gov (United States)

    Cho, YongMin; Ryu, Seung-Hun; Lee, Byeo Ri; Kim, Kyung Hee; Lee, Eunil; Choi, Jaewook

    2015-01-01

    It has frequently been reported that exposure to artificial light at night (ALAN) may cause negative health effects, such as breast cancer, circadian phase disruption and sleep disorders. Here, we reviewed the literature assessing the effects of human exposure to ALAN in order to list the health effects of various aspects of ALAN. Several electronic databases were searched for articles, published through August 2014, related to assessing the effects of exposure to ALAN on human health; these also included the details of experiments on such exposure. A total of 85 articles were included in the review. Several observational studies showed that outdoor ALAN levels are a risk factor for breast cancer and reported that indoor light intensity and individual lighting habits were relevant to this risk. Exposure to artificial bright light during the nighttime suppresses melatonin secretion, increases sleep onset latency (SOL) and increases alertness. Circadian misalignment caused by chronic ALAN exposure may have negative effects on the psychological, cardiovascular and/or metabolic functions. ALAN also causes circadian phase disruption, which increases with longer duration of exposure and with exposure later in the evening. It has also been reported that shorter wavelengths of light preferentially disturb melatonin secretion and cause circadian phase shifts, even if the light is not bright. This literature review may be helpful to understand the health effects of ALAN exposure and suggests that it is necessary to consider various characteristics of artificial light, beyond mere intensity.

  2. Ortaöğretim 9. Sınıf Öğrencilerinin Yazılı Anlatım Alan Bilgisi Başarı Düzeyleri Üzerine Bir Araştırma A Research On 9th Grade Of Secondary Education Students ' Achievement Levels Of Field Knowledge Of Writing Expression

    Directory of Open Access Journals (Sweden)

    Hasan BAĞCI

    2012-12-01

    ğretimin son aşamasına kadar bu becerilerinin geliştirildiği süreci içine alan bir dönemdir. Yazma becerisi bilgi, birikim ve dili etkili kullanmayı gerektirdiğinden bu sürecin okuma, dinleme/izleme, konuşma ve dil bilgisi etkinlikleriyle de desteklenmesi gerekir.Öğrencilerin yazılı anlatım metinlerini inceleyen araştırmacılar, öğrenci metinlerinde birçok eksikliğin olduğunu, öğrencilerin yazma becerilerinin beklenen yeterliliğe ulaşamadığını ifade etmektedir. Bu becerideki eksikliklerin bilgi aşamasından bilgilerin beceriye dönüştürülememesine kadar geniş bir çerçeveye dağıldığı düşünülmektedir. Bu yüzden bu çalışmanın amacı, ortaöğretim 9. sınıf öğrencilerinin Dil ve Anlatım Ders Programı’nda da ifade edilen yazma becerisine yönelik kazanım cümleleri doğrultusunda yazılı anlatım alan bilgisi düzeylerini belirlemektir. Araştırmada ayrıca öğrencilerin yazılı anlatım alan bilgisi yeterlilik düzeylerinin başta cinsiyet olmak üzere diğer değişkenlere göre de değişip değişmediği tespit edilmiştir.Araştırmadan elde edilen bulgulara göre, ortaöğretim 9. sınıf öğrencilerin Yazılı Anlatım Alan Bilgisi Testi genel başarı puanları ortalamaları 100 tam puan üzerinden 59 puanla sınırlı kalmıştır. Yine 9. sınıf öğrencilerinin yazılı anlatım alan bilgisi başarı düzeyleri, cinsiyet değişkenine göre anlamlı bir farklılık göstermezken öğrencilerin akademik başarına, serbest yazma etkinliği yapmalarına, günlük tutmalarına, Dil ve Anlatım dersini sevmeleri ile yazma etkinliklerinden memnun olmalarına göre ise değişmektedir. Araştırmanın sonunda elde edilen sonuçlara bağlı kalınarak Dil ve Anlatım derslerini veren öğretmenlere bazı önerilerde bulunulmuştur.

  3. The March 2004 Riots in Kosovo: A Failure of the International Community

    Science.gov (United States)

    2007-12-14

    becoming very tense. Even one of the most moderate and statesmanlike figures in the Kosovo Albanian political spectrum, Prime Minister Bajram Rexhepi ...that obstructed progress on privatization. Prime Minster Rexhepi gave one of the most measured responses to what he saw as not only economic impact...position in February 2006. Prime Ministers of Kosovo373 1. Bajram Rexhepi , PDK, March 2002 to December 2004 2. Ramush Haradinaj, AAK, December 2004

  4. NCBI nr-aa BLAST: CBRC-PTRO-04-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-04-0004 sp|Q8VBS7|VN1A6_MOUSE Vomeronasal type-1 receptor A6 (Vomeronasal... type-1 receptor A3) (Vomeronasal type-1 receptor A1) (Vomeronasal type-1 receptor A10) dbj|BAB79209.1| vomeronasa...l receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasal receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasa

  5. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15890664 >1n8kA 9 361 1 333 5e-31 ... ref|NP_534796.1| xylitol dehydroge...nase [Agrobacterium tumefaciens str. C58] ... gb|AAL45112.1| xylitol dehydrogenase [Agrobacterium ... ... ... tumefaciens str. C58] gb|AAK89121.1| AGR_L_1091p ... [Agrobacterium tumefaciens str. C58] pir||G98199 xylitol... ... (strain C58, Cereon) pir||AB3087 xylitol dehydrogenase ... Atu4318 [imported] - Agrobacter

  6. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17938007 >1n8kA 9 361 1 333 5e-31 ... ref|NP_534796.1| xylitol dehydroge...nase [Agrobacterium tumefaciens str. C58] ... gb|AAL45112.1| xylitol dehydrogenase [Agrobacterium ... ... ... tumefaciens str. C58] gb|AAK89121.1| AGR_L_1091p ... [Agrobacterium tumefaciens str. C58] pir||G98199 xylitol... ... (strain C58, Cereon) pir||AB3087 xylitol dehydrogenase ... Atu4318 [imported] - Agrobacter

  7. EST Table: FS737333 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS737333 E_FL_bmmt_08I09_R_0 10/09/28 68 %/182 aa ref|NP_059479.1| ATP synthase F0 ...subunit 6 [Bombyx mori] gb|AAF73768.1|AF149768_12 ATPase 6 [Bombyx mori] gb|AAK85722.1| ATPase subunit 6 [Bo....1| ATP synthase F0 subunit 6 [Bombyx mori] gb|ADE18460.1| ATP synthase F0 subunit 6 [Bombyx mori] gb|ADE18473

  8. Influence of light intensity and spectral composition of artificial light at night on melatonin rhythm and mRNA expression of gonadotropins in roach Rutilus rutilus.

    Science.gov (United States)

    Brüning, Anika; Hölker, Franz; Franke, Steffen; Kleiner, Wibke; Kloas, Werner

    2018-02-01

    In this study we investigated the influence of artificial light at night (ALAN) of different intensities (0, 1, 10, 100 lx) and different colours (blue, green, red) on the daily melatonin rhythm and mRNA expression of gonadotropins in roach Rutilus rutilus, a ubiquitous cyprinid, which occur in standing and moderately flowing freshwater habitats of central Europe. Melatonin concentrations were significantly lowered under nocturnal white light already at 1 lx. Low intensity blue, green and red ALAN lowered the melatonin levels significantly in comparison to a dark control. We conclude that ALAN can disturb melatonin rhythms in roach at very low intensities and at different wavelengths and thus light pollution in urban waters has the potential to impact biological rhythms in fish. However, mRNA expression of gonadotropins was not affected by ALAN during the period of the experiments. Thus, suspected implications of ALAN on reproduction of roach could not be substantiated.

  9. Coastal urban lighting has ecological consequences for multiple trophic levels under the sea.

    Science.gov (United States)

    Bolton, D; Mayer-Pinto, M; Clark, G F; Dafforn, K A; Brassil, W A; Becker, A; Johnston, E L

    2017-01-15

    Urban land and seascapes are increasingly exposed to artificial lighting at night (ALAN), which is a significant source of light pollution. A broad range of ecological effects are associated with ALAN, but the changes to ecological processes remain largely unstudied. Predation is a key ecological process that structures assemblages and responds to natural cycles of light and dark. We investigated the effect of ALAN on fish predatory behaviour, and sessile invertebrate prey assemblages. Over 21days fish and sessile assemblages were exposed to 3 light treatments (Day, Night and ALAN). An array of LED spotlights was installed under a wharf to create the ALAN treatments. We used GoPro cameras to film during the day and ALAN treatments, and a Dual frequency IDentification SONar (DIDSON) to film during the night treatments. Fish were most abundant during unlit nights, but were also relatively sedentary. Predatory behaviour was greatest during the day and under ALAN than at night, suggesting that fish are using structures for non-feeding purposes (e.g. shelter) at night, but artificial light dramatically increases their predatory behaviour. Altered predator behaviour corresponded with structural changes to sessile prey assemblages among the experimental lighting treatments. We demonstrate the direct effects of artificial lighting on fish behaviour and the concomitant indirect effects on sessile assemblage structure. Current and future projected use of artificial lights has the potential to significantly affect predator-prey interactions in marine systems by altering habitat use for both predators and prey. However, developments in lighting technology are a promising avenue for mitigation. This is among the first empirical evidence from the marine system on how ALAN can directly alter predation, a fundamental ecosystem process, and have indirect trophic consequences. Copyright © 2016 Elsevier B.V. All rights reserved.

  10. Kinetics of thermal decomposition of aluminium hydride: I-non-isothermal decomposition under vacuum and in inert atmosphere (argon)

    International Nuclear Information System (INIS)

    Ismail, I.M.K.; Hawkins, T.

    2005-01-01

    Recently, interest in aluminium hydride (alane) as a rocket propulsion ingredient has been renewed due to improvements in its manufacturing process and an increase in thermal stability. When alane is added to solid propellant formulations, rocket performance is enhanced and the specific impulse increases. Preliminary work was performed at AFRL on the characterization and evaluation of two alane samples. Decomposition kinetics were determined from gravimetric TGA data and volumetric vacuum thermal stability (VTS) results. Chemical analysis showed the samples had 88.30% (by weight) aluminium and 9.96% hydrogen. The average density, as measured by helium pycnometery, was 1.486 g/cc. Scanning electron microscopy showed that the particles were mostly composed of sharp edged crystallographic polyhedral such as simple cubes, cubic octahedrons and hexagonal prisms. Thermogravimetric analysis was utilized to investigate the decomposition kinetics of alane in argon atmosphere and to shed light on the mechanism of alane decomposition. Two kinetic models were successfully developed and used to propose a mechanism for the complete decomposition of alane and to predict its shelf-life during storage. Alane decomposes in two steps. The slowest (rate-determining) step is solely controlled by solid state nucleation of aluminium crystals; the fastest step is due to growth of the crystals. Thus, during decomposition, hydrogen gas is liberated and the initial polyhedral AlH 3 crystals yield a final mix of amorphous aluminium and aluminium crystals. After establishing the kinetic model, prediction calculations indicated that alane can be stored in inert atmosphere at temperatures below 10 deg. C for long periods of time (e.g., 15 years) without significant decomposition. After 15 years of storage, the kinetic model predicts ∼0.1% decomposition, but storage at higher temperatures (e.g. 30 deg. C) is not recommended

  11. DİVANÜ LÜGATİ’T- TÜRK’TE YER ALAN TÜRK HALK KÜLTÜRÜ ÖGELERİNİN İLKÖĞRETİM 4. VE 5. SINIF SOSYAL BİLGİLER PROGRAMLARINDA İŞLENİŞİ

    Directory of Open Access Journals (Sweden)

    Namık ÇENCEN

    2016-05-01

    Full Text Available 1074 yılında Kaşgarlı Mahmut tarafından kaleme alınan Divan-ı Lûgati't Türk, XI. yüzyıl Türk dünyasının sağlam bir dil ve kültür mirasıdır. Kaşgarlı Mahmut bu değerli eseri ile Türk milletinin kalbinde olduğu kadar Türk dil ve kültür tarihine de adını altın harflerle yazdırmaya hak kazanmış üstün değerlerimizden biridir. Türk kültür mirasının korunmasında ve yaşatılmasında ders programları ve kitaplarının önemli işlevleri bulunmaktadır.Bu makalede Divanü Lügati’t Türk’te yer alan yüksek Türk kültürünün öğeleri (yemek adetleri, doğum, düğün, ölüm adetlerinden, oyun ve eğlencesine vb… ele alınarak bunların “İlköğretim 4. ve 5. Sınıf Sosyal Bilgiler Programlarında işlenişi ve bu kültür öğeleriyle ilgili genel amaçlar, kazanımlar vurgulanarak, programdaki işlenişi ve oranı üzerinde durulmaktadır. Bu çalışma nitel bir araştırma olup veriler doküman incelemesi kullanılarak toplanmıştır. 4. sınıf Sosyal Bilgiler öğretim programında yer alan sekiz ünite içerisinde Divanü Lügati’t Türk’te yer alan Türk Kültür öğeleri yalnızca iki ünite içerisinde ele alınmaktadır. 5.sınıf Sosyal Bilgiler öğretim programında, sekiz ünite içerisinde Divanü Lügati’t Türk’te yer alan Türk Kültür öğeleri yalnızca bir ünite içerisinde ele alınmaktadır. Kültür aktarımına yardımcı olduğu düşünülen; öğrencileri kültürel değerler bakımından besleyici ve duyarlılığı yüksek bireyler olarak yetiştirmeye yönelik bir ders olan Sosyal Bilgiler dersinin öğretim programında Türk halk kültürü öğelerinin daha fazla yer alması gerektiği düşünülmektedir. Anahtar Kelimeler: Sosyal Bilgiler Programı, Divanü Lügati’t Türk, Ders Programı, Değerler,  Kazanımlar TEACHING TURKISH FOLKLOR ELEMENTS FROM DİVANÜ LÜGATİ’T- TURK in 4TH AND 5TH GRADE SOCIAL SCIENCES CURRICULUMAbstract: Divan

  12. Basında Yer Alan Namus Cinayetlerinin Sosyolojik Analizi /A Sociological Analysis of Honor Killings Reported by the Mass Media

    Directory of Open Access Journals (Sweden)

    Ülkü Hayriye İNCİ

    2013-10-01

    Full Text Available Öz Erkek egemen toplumlarda kadına yönelik şiddetin kısmi bir kabul gördüğü bilinmektedir. Kadına yönelik şiddetin özel bir şekli de namus cinayetleridir. Son zamanlarda ulusal medyada kendisine oldukça fazla yer bulan namus cinayetleri, sosyolojik çalışmalarda da kendisine yer bulmaya başlamıştır. Bu çalışma, Türkiye’de son zamanlarda oldukça sık tartışılan namus cinayetlerinin sosyal ve kültürel hayattaki durumunu tartışmaya açmaktadır. Çalışma basında yer alan namus cinayetleri ile sınırlıdır. Çalışmada içerik analizi yöntemi kullanılmıştır. Bu bağlamda, Türkiye’de meydana gelen namus cinayetlerinin yoğun olarak ortaya çıktığı bölgelerdeki sosyal sorunlar, farklı bölgelerdeki sosyal yapının namus cinayetlerini nasıl etkilediği, toplumda nasıl yansıma bulduğu ve özellikle kadınlar tarafından nasıl algılandığı konusu, basına yansıyan haberlerin içerik çözümlemesiyle ortaya konulmaya çalışılmıştır. Abstract Violence against women is somewhat acceptable in societies which dominated by the patriarchal system. One of the aspects of violence against women is honor killings. Nowadays, honor killings take place pretty much in Turkish national media. This article discusses the social and cultural basis of honor killings debated quite often recently. The work is limited to honor killings reported by mass media. In the work the content analysis method was used. In this context, social problems and social structures of different regions of Turkey analyzed to determine the source of problem. Additionally, the place of the honor killings, how they come up, and their effects on women and society have been presented with the content analysis of the news on the media.

  13. Maestro lahkub, edu retsept taskus / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2006-01-01

    USA keskpanga pikaaegse juhi Alan Greenspani tegevusest ja ametist tagasiastumisest. Vt. samas: Kõnekate vihjete suurmeister; Doktorikraad tuli alles keskeas; Alan Greenspani tee pooljumala seisusesse. Verstapostid keskpanga juhina

  14. RASYONEL KARAR ALAN EKONOMİK BİRİMİN RİSK ALTINDA VERDİĞİ KARARLARA DAVRANIŞSAL YAKLAŞIM: KAHNEMAN-TVERSKY BEKLENTİ TEORİSİ PERSPEKTİFİNDEN ELEŞTİREL BİR BAKIŞ

    Directory of Open Access Journals (Sweden)

    Fatih ŞENTÜRK

    2014-08-01

    Full Text Available ÖzetEkonomi literatüründe neo-klasik döneme kadar ekonomi ve psikoloji bilimleri arasındaki bağ göz ardıedilerek, insanın salt rasyonel kararlar alan bir varlık olduğu ifade edilmiştir. Ancak son otuz yıllık dönemdeinsanların, ekonomik kararlar alırken psikolojiye ilişkin çeşitli faktörlerden de etkilendiğini savunan“Davranışsal Yaklaşım”, farklı bir bakış ortaya koymuştur. Bu yaklaşımın öncüleri, D. Kahneman ve A.Tversky belirsizlik ortamında karar alan bireylerin davranışlarını incelemiş ve insanların, riskten kaçınmaeğilimlerinin kazanma isteklerine galip geldiğini ve her zaman rasyonel davranışlar sergileyemedikleriniileri sürmüşlerdir. Yapmış oldukları birçok deneysel çalışma ile kayıpların verdiği acının, kazançların verdiğitatminden iki kat daha fazla olduğunu tespit etmişlerdir. Bu makalede insan psikolojisinin ekonomiktercihlere etkilerine değinilmiş ve özellikle risk altında karar verme konusunda bireyin irrasyonel davranışlargösterdiği çeşitli örnekler ışığında açıklanmaya çalışılmıştır.AbstractIgnoring the connection between the economics and psychological sciences until the neo-classical termin economics literature, it has been stated that human is a creature taking only rational decisions. However,in the last thirty years, a different approach named “Behavioural Approach” that argues that people are influenced also by various factors related with psychology while taking decisions with economy has occured.The pioneers of this approach, D. Kahneman and A. Tversky examined the behaviours of the individualswho make decision in an uncertainty environment and put forward that people’s tendency of avoidingrisks defeats their willing to win and that they cannot always behave rationally. With many experimentalstudies they carried out, they determined that the sadness caused by the losses are two times more than thesatisfaction given by

  15. Long-term dim light during nighttime changes activity patterns and space use in experimental small mammal populations.

    Science.gov (United States)

    Hoffmann, Julia; Palme, Rupert; Eccard, Jana Anja

    2018-07-01

    Artificial light at night (ALAN) is spreading worldwide and thereby is increasingly interfering with natural dark-light cycles. Meanwhile, effects of very low intensities of light pollution on animals have rarely been investigated. We explored the effects of low intensity ALAN over seven months in eight experimental bank vole (Myodes glareolus) populations in large grassland enclosures over winter and early breeding season, using LED garden lamps. Initial populations consisted of eight individuals (32 animals per hectare) in enclosures with or without ALAN. We found that bank voles under ALAN experienced changes in daily activity patterns and space use behavior, measured by automated radiotelemetry. There were no differences in survival and body mass, measured with live trapping, and none in levels of fecal glucocorticoid metabolites. Voles in the ALAN treatment showed higher activity at night during half moon, and had larger day ranges during new moon. Thus, even low levels of light pollution as experienced in remote areas or by sky glow can lead to changes in animal behavior and could have consequences for species interactions. Copyright © 2018 Elsevier Ltd. All rights reserved.

  16. 75 FR 54114 - Procurement List Additions

    Science.gov (United States)

    2010-09-03

    ... the Alan Bible Federal Building and Lloyd George U.S. Courthouse in Las Vegas, NV. In its comments.... Services Service Type/Locations: Janitorial & Grounds Service, Alan Bible Federal Building, 600 Las Vegas...

  17. Influence of artificially induced light pollution on the hormone system of two common fish species, perch and roach, in a rural habitat.

    Science.gov (United States)

    Brüning, Anika; Kloas, Werner; Preuer, Torsten; Hölker, Franz

    2018-01-01

    Almost all life on earth has adapted to natural cycles of light and dark by evolving circadian and circannual rhythms to synchronize behavioural and physiological processes with the environment. Artificial light at night (ALAN) is suspected to interfere with these rhythms. In this study we examined the influence of ALAN on nocturnal melatonin and sex steroid blood concentrations and mRNA expression of gonadotropins in the pituitary of European perch ( Perca fluviatilis ) and roach ( Rutilus rutilus ). In a rural experimental setting, fish were held in net cages in drainage channels experiencing either additional ALAN of ~15 lx at the water surface or natural light conditions at half-moon. No differences in melatonin concentrations between ALAN and natural conditions were detected. However, blood concentration of sex steroids (17β-estradiol; 11-ketotestosterone) as well as mRNA expression of gonadotropins (luteinizing hormone, follicle stimulating hormone) was reduced in both fish species. We conclude that ALAN can disturb biological rhythms in fish in urban waters. However, impacts on melatonin rhythm might have been blurred by individual differences, sampling methods and moonlight. The effect of ALAN on biomarkers of reproduction suggests a photo-labile period around the onset of gonadogenesis, including the experimental period (August). Light pollution therefore has a great potential to influence crucial life history traits with unpredictable outcome for fish population dynamics.

  18. EXAMINATION OF TEXTS AT MEB 6, 7 AND 8. GRADE TURKISH COURSE TEXTBOOKS ACCORDING TO VALUE TRANSMISSION MEB 6, 7 VE 8. SINIF TÜRKÇE DERS KİTAPLARINDA YER ALAN METİNLERİN DEĞER İLETİMİ AÇISINDAN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Esra EKİNCİ ÇELİKPAZU

    2011-06-01

    ürüst bireylerin yetiştirilmesi için etkili bir değer eğitimine ihtiyaç vardır. Okullar, ulusal ve evrensel değerlerin iletimini sağlayarak toplumların devamlılığını sağlayan kurumlardır. Eğitim öğretim sürecinin vazgeçilmez bir parçası olan ders kitaplarının değer iletimi konusunda önemli bir rolü vardır. Öğrenciler, ders kitaplarında yer alan ve ana dilinin her türlü imkânından ve söz varlığı zenginliğinden yararlanılarak oluşturulan edebî eserler yoluyla millî ve evrensel değerleri kazanmaktadırlar. Bu çalışmanın amacı Milli Eğitim Bakanlığı Yayınevine ait İlköğretim 6, 7 ve 8. sınıf Türkçe ders kitaplarında yer alan okuma metinlerinin hangi ulusal ve evrensel değerleri ilettiğini / sezdirdiğini tespit etmek ve iletilen / sezdirilen değerlerin 6, 7 ve 8. sınıf ders kitaplarındaki dağılımını belirlemektir. Çalışmada nitel araştırma yöntemlerinden doküman analizi yöntemi kullanılmıştır. Araştırmanın veri örneklemini, MEB yayınevine ait 6, 7 ve 8. sınıf Türkçe ders kitapları oluşturmaktadır. Ders kitaplarında yer alan okuma metinleri, “Değerler Tespit Formu (DTF”na göre incelenerek hangi ulusal ve evrensel değerlerin metinler aracılığıyla iletildiği tespit edilmeye çalışılmıştır. Yapılan çalışmada MEB 6, 7 ve 8. sınıf Türkçe ders kitaplarında yer alan metinlerin değerlerin iletimini istenen düzeyde gerçekleştirmediği ve 6. sınıfta değer iletiminin daha yoğun olduğu, 7 ve 8. sınıfta ise azaldığı görülmüştür.

  19. Exposure to dim artificial light at night increases REM sleep and awakenings in humans.

    Science.gov (United States)

    Cho, Chul-Hyun; Lee, Heon-Jeong; Yoon, Ho-Kyoung; Kang, Seung-Gul; Bok, Ki-Nam; Jung, Ki-Young; Kim, Leen; Lee, Eun-Il

    2016-01-01

    Exposure to artificial light at night (ALAN) has become increasing common, especially in developed countries. We investigated the effect of dALAN exposure during sleep in healthy young male subjects. A total of 30 healthy young male volunteers from 21 to 29 years old were recruited for the study. They were randomly divided into two groups depending on light intensity (Group A: 5 lux and Group B: 10 lux). After a quality control process, 23 healthy subjects were included in the study (Group A: 11 subjects, Group B: 12 subjects). Subjects underwent an NPSG session with no light (Night 1) followed by an NPSG session randomly assigned to two different dim light conditions (5 or 10 lux, dom λ: 501.4 nm) for a whole night (Night 2). We found significant sleep structural differences between Nights 1 and 2, but no difference between Groups A and B. Exposure to dALAN during sleep was significantly associated with increased wake time after sleep onset (WASO; F = 7.273, p = 0.014), increased Stage N1 (F = 4.524, p = 0.045), decreased Stage N2 (F = 9.49, p = 0.006), increased Stage R (F = 6.698, p = 0.017) and non-significantly decreased REM density (F = 4.102, p = 0.056). We found that dALAN during sleep affects sleep structure. Exposure to dALAN during sleep increases the frequency of arousals, amount of shallow sleep and amount of REM sleep. This suggests adverse effects of dALAN during sleep on sleep quality and suggests the need to avoid exposure to dALAN during sleep.

  20. Tropikal Metilsalisilat-Mentol Uygulamasının Rat Deri Flebi Yaşayabilirliği Üzerine Etkisi

    OpenAIRE

    Yenidünya, Mehmet Oğuz; Sevin, Kutlu; Ketene, Mehmet T.; Yormuk, Erdem

    1993-01-01

    Ratlarda hazırlanan random paternli pannikulus karnozusu içeren deri fleplerinde topikal uygulanan metilsalisilat-mentol'ün flep yaşayabilen alanı üzerindeki etkisi araştırıldı. Flep yaşayabilen alan ölçümleri milimetrik kağıt ile yapıldı. Sonuç olarak topikal metilsalisilat-mentol'ün random paternlirat deri fleplerinde yaşayabilen alanı artırdığı saptandı.

  1. A Behavioral Test of Accepting Benefits that Cost Others: Associations with Conduct Problems and Callous-Unemotionality

    Science.gov (United States)

    Sakai, Joseph T.; Dalwani, Manish S.; Gelhorn, Heather L.; Mikulich-Gilbertson, Susan K.; Crowley, Thomas J.

    2012-01-01

    Background Youth with conduct problems (CP) often make decisions which value self-interest over the interests of others. Self-benefiting behavior despite loss to others is especially common among youth with CP and callous-unemotional traits (CU). Such behavioral tendencies are generally measured using self- or observer-report. We are unaware of attempts to measure this tendency with a behavioral paradigm. Methods/Principal Findings In our AlAn's (altruism-antisocial) game a computer program presents subjects with a series of offers in which they will receive money but a planned actual charity donation will be reduced; subjects decide to accept or reject each offer. We tested (1) whether adolescent patients with CP (n = 20) compared with adolescent controls (n = 19) differed on AlAn's game outcomes, (2) whether youths with CP and CU differed significantly from controls without CP or CU, and (3) whether AlAn's game outcomes correlated significantly with CP and separately, CU severity. Patients with CP and CU compared with controls without these problems took significantly more money for themselves and left significantly less money in the charity donation; AlAn's game outcomes were significantly correlated with CU, but not CP. Conclusions/Significance In the AlAn's game adolescents with conduct problems and CU traits, compared with controls without CP/CU, are disposed to benefit themselves while costing others even in a novel situation, devoid of peer influences, where anonymity is assured, reciprocity or retribution are impossible, intoxication is absent and when the “other” to be harmed is considered beneficent. AlAn's game outcomes are associated with measures of CU. Results suggest that the AlAn's game provides an objective means of capturing information about CU traits. The AlAn's game, which was designed for future use in the MRI environment, may be used in studies attempting to identify the neural correlates of self-benefiting decision-making. PMID

  2. Kilpailija-analyysi ICT-alan myynninulkoistusyritykselle

    OpenAIRE

    Pöyhiä, Sami

    2017-01-01

    Tämä opinnäytetyö on toiminnallinen työ kilpailija-analyysin luomisesta. Työ toimii oppaana kilpailija-analyysin luomiseen ja sisältää huomioita, joita kannattaa pitää mielessään kilpailija-analyysin tuottamisessa. Tämän opinnäytetyön pohjalta on luotu kilpailija-analyysiprodukti opinnäytetyön toimeksiantajalle. Toiminnallisen produktin tehtävänantona oli selvittää kilpailutilanne ICT-alalla toimivalle myynninulkoistusyritykselle, selvittää suurimmat toimijat toimialalla, saada tietoa palvelu...

  3. Meditsiinidoktor Lea Pehme / Alan Altraja

    Index Scriptorium Estoniae

    Altraja, Alan, 1965-

    2008-01-01

    7. sept. 2007 kaitses Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tuberkuloosi epidemioloogiline olukord Eestis 1991-2003 rõhuasetusega kopsuvälisele tuberkuloosile ja kopsutuberkuloosi diagnoosimise viivitust mõjutavatele teguritele" Lea Pehme

  4. Alan Greenspan, the confidence strategy

    Directory of Open Access Journals (Sweden)

    Edwin Le Heron

    2006-12-01

    Full Text Available To evaluate the Greenspan era, we nevertheless need to address three questions: Is his success due to talent or just luck? Does he have a system of monetary policy or is he himself the system? What will be his legacy? Greenspan was certainly lucky, but he was also clairvoyant. Above all, he has developed a profoundly original monetary policy. His confidence strategy is clearly opposed to the credibility strategy developed in central banks and the academic milieu after 1980, but also inflation targeting, which today constitutes the mainstream monetary policy regime. The question of his legacy seems more nuanced. However, Greenspan will remain 'for a considerable period of time' a highly heterodox and original central banker. His political vision, his perception of an uncertain world, his pragmatism and his openness form the structure of a powerful alternative system, the confidence strategy, which will leave its mark on the history of monetary policy.

  5. Alpha particle emission as a probe of the level density in highly excited A∼200 nuclei

    International Nuclear Information System (INIS)

    Fabris, D.; Fioretto, E.; Viesti, G.; Cinausero, M.; Gelli, N.; Hagel, K.; Lucarelli, F.; Natowitz, J.B.; Nebbia, G.; Prete, G.; Wada, R.

    1994-01-01

    The alpha particle emission from 90 to 140 MeV 19 F+ 181 Ta fusion-evaporation reactions has been studied. The comparisons of the experimental spectral shapes and multiplicities with statistical model predictions indicate a need to use an excitation energy dependent level-density parameter a=A/K in which K increases with excitation energy. This increase is more rapid than that in lower mass nuclei. The effect of this change in level density on the prescission multiplicities in fission is significant

  6. Investigating AAK1-and GAK-Regulated Virus-Host Interactions Uncovers Broad-Spectrum Antivirals

    Science.gov (United States)

    2017-02-16

    AP1) and AP2M1 (AP2) were 527 selected from the Human ORFeome library of cDNA clones (65) (Open Biosystems) and 528 recombined into either pCherry...TSV01 Renilla reporter plasmid was a gift from Pei-Yong Shi (68). 534 Lentiviral constructs used for AP2 overexpression were cloned into the pRRLSIN...681 total of 10 days and observed daily for 28 days for lethality or clinical signs of disease. 682 683 Animal study approval/ Ethics Statement

  7. Artificial Light at Night Affects Organism Flux across Ecosystem Boundaries and Drives Community Structure in the Recipient Ecosystem

    Directory of Open Access Journals (Sweden)

    Alessandro Manfrin

    2017-10-01

    Full Text Available Artificial light at night (ALAN is a widespread alteration of the natural environment that can affect the functioning of ecosystems. ALAN can change the movement patterns of freshwater animals that move into the adjacent riparian and terrestrial ecosystems, but the implications for local riparian consumers that rely on these subsidies are still unexplored. We conducted a 2-year field experiment to quantify changes of freshwater-terrestrial linkages by installing streetlights in a previously light-naïve riparian area adjacent to an agricultural drainage ditch. We compared the abundance and community composition of emerging aquatic insects, flying insects, and ground-dwelling arthropods with an unlit control site. Comparisons were made within and between years using two-way generalized least squares (GLS model and a BACI design (Before-After Control-Impact. Aquatic insect emergence, the proportion of flying insects that were aquatic in origin, and the total abundance of flying insects all increased in the ALAN-illuminated area. The abundance of several night-active ground-dwelling predators (Pachygnatha clercki, Trochosa sp., Opiliones increased under ALAN and their activity was extended into the day. Conversely, the abundance of nocturnal ground beetles (Carabidae decreased under ALAN. The changes in composition of riparian predator and scavenger communities suggest that the increase in aquatic-to-terrestrial subsidy flux may cascade through the riparian food web. The work is among the first studies to experimentally manipulate ALAN using a large-scale field experiment, and provides evidence that ALAN can affect processes that link adjacent ecosystems. Given the large number of streetlights that are installed along shorelines of freshwater bodies throughout the globe, the effects could be widespread and represent an underestimated source of impairment for both aquatic and riparian systems.

  8. Artificial light at night affects sleep behaviour differently in two closely related songbird species.

    Science.gov (United States)

    Sun, Jiachen; Raap, Thomas; Pinxten, Rianne; Eens, Marcel

    2017-12-01

    Artificial light at night (ALAN) or light pollution is an increasing and worldwide problem. There is growing concern that because of the disruption of natural light cycles, ALAN may pose serious risks for wildlife. While ALAN has been shown to affect many aspects of animal behaviour and physiology, few studies have experimentally studied whether individuals of different species in the wild respond differently to ALAN. Here, we investigated the effect of ALAN on sleep behaviour in two closely related songbird species inhabiting the same study area and roosting/breeding in similar nest boxes. We experimentally exposed free-living great tits (Parus major) and blue tits (Cyanistes caeruleus) to artificial light inside their nest boxes and observed changes in their sleep behaviour compared to the previous night when the nest boxes were dark. In line with previous studies, sleep behaviour of both species did not differ under dark conditions. ALAN disrupted sleep in both great and blue tits. However, compared to blue tits, great tits showed more pronounced effects and more aspects of sleep were affected. Light exposed great tits entered the nest boxes and fell asleep later, woke up and exited the nest boxes earlier, and the total sleep amount and sleep percentage were reduced. By contrast, these changes in sleep behaviour were not found in light exposed blue tits. Our field experiment, using exactly the same light manipulation in both species, provides direct evidence that two closely related species respond differently to ALAN, while their sleep behaviour under dark conditions was similar. Our research suggests that findings for one species cannot necessarily be generalised to other species, even closely-related species. Furthermore, species-specific effects could have implications for community dynamics. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Korkojen kopsetta kuljetusliikkeessä : naisyrittäjänä miehisessä maailmassa

    OpenAIRE

    TOIVONEN, AULI

    2006-01-01

    Kuljetusalan ammatit ovat vahvasti segregoituneita. Tavaraliikenteessä yrittäjinä toimivien naisten osuus on 5,7 % työvoimasta ja henkilöliikenteessä 15,9 % (Tilastokeskus 2006). Naisten omistamien yritysten määrää ei ole erikseen tilastoitu. Nuoret eivät koe alan yrittäjyyttä kiehtovana. Samanaikaisesti omistajanvaihdoksen edessä on vuoteen 2010 mennessä 3 000 -­ 4 000 alan yrittäjää. Alan yleisiä uhkatekijöitä ovat kustannusten nousu, kilpailun kiristyminen, työvoimapula sekä turvallisuusva...

  10. TURİZM EĞİTİMİ ALAN ÖĞRENCİLERİN KARİYER SEÇİMİNE ETKİ EDEN KARİYER ÇAPALARININ BELİRLENMESİNE YÖNELİK BİR ARAŞTIRMA (AN INVESTIGATION TO DETERMINE THE CAREER ANCHORS WHICH AFFECT THE CAREER DECISION OF TOURISM STUDENTS

    Directory of Open Access Journals (Sweden)

    Tuba GEZEN

    2014-04-01

    Full Text Available ÖZ: Kariyer çapaları örgütlerde kariyer aracı olarak kullanılmasına rağmen birçok sınırlı araştırmaya da konu olmuştur. Bu araştırmanın amacı turizm eğitimi alan öğrencilerin meslek ve kariyer seçimine etki eden kariyer çapalarının belirlenmesidir. Bu amaçla Balıkesir Üniversitesi Turizm İşletmeciliği ve Otelcilik Yüksekokulu’nda öğrenim gören öğrencilere anket uygulanmıştır. Turizm eğitimi alan öğrencilerin kariyer çapalarının belirlenmesi amacıyla Schein (1990 tarafından geliştirilen kariyer çapaları ölçeği kullanılmış ve ölçeğin geçerlilik ve güvenirlik analizleri yapılmıştır. Ölçeğe ilk olarak açıklayıcı faktör analizi uygulanmıştır. Doğrulayıcı faktör analizi ile de modelin uygunluğu test edilmiştir. Araştırmada ayrıca öğrencilerin demografik özellikleri ile kariyer çapaları arasında anlamlı bir fark olup olmadığı da belirlenmeye çalışılmıştır. Araştırma sonucunda turizm eğitimi alan öğrenciler için teknik fonksiyonel yetkinlik, hayat tarzı, girişimcilik ve özerklik ve otonomi kariyer çapalarının diğerlerinden daha önemli olduğu tespit edilmiştir. Ayrıca bu kariyer çapalarının, öğrencilerin cinsiyeti, yaşı, mesleği seçmede etkili olan durumu ve mezun olduktan sonra mesleği yapma isteğine göre farklılıklar gösterdiği sonucuna ulaşılmıştır. Anahtar Kelimeler: Kariyer, Kariyer Çapaları, Turizm Öğrencileri, Demografik Özellikler. ABSTRACT: Although career anchors are used as a career tool in organizations, are examined in many limited researches. The purpose of this study is to determine the career anchors which affect the job and career decision of the tourism students. Therefore, Tourism and Hotel Management students who attend four-year programs/departments of Balikesir University have been conducted surveys. The Career Anchors Scale developed by Schein (1990 has been used to determine the

  11. NCBI nr-aa BLAST: CBRC-DDIS-02-0229 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-02-0229 ref|NP_337051.1| PE_PGRS family protein [Mycobacterium tuberculosis... CDC1551] ref|YP_177886.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] ref|YP_001283845.1| P...E-PGRS family protein [Mycobacterium tuberculosis H37Ra] pir||F70868 hypothetical glycine-rich protein Rv2487c - Mycobacterium tuberc...ulosis (strain H37RV) gb|AAK46865.1| PE_PGRS family protein [Mycobacterium tuberc...ulosis CDC1551] emb|CAE55495.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis

  12. NCBI nr-aa BLAST: CBRC-STRI-01-2626 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2626 sp|Q8VBS7|VN1A6_MOUSE RecName: Full=Vomeronasal type-1 receptor A...6; AltName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A1; AltName: Full=Vomeronasa...l type-1 receptor A10 dbj|BAB79209.1| vomeronasal receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasa...l receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasal receptor V1RA10

  13. Book Review: The future of spacetime. Stephen William Hawking (ed.); Kip S. Thorne, Igor Novikov, Timothy Ferris, Alan Lightman, and Richard Price, W.W. Norton & Company, 2002, 224 pp., US 25.95, ISBN 0393020223

    Science.gov (United States)

    Smeenk, Chris

    2003-12-01

    The study of Einstein's theory of general relativity experienced a renaissance beginning in the early 1960s. Prior to this resurgence of interest, general relativity was isolated from mainstream physics-admired for its elegance, perhaps, but only from a distance. The generation of students who risked their careers by entering this neglected field has now reached the age of festschrifts. In June of 2000, Caltech hosted ;Kipfest,; a conference in honor of Kip Thorne's 60th birthday. Thorne started graduate school at Princeton in 1962 and began research in general relativity under John Wheeler's guidance in the heady early days of the renaissance. Since then, he has played a prominent role in general relativity: as co-author of the influential textbook Gravitation, as a leader in research regarding astrophysical applications of Einstein's theory, and as a co-founder and chief advocate for the Laser Interferometer Gravitational Wave Observatory (LIGO), to mention a few aspects of his far-reaching work. ;Kipfest; included 14 speakers discussing fields to which Thorne has contributed. But the conference also reflected Thorne's long-standing commitment to communicating science to a general audience: Igor Novikov, Stephen Hawking, Timothy Ferris, and Alan Lightman gave popular talks at ;Kipfest,; with Thorne himself tricked into delivering a fifth. The Future of Spacetime gathers adaptations of these five lectures, along with a lengthy introductory essay by Richard Price.

  14. On-line measurement of food viscosity during flow

    DEFF Research Database (Denmark)

    Mason, Sarah Louise; Friis, Alan

    2006-01-01

    Sarah L. Mason and Alan Friis discuss some of the principles and equipment used to monitor food viscosity in real time.......Sarah L. Mason and Alan Friis discuss some of the principles and equipment used to monitor food viscosity in real time....

  15. 78 FR 6805 - Information Collection: Arctic National Wildlife Refuge Recreation Visitor Study-2013

    Science.gov (United States)

    2013-01-31

    .... ADDRESSES: Comments concerning this notice should be addressed to Alan E. Watson, Aldo Leopold Wilderness... . The public may inspect comments received at the Aldo Leopold Wilderness Research Institute, USDA... FURTHER INFORMATION CONTACT: Alan E. Watson, Aldo Leopold Wilderness Research Institute, (406) 542-4197...

  16. Adıyaman İl Merkezinde Elektromanyetik Kirliliğin Ölçülmesi

    OpenAIRE

    SÖĞÜT, Ömer; KARADENİZ, Şükrü

    2017-01-01

    Buaraştırmada, Adıyaman il merkezinde Atatürk Bulvarı boyunca (5750 m) 250 maralıklarla, 24 farklı yerlerde elektrik alan şiddeti (E), manyetik alanşiddeti (H) ve eşdeğer düzlem dalga güç yoğunluğu (S) ölçümleri yapıldı.Seçilen yerlerde elektrik alan şiddetini, manyetik alan şiddetini ve güçyoğunluğunu ölçmek için, SpectranHF-60105 V4 taşınabilir spektrum analizörü kullanıldı. Ölçümler, aynı yerde aynı gün içerisinde sabah10.00-12.00 ve öğleden sonra 17.00-19.00 saatlerinde olmak üzere günde ...

  17. Two decades of temporal change of Earth's inner core boundary

    Science.gov (United States)

    Yao, Jiayuan; Sun, Li; Wen, Lianxing

    2015-09-01

    We report two decades of changing behavior of the Earth's inner core boundary (ICB), which provides the simplest explanation for the observed temporal change of the compressional seismic waves that are reflected from the ICB (PKiKP) and refracted in the inner core (PKIKP), from earthquake doublets occurring in South Sandwich Islands between 1993 and 2013. In the early period (before 2003), the ICB is enlarged beneath the western coast of Gabon, Republic of Congo, and southwest Tanzania in the reflected points of the PKiKP observed at seismic stations OBN, AAK, and ARU, while it experiences little change beneath Zimbabwe or/and Kenya, and beneath west Angola or/and north Central African Republic, in the PKIKP entry or/and exit points of AAK and ARU observations, respectively. In the later period (after 1998), the ICB regions beneath the western coast of Gabon, Republic of Congo, and southwest Tanzania either shrink or remain unchanged, and the temporal change migrates to beneath Zimbabwe or/and Kenya, and beneath west Angola or/and north Central African Republic, with a decrease of inner core surface by 5.59 km between 1998 and 2009 beneath Zimbabwe or Kenya and by 1.73 km beneath west Angola or north Central African Republic between 1998 and 2013. These results indicate that ICB temporal change occurs in localized regions and is episodic, rapidly migrating, and alternately enlarged and shrunk.

  18. Remote identification of research and educational activities using spectral properties of nighttime light

    Science.gov (United States)

    Rybnikova, Nataliya A.; Portnov, Boris A.

    2017-06-01

    Research and educational activities (R&EAs) are major forces behind modern economic growth. However, data on geographic location of such activities are often poorly reported. According to our research hypothesis, intensities and spectral properties of artificial light-at-night (ALAN) can be used for remote identification of R&EAs, due to their unique ALAN signatures. In order to develop activity identification models, we carried out a series of in situ measurements of ALAN intensities and spectral properties in a major metropolitan area in Israel. For this task, we used an illuminance CL-500A spectrophotometer that measures the total intensity and spectral irradiance of ALAN, incremented by a 1-nm pitch, from 360 to 780 nm. As our analysis shows, logistic regressions, incorporating ALAN intensities at the peak or near-peak wavelengths, and geographical attributes of the measurement sites as controls, succeeded to predict correctly up to 98.6% of the actual locations of R&EAs. A digital camera satellite image, obtained from the Astronaut Photography Database, was used for the model's validation. According to the validation results, the actual locations of R&EAs coincided well with the estimated high probability areas, as confirmed by the values of Cohen's Kappa index of up to 64%, which indicate a reasonable level of agreement.

  19. High Incidence of Breast Cancer in Light-Polluted Areas with Spatial Effects in Korea.

    Science.gov (United States)

    Kim, Yun Jeong; Park, Man Sik; Lee, Eunil; Choi, Jae Wook

    2016-01-01

    We have reported a high prevalence of breast cancer in light-polluted areas in Korea. However, it is necessary to analyze the spatial effects of light polluted areas on breast cancer because light pollution levels are correlated with region proximity to central urbanized areas in studied cities. In this study, we applied a spatial regression method (an intrinsic conditional autoregressive [iCAR] model) to analyze the relationship between the incidence of breast cancer and artificial light at night (ALAN) levels in 25 regions including central city, urbanized, and rural areas. By Poisson regression analysis, there was a significant correlation between ALAN, alcohol consumption rates, and the incidence of breast cancer. We also found significant spatial effects between ALAN and the incidence of breast cancer, with an increase in the deviance information criterion (DIC) from 374.3 to 348.6 and an increase in R2 from 0.574 to 0.667. Therefore, spatial analysis (an iCAR model) is more appropriate for assessing ALAN effects on breast cancer. To our knowledge, this study is the first to show spatial effects of light pollution on breast cancer, despite the limitations of an ecological study. We suggest that a decrease in ALAN could reduce breast cancer more than expected because of spatial effects.

  20. 1. VII avati Rael Arteli galerii kaks väljapanekut

    Index Scriptorium Estoniae

    2004-01-01

    Fotogaleriis on väljas Andreas W kureeritud "Puudumise kohalolu", mis koosneb Tartu Kõrgema Kunstikooli fotograafia üliõpilaste Madis Katzi, Taavi Piibemanni, Riho Peikeri, Alan Proosa ja Kaisa Eiche ning Toomas Kalve ja Alan Rossi töödest. Audiogaleriis eksponeerib oma helindeid Taavi Tulev

  1. 75 FR 54296 - Information Collection; Trends in Use and Users in the Boundary Waters Canoe Area Wilderness, MN

    Science.gov (United States)

    2010-09-07

    ... notice should be addressed to Alan E. Watson, Aldo Leopold Wilderness Research Institute, USDA Forest... submitted by e-mail to: [email protected] . The public may inspect comments received at the Aldo Leopold... to the building. FOR FURTHER INFORMATION CONTACT: Alan E. Watson, Aldo Leopold Wilderness Research...

  2. Artificial Light at Night Reduces Daily Energy Expenditure in Breeding Great Tits (Parus major)

    NARCIS (Netherlands)

    Welbers, Anouk; van Dis, Natalie; Kolvoort, Annemieke; Ouyang, J.Q.; Visser, M.E.; Spoelstra, K.; Dominoni, D.M.

    2017-01-01

    The ecological impact of artificial light at night (ALAN) is an increasingly recognized process that accompanies expanding urbanization. Yet, we have limited knowledge on the impact of ALAN on wild species, and on the potential to mitigate any negative effects by using different light sources and

  3. NCBI nr-aa BLAST: CBRC-AGAM-03-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0056 ref|NP_524691.1| fusilli CG8205-PD, isoform D [Drosophila melanog...aster] ref|NP_725481.1| fusilli CG8205-PE, isoform E [Drosophila melanogaster] ref|NP_725482.1| fusilli CG82...05-PF, isoform F [Drosophila melanogaster] gb|AAK15280.1|AF321979_1 fusilli [Drosophila melanogaster] gb|AAM...70981.1| CG8205-PD, isoform D [Drosophila melanogaster] gb|AAM70982.1| CG8205-PE,... isoform E [Drosophila melanogaster] gb|AAM70983.1| CG8205-PF, isoform F [Drosophila melanogaster] NP_524691.1 1e-52 33% ...

  4. NCBI nr-aa BLAST: CBRC-DDIS-01-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-01-0111 ref|NP_060837.2| phytoceramidase, alkaline [Homo sapiens] ref|XP_...001175032.1| PREDICTED: phytoceramidase, alkaline isoform 3 [Pan troglodytes] sp|Q9NUN7|APHC_HUMAN Alkaline ...phytoceramidase (aPHC) (Alkaline ceramidase) (Alkaline dihydroceramidase SB89) gb|AAK71923.1|AF214454_1 alkali...ne phytoceramidase [Homo sapiens] gb|AAL56013.1|AF327353_1 alkaline dihydrocera...midase SB89 [Homo sapiens] gb|AAH73853.1| Phytoceramidase, alkaline [Homo sapiens] gb|EAW75010.1| phytoceramidase, alkaline, isoform CRA_b [Homo sapiens] NP_060837.2 3e-23 29% ...

  5. From The Beatles to Bosons

    CERN Multimedia

    Stephanie McClellan

    2013-01-01

    Before embarking on a successful career as a musician, Alan Parsons started out as a sound engineer - earning his first credit on The Beatles’ Abbey Road.  Over the years, he has worked and collaborated with various artists, but 30 September 2013 marks a unique collaboration.  For CERN’s ‘Bosons & More’ party, Alan Parsons Live Project will be sharing the stage with the Orchestre de la Suisse Romande.  Having already visited CERN in 2011, Alan Parsons provides an insight into his views on science and his upcoming performance at the ‘Bosons & More’ event.     Alan Parsons during his visit to CERN in August 2011. Since visiting CERN in 2011, how have your feelings towards the Organization developed? I was thrilled to hear about the recent discovery and how years of work had paid off. Together with my wife, Lisa, and my band, we were very privileged to come to CERN a couple of years ago, hav...

  6. A Bibliography of the Personal Software Process (PSP) and the Team Software Process (TSP)

    Science.gov (United States)

    2009-10-01

    tspsymposium/ Padula , Alan. ―TSP-Agile Showdown: The Gun Smoke Clears.‖ Proceedings of the TSP Sympo- sium (September 2009). http://www.sei.cmu.edu...www.sei.cmu.edu/tspsymposium/ Padula , Alan. ―TSP—Agile Showdown.‖ Proceedings of the TSP Symposium (September 2008). http://www.sei.cmu.edu

  7. Selective AAK1 and GAK Inhibitors for Combating Dengue and Other Emerging Viral Infections

    Science.gov (United States)

    2017-10-01

    Hemorrhagic Fever Viruses, Santa Fe, New Mexico , December 2016. 7. PARTICIPANTS & OTHER COLLABORATING ORGANIZATIONS Individuals who have worked on the... varicella -zoster virus glycoprotein I, a protein localized in the trans-Golgi network. EMBO J. 1996;15(22):6096–6110. 18. Bhattacharyya S, Hope TJ

  8. Selective AAK1 and GAK Inhibitors for Combating Dengue and Other Emerging Viral Infections

    Science.gov (United States)

    2017-10-01

    techniques, describe how they will be shared. • Inventions, patent applications, and/or licenses Identify inventions, patent applications with date, and/or...articles, reprints of manuscripts and abstracts, a curriculum vitae, patent applications, study questionnaires, and surveys, etc. Organization Name: Geneva

  9. Does artificial light-at-night exposure contribute to the worldwide obesity pandemic?

    Science.gov (United States)

    Rybnikova, N A; Haim, A; Portnov, B A

    2016-05-01

    Worldwide overweight and obesity rates are on the rise, with about 1 900 billion adults being defined as overweight and about 600 million adults being defined as obese by the World Health Organization (WHO). Increasing exposure to artificial light-at-night (ALAN) may influence body mass, by suppression of melatonin production and disruption of daily rhythms, resulting in physiological or behavioral changes in the human body, and may thus become a driving force behind worldwide overweight and obesity pandemic. We analyzed most recent satellite images of night time illumination, available from the US Defense Meteorological Satellite Program (DMSP), combining them with country-level data on female and male overweight and obesity prevalence rates, reported by the WHO. The study aims to identify and measure the strength of association between ALAN and country-wide overweight and obesity rates, controlling for per capita GDP, level of urbanization, birth rate, food consumption and regional differences. ALAN emerged as a statistically significant and positive predictor of overweight and obesity (t>1.97; Pworldwide. Regional differences in the strength of association between ALAN and excessive body mass are also noted. This study is the first population-level study that confirms the results of laboratory research and cohort studies in which ALAN was found to be a contributing factor to excessive body mass in humans.

  10. Fulltext PDF

    Indian Academy of Sciences (India)

    As we had promised last month, we continue in this issue our coverage of the life, work and seminal ideas of Alan Turing. V Rajaraman describes in some detail Turing's work on thinking machines, expanding on Vijay Chandru's account last time; while Priti Shankar presents a sensitive review of Alan Hodges' sensitive ...

  11. Infojuhtimise alane kohtumine Riias / Sirje Virkus

    Index Scriptorium Estoniae

    Virkus, Sirje, 1956-

    1997-01-01

    23.-25. veebruaril 1997. a. toimus Riias TEMPUS projekti "Information Management Education for the Baltic States" esindajate kohtumine. Tallinna Pedagoogikaülikooli infoteaduste osakonda esindas Sirje Virkus

  12. Alan Turning / Ian Whitelaw, Julie Whitaker

    Index Scriptorium Estoniae

    Whitelaw, Ian, 1953-

    2011-01-01

    Arvutiasjanduse ja tehisintellekti pioneer, sakslaste Enigma šifri murdnud Teise maailmasõja aegse Briti töörühma juht, ehitas esimese programmeeritava arvuti, töötas välja Turingi testi masina intellekti tuvastamiseks

  13. ATP alane konverents Tartus / Tõnis Tamm

    Index Scriptorium Estoniae

    Tamm, Tõnis

    2004-01-01

    17.-19. maini 2004 toimus Eurosert OÜ korraldusel Tartus IIR-i (International Institute of Refrigeration) konverents, mille lõpparuandena koostati ettepanekute kava ÜRO Euroopa majanduskomisjonile WP11 kontrolli parandamiseks kiiresti riknevate toiduainete veoks ja sellel veol kasutatavate erivahendite üle

  14. Help a Brother Out: A Case Study in Multinational Intelligence Sharing, NATO SOF

    Science.gov (United States)

    2011-12-01

    timely 106 NSHQ COS briefing, October 20, 2010, and Alan Dron , “Special Network—Alliance Aims to Improve...BICES Communications & Information Systems Strategy, August 2011, 3, and Dron , “Special Network—Alliance Aims to Improve Cooperation among Special...and the Intelligence System.” International Journal of Intelligence and Counterintelligence 8, no. 4 (2005): 575–592. Dron , Alan. “Special Network

  15. On the oxidation and combustion of AlH{sub 3} a potential fuel for rocket propellants and gas generators

    Energy Technology Data Exchange (ETDEWEB)

    Weiser, Volker; Eisenreich, Norbert; Koleczko, Andreas; Roth, Evelin [Fraunhofer-Institut fuer Chemische Technologie (ICT), Joseph-von-Fraunhoferstrasse 7, 76327 Pfinztal (Germany)

    2007-06-15

    Aluminum hydride is a promising candidate for application in energetic materials and hydrogen storages. E.g. an AP/HTPB rocket propellant filled with alane was calculated for a 100 N s kg{sup -1} higher specific impulse compared to the same concentration of aluminum. Different investigations on {alpha}-AlH{sub 3} polyhedra using thermoanalytical methods and X-ray diffraction were performed to receive a better understanding of dehydration at about 450 K, passivation of the remaining porous aluminum particles and further oxidation. A modeling approach to describe these conversions including diffusion processes, Avrami-Erofeev mechanism and Arrhenius type reaction steps of n-th order were introduced. Results were discussed in comparison to experimental investigations under pressure with model propellants on the base of gelled pure nitromethane and also filled with alane or pure aluminum in concentrations of 5%, 10% and 15%. Both alane and aluminum increase the burning rate on a factor of two correlated with a temperature increase up to 500 K and more. A mesa burning effect at 6 to 10 MPa was indicated by the mixtures with alane. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

  16. The Inevitable War?

    Science.gov (United States)

    2011-05-20

    69 67 Alan Bryman and Emma Bell , Business Research Methods, 2 ed. (Oxford: Oxford...University Press, USA, 2007), 727. Bryam and Bell define a dependant variable as “ a variable that is causally influenced by another variable.” As the...Pushing-for-Yuan-to-be-Global- Currency-But-Business-Leaders-Say-Not-Yet-114475409.html (accessed April 6, 2011). Bryman , Alan, and Emma Bell

  17. Köpeklerde siklus tayini amacıyla vaginal sitolojinin geleneksel mikroskop yöntemi ve BS200Pro yazılımı ile dijital formatta değerlendirilmesi

    OpenAIRE

    MÜLAZIMOĞLU, S. Barış

    2009-01-01

    Bu doktora çalışmasında, resim işleme yazılımı kullanılarak seksüel siklusun değişik dönemlerinde, eksfoliatif sitoloji amaçlı hazırlanan preparatlardaki hücre alanı, hücre çevresi, hücre çapı, sitoplazma alanı, çekirdek alanı, çekirdek çapı ölçümleri ve RGB (Red-Green-Blue) değerlerinin siklus tayininde yeni bir parametre olarak ne şekilde kullanılabileceğinin saptanması amaçlanmıştırÇalışmanın hayvan materyalini seksüel siklus dönemlerinin takibi amacı ile Ankara Üniver...

  18. Synthetic Ligands of Cannabinoid Receptors Affect Dauer Formation in the Nematode Caenorhabditis elegans

    Directory of Open Access Journals (Sweden)

    Pedro Reis Rodrigues

    2016-06-01

    Full Text Available Under adverse environmental conditions the nematode Caenorhabditis elegans can enter an alternate developmental stage called the dauer larva. To identify lipophilic signaling molecules that influence this process, we screened a library of bioactive lipids and found that AM251, an antagonist of the human cannabinoid (CB receptor, suppresses dauer entry in daf-2 insulin receptor mutants. AM251 acted synergistically with glucose supplementation indicating that the metabolic status of the animal influenced the activity of this compound. Similarly, loss of function mutations in the energy-sensing AMP-activated kinase subunit, aak-2, enhanced the dauer-suppressing effects of AM251, while constitutive activation of aak-2 in neurons was sufficient to inhibit AM251 activity. Chemical epistasis experiments indicated that AM251 acts via G-protein signaling and requires the TGF-β ligand DAF-7, the insulin peptides DAF-28 and INS-6, and a functional ASI neuron to promote reproductive growth. AM251 also required the presence of the SER-5 serotonin receptor, but in vitro experiments suggest that this may not be via a direct interaction. Interestingly, we found that other antagonists of mammalian CB receptors also suppress dauer entry, while the nonselective CB receptor agonist, O-2545, not only inhibited the activity of AM251, but also was able to promote dauer entry when administered alone. Since worms do not have obvious orthologs of CB receptors, the effects of synthetic CBs on neuroendocrine signaling in C. elegans are likely to be mediated via another, as yet unknown, receptor mechanism. However, we cannot exclude the existence of a noncanonical CB receptor in C. elegans.

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  1. NCBI nr-aa BLAST: CBRC-TBEL-01-0844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-0844 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  2. NCBI nr-aa BLAST: CBRC-OGAR-01-0999 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0999 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  3. NCBI nr-aa BLAST: CBRC-DNOV-01-2029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2029 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  4. NCBI nr-aa BLAST: CBRC-OGAR-01-0964 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0964 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  5. NCBI nr-aa BLAST: CBRC-TBEL-01-1968 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1968 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  6. NCBI nr-aa BLAST: CBRC-TBEL-01-1663 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1663 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  7. NCBI nr-aa BLAST: CBRC-CJAC-01-1667 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1667 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  8. NCBI nr-aa BLAST: CBRC-TBEL-01-0265 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-0265 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  9. NCBI nr-aa BLAST: CBRC-TBEL-01-2458 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2458 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  10. NCBI nr-aa BLAST: CBRC-HSAP-11-0146 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-11-0146 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  11. NCBI nr-aa BLAST: CBRC-TBEL-01-1150 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1150 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  12. NCBI nr-aa BLAST: CBRC-OCUN-01-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0029 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  13. NCBI nr-aa BLAST: CBRC-DNOV-01-2275 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2275 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  14. NCBI nr-aa BLAST: CBRC-OGAR-01-0573 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0573 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  15. NCBI nr-aa BLAST: CBRC-FCAT-01-0995 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0995 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  16. NCBI nr-aa BLAST: CBRC-FCAT-01-0442 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0442 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  17. NCBI nr-aa BLAST: CBRC-OCUN-01-0191 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0191 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  18. NCBI nr-aa BLAST: CBRC-CFAM-18-0231 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-18-0231 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  19. NCBI nr-aa BLAST: CBRC-RMAC-14-0114 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-14-0114 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  20. NCBI nr-aa BLAST: CBRC-LAFR-01-2889 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2889 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  1. NCBI nr-aa BLAST: CBRC-ETEL-01-0606 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0606 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  2. NCBI nr-aa BLAST: CBRC-TBEL-01-2401 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2401 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  3. NCBI nr-aa BLAST: CBRC-PTRO-12-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-12-0125 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  4. NCBI nr-aa BLAST: CBRC-OCUN-01-1127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1127 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  5. NCBI nr-aa BLAST: CBRC-PTRO-12-0131 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-12-0131 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  6. NCBI nr-aa BLAST: CBRC-CFAM-21-0240 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-21-0240 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  7. NCBI nr-aa BLAST: CBRC-OGAR-01-0162 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0162 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  8. Two-Phase Flow in High-Heat-Flux Micro-Channel Heat Sink for Refrigeration Cooling Applications. Part 1: Micro-Channel Heat Sink for Direct Refrigeration Cooling

    Science.gov (United States)

    2008-09-01

    the two-phase mixture exiting the condenser. Throttling from high to low pressure was achieved by a manual metering valve situated upstream of the micro...channel et al. htp N4hsP) correlation (2002) kh sp = Nu kf dh’ Nuta, = const (Refer to Eqs. (1.4.6) and (1.4.7)), = 0.023Re" Prf4 f f E=1.0+6Bol6 +f(Bo)x...12.26% (318 data points) 0Id" +30%OND A ~’AAK - -30%",A- / A’ A* 10 " , , , htp ,&xp [W/M 2 K] Figure 1.4.8 Comparison of heat transfer coefficient

  9. Stability and Control Analysis of V/STOL Type B Aircraft.

    Science.gov (United States)

    1979-03-31

    control deficiency is larger at higher angles of attack. For example at 100 kt (51 m/s), the maximum sideslip is re- duced 2 deg, or 13%, by increasing... DEFICIENCY AREA L O ESIRED ENVELOPEi ( JI~AX SI lO KTI REACTION\\ TTLJJETS I o-TO J %%PLUS AIlERONS)S, E3" :-o e- AILERONS 0 10 20 30 40 so so 70 80 go...DISCRETE-TIME OPTIMAL CONTROL LAW GAINS [(0-I)r1 [C1 atC 2 1 jAtK1 & tK2 1 H D P! CONTROL LAW IN INCREMENTAL FORM ERROR DYNAMICS: Ak = Aak - Cl( ak

  10. NCBI nr-aa BLAST: CBRC-TBEL-01-1930 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1930 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  11. NCBI nr-aa BLAST: CBRC-LAFR-01-0512 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0512 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  12. NCBI nr-aa BLAST: CBRC-HSAP-11-0137 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-11-0137 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  13. NCBI nr-aa BLAST: CBRC-LAFR-01-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0007 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  14. Lise 1 Biyoloji Dersi Alan Öğrencilerin Canlıların Çeşitliliği ve Sınıflandırılmasıyla ilgili Kavram Yanılgılarının Belirlenmesi ve Kavram Haritası Yardımıyla Değiştirilmesi

    OpenAIRE

    TÜRKMEN, Lütfullah; ÇARDAK, Osman; DIKMENLI, Musa

    2014-01-01

    İlk ve orta öğrenim fen bilimleri eğitiminde, öğrencilerin sahip oldukları kavram yanılgılarını değiştirmek için öğretmenler ve fen bilimleri eğitimcileri tarafından farklı öğretim yöntemleri kullanılmaktadır. Kavram yanılgılarını değiştirmek kullanılan en yaygın olan yöntemlerden biri de kavram haritalarıdır. Bu çalışmanın amacı Lise 1. sınıf biyoloji dersi alan öğrencilerin Canlıların çeşitliliği ve sınıflandırılması hakkındaki kavram yanılgılarını değiştirmektir. Bu çalışma biyoloji dersi...

  15. Basit Doğrusal Regresyon Analizi İle Hiyerarşik Doğrusal Modeller Analizinin Karşılaştırılması

    OpenAIRE

    ATAR, Burcu

    2014-01-01

    Hiyerarşik veya iç içe geçmiş yapıdaki verilere birçok araştırma alanında rastlanmaktadır. Eğitim alanında öğrenciler, sınıf, okul, şehir, ülke gibi hiyerarşik bir sosyal yapının içinde yer alırlar. Bu yapıdaki bir veride aynı sınıftaki veya okuldaki öğrenciler, evrenden rasgele seçilen öğrencilere göre birbirlerine daha benzer özellikler gösterirler. O halde, aynı sosyal birimde yer alan bireylerden elde edilen gözlemlerin birbirinden tamamen bağımsız olduğu söylenemez. Halbuki doğrusal regr...

  16. The Influence of the Competition in Contracting Act on the Volume of Competitive Prime Contract Awards for Major Hard Goods and Non-Major Hard Goods Purchased by the Department of Defense

    Science.gov (United States)

    1988-11-16

    parts was less than for sole source acquired spare parts see, Alan E. Olsen ; James E. Cunningham; and Donald J. Wilkins, "A Cost-Benefit Analysis of...Washington, D.C. Logistc Management-Institute, MUTT- I 339 I Zusman, Morris; Asher, Norman; Wetzler, Elliot; Bennett, Debbie; Gustaves, Selmer ; Higgins...Acquisition." Masters Thesis, Naval Postgraduate School, 1984. Olsen , Alan E.; Cunningham, James E.; and Wilkins, Donald J. "A Cost-Benefit Analysis of

  17. Public infrastructure investment: A bridge to productivity growth?

    OpenAIRE

    Jerome Levy Economics Institute of Bard College

    1993-01-01

    Table of Contents: Preface, by Dimitri B. Papadimitriou; Public Capital and Economic Growth, by David Alan Aschauer; New Federal Spending for Infrastructure: Should We Let This Genie Out of the Bottle?, by Douglas Holtz-Eakin. Abstract: This brief presents contrasting views on the effects of public infrastructure investment on private sector productivity. David Alan Aschauer states that the slower rate of productivity growth since the early 1970s-coupled with an aging population, the declinin...

  18. Jalkojen ihon suojaus- ja kevennyskoulutus

    OpenAIRE

    Lokka, Maija

    2016-01-01

    Tämän opinnäytetyön tarkoituksena on tuottaa koulutusvideo demonstraation keinoin tukemaan Mills Enterprises Ltd Oy:n tuoteviestintää jalkojenhoidon ammattilaisille, kosmetologeille sekä alan opiskelijoille. Video tuotetaan yhteistyössä viestintäalan ammattilaisten kanssa. Tavoitteena on tuottaa tiivis tietopaketti yleisimpien jalkaongelmien ennaltaehkäisyyn ja hoitoon ihon suojaus- ja kevennystuotteiden avulla. Perinnölliset ja ulkoiset tekijät voivat aiheuttaa ongelmia jalkojen iholle ja va...

  19. The Christian Nobles at the Court of Great Khan, as Described in Mediaeval European Sources

    Directory of Open Access Journals (Sweden)

    Vladimír Liščák

    2017-06-01

    Full Text Available Research objectives: “Moreover, the chief princes of his whole empire, more than thirty thousand in number, who are called Alans, and govern the whole Orient, are Christians either in fact or in name, calling themselves the Pope’s slaves, and ready to die for the Franks.” With these words John of Marignola, a notable traveller to the Far East in the fourteenth century and a legate to the Great Khan of Cathay, attested in his Cronica Boemorum the presence of certain Christian nobles of the Alan race in the service of the Mongol-Chinese emperor. The immediate impetus for Marignola’s mission was that in 1336 the Great Khan Ukhaghatu Toghon-Temür sent a delegation of sixteen “Franks” (Franquis, as the Mongols called Europeans, ad Papam, Dominum Christianorum in Franchiam. They brought two letters to the pope: one purporting to be from the Great Khan himself, and the other from certain princes of the Christian Alans in his service. By the coming of the Mongolian legation in Avignon in 1338, we are informed, among others, that the successor of John of Montecorvino, the first archbishop in Khanbalik, had never reached his destination, as well as the other succeeding archbishops to Khanbalik. Research materials: Marignola’s mission was important not only with its spiritual message, but rather with an excellent choice of gift for the Great Khan. Western messengers brought with them, among the gifts from the Pope in Rome, a singularly auspicious present: a magnificent black horse with white hind hooves. Marignola, in his Cronica Boemorum, identifies the Christian dignitaries at the court of the Great Khan as the Alans. We know of them from earlier sources, but mostly under the generic name “Christians” or “Nestorian Christians”. John of Montecorvino reportedly converted many Alans (he did not mention their name to Roman Catholic Christianity in addition to Armenians in China. According to the Annals of the Yuan Dynasty, in 1229 and

  20. Alan Turing: person of the XXth century?

    Directory of Open Access Journals (Sweden)

    Sánchez Ron, José M.

    2013-12-01

    Full Text Available “Time” magazine chose Albert Einstein as “Person of the Century.” This was undoubtedly a reasonable choice, but as I will argue in this article, there are also good reasons for contending that Turing might have received this honor. One such reason I consider here is his purely scientific work, which stems from the greatest mathematical tradition, and how it affected the development of mathematics itself and was finally instrumental in shaping a new technological world. This is true both as regards the computation and treatment of information as well as the establishment of new forms of social relations. In relation to the foregoing, we have Turing’s contributions to the deciphering of secret codes during the Second World War, which in a somewhat metaphorical sense may be regarded as a new tool for undermining personal privacy, that civil right whose denial finally ruined his lifeEn diciembre de 1999, la revista Time eligió a Albert Einstein “The Person of the Century”. Fue, no cabe duda, una elección razonable, pero, como se argumenta en este artículo, existen también buenos argumentos para sostener que Turing podría haber recibido tal honor. En apoyo de semejante tesis están sus trabajos puramente científicos, que se esbozan aquí, trabajos que entroncan con la mejor tradición matemática, y cómo afectaron al desarrollo matemático, siendo finalmente instrumentales en la configuración de un nuevo mundo tecnológico, tanto en lo que al cálculo y manejo de información se refiere, como en lo relativo al establecimiento de nuevas formas de relaciones sociales. Relacionadas con lo anterior, se encuentran las aportaciones que hizo durante la Segunda Guerra Mundial al desciframiento de códigos secretos, que, en cierto sentido, metafórico, se pueden considerar como una nueva herramienta para socavar la privacidad, ese derecho civil cuya negación arruinó su propia vida.

  1. Alan Charlesworth. Revolução Digital

    OpenAIRE

    Lima, Fábio

    2014-01-01

    Se, por um lado, no início deste milénio a Internet ainda era vista pelas marcas e pelos anunciantes como uma mera troca de bits e de bytes, em que o crescimento desmesurado de sites, aliado à falta de estruturas e de qualidade dos conteúdos levavam a uma desorganização da oferta existente, hoje em dia o cenário é completamente diferente, com as marcas a canalizarem cada vez mais o seu investimento para o online, em detrimento dos ditos meios tradicionais (ou vulgarmente designados por offlin...

  2. Logististen toimintojen ulkoistamisen hyödyt ja uhkatekijät elintarviketeollisuudessa

    OpenAIRE

    Keskinen, Satu

    2013-01-01

    Opinnäytetyössä tarkastellaan yritysten välisissä suhteissa syntyvää arvonluontia ja osapuolten panostuksia toimintojen ulkoistamisessa. Aineisto pohjautuu soveltuvin osin elintarviketuotannon prosesseihin ja niiden vaikutuksiin. Opinnäytetyö aineisto toteutettiin perehtymällä alan kirjallisuuteen, tutkimusraportteihin, elinkeinoelämän analyyseihin kehityssuunnista sekä alan suurten yhtiöiden strategioihin ja asiakashyötyihin. Työn toteutuksen aikana kesällä ja syksyllä 2013 aiheeseen lii...

  3. Electron-microscopy studies of NaAlH{sub 4} with TiF{sub 3} additive: hydrogen-cycling effects

    Energy Technology Data Exchange (ETDEWEB)

    Andrei, C.M.; Holmestad, R. [Norwegian University of Science and Technology, Department of Physics, Trondheim (Norway); Walmsley, J.C. [SINTEF Materials and Chemistry, Trondheim (Norway); Brinks, H.W.; Hauback, B.C. [Institute for Energy Technology, P.O. Box 40, Kjeller (Norway); Srinivasan, S.S.; Jensen, C.M. [University of Hawaii, Department of Chemistry, Honolulu, HI (United States)

    2005-02-01

    NaAlH{sub 4} is a promising candidate material for hydrogen storage. Ti additives are effective in reducing the reaction temperatures and improving kinetics. In this work, the microstructure of NaAlH{sub 4} with 2% TiF{sub 3} has been studied in different conditions using a combination of transmission electron microscopy and scanning electron microscopy, both with energy-dispersive spectroscopic X-ray analysis. The effect of the additive on particle and grain size was examined after the initial ball-milling process and after 15 cycles. The additive has an uneven distribution in the sample after ball milling. Selected-area diffraction and high-resolution imaging confirmed the presence of TiF{sub 3}. This phase accounts for most of the Ti in the material at this stage and showed limited mixing with the alanate. The grain size within particles for TiF{sub 3} is larger than for the alanate particles. Diffraction from the latter was dominated by metallic aluminium. After cycling, the TiF{sub 3} has decomposed and energy-dispersive spectroscopic X-ray analysis maps showed some combination of Ti with the alanate phase. There is no significant change in the measurable grain size of the Al-containing alanate particles between the ball-milled and the 15-cycled samples, but more cycles result in agglomeration of the material. (orig.)

  4. Ei ruokaa, ei elokuvaa : elokuvacateringin analysointi ja yritystoiminnan perustaminen liiketoimintasuunnitelman ja henkilökohtaisen työkokemuksen avulla

    OpenAIRE

    Itkonen, Johanna

    2017-01-01

    Tässä opinnäytetyössä käsittelen elokuva-cateringiä (freelancer-toimintana) sen mahdollisuuksia ja toimenpiteitä kasvaa yritykseksi (Jojo Foods, työnimi) liiketoimintasuunnitelman avulla, sekä tarkastella mitä vaaditaan ja mitä henkilökohtaisesti toivon elokuvacatering -alan yritykseltäni tulevaisuudessa. Suomessa opinnäytetyön kirjoitushetkellä on vain yksi erityisesti elokuvatuotantoihin ja -kuvauksiin suunnattu catering-alan yritys, jonka omistaa ja pyörittää yksi ihminen. Freelance-toimij...

  5. Franchise-liiketoiminnan kehittäminen : Case: lamit.fi

    OpenAIRE

    Hänninen, Aki

    2014-01-01

    Opinnäytetyön tarkoituksena on selvittää keinoja toimeksiantajan aloittaman franchise-toiminnan kehittämiseen.Tutkimuskohteena oli osakeyhtiö lamit.fi:n aloittama franchise-ketju, joka perustuu energiatodistusten laadintaan. Ketjun toiminta on aloitettu keväällä 2013. Tutkimuksen aikana selvi-tettiin keinoja kehittää franchise-toimintaa asiakkuuksien näkökulmasta. Toimeksiantajana toimii Jyväskyläläinen energia-alan yritys Osakeyhtiö lamit.fi. Yritys on keskittynyt energia-alan ohjelmist...

  6. Flagellum motion in 2-D: Work rate and efficiency of the non-sinusoidal approach

    Science.gov (United States)

    Viridi, Sparisoma; Nuraini, Nuning; Stephanie, Monica; Rifqi, Ainur; Christina, Dina; Thania, Elsa; Sihite, Erland

    2018-03-01

    Today microorganisms have been widely used to support human life. Some examples include foodstuffs (Spirulina.sp), to help with medical needs, for mining purposes and more. On the other hand, the development of technology is also very big influence on human life. The combination of technology and health science will be very useful if we can develop it. One is the cancer treatment by utilizing the movement of the flagella to be made a nanorobot used as a carrier of cancer drugs. Movement of flagella that resembles the shape of the arc and straight line can be searched formulation and then applied to the manufacture of nanorobot tail. Then the nanorobot will carry a cancer drug that leads directly to the cancer cells. So hopefully with this nanorobot, can minimize the death of healthy cells around cancer cells. From the results of research and analysis of the movement of flagella, it can be concluded that the smaller the mass of the flagella, the greater the efficiency will be or will be more efficient. So, the energy needed nanorobot will be smaller. Model with non-sinusoidal approach (Brokaw, 1965) is discussed in this work and formulation to get the energy efficiency is proposed and analyzed. Unfortunately, there is a negative value in the formulation.

  7. Kehitysehdotusten tuottaminen palvelupolun parantamiseksi - Case Expert ASA Oy

    OpenAIRE

    Berg, Esa

    2011-01-01

    Kodintekniikka-alan kiristyvä kilpailutilanne ja maailmantalouden epävakaat ajat vaativat alalla toimivilta yrityksiltä keinoja löytää kilpailuetuja verrattuna muihin alan toimijoihin. Tämä tilanne johtaa siihen, että yritysten tulee entistä enemmän kiinnittää aitoa kiinnostusta asiakkaiden tarpeisiin ja toiveisiin, jotta yritys voisi palvella heitä paremmin. Tämän opinnäytetyön tavoitteena on ollut asiakkaan palvelupolun kehittämiseen tähtäävien kehitysideoiden tuottaminen Service ...

  8. Eric Alan Johnson : "Mne nravitsja tot duhh, kotorõi tõ oshtshushtshaejesh v Pitere" / Eric Alan Johnson ; interv. Liana Turpakova

    Index Scriptorium Estoniae

    Johnson, Eric Alan

    2008-01-01

    USA saatkonna Eestis pressiatashee vastab küsimustele, mis puudutavad tema elukäiku, vene keele õppimist, huvi Venemaa vastu, elu Leningradis, ülikoolis õppimist, tööd diplomaadina Moskvas ja Peterburis, muusika- ja kirjandushuvi

  9. MITTAUSTEKNISET RESURSSIT LAPIN KUNNISSA

    OpenAIRE

    Vierelä, Tapio

    2015-01-01

    Opinnäytetyöni tavoitteena oli selvittää Lapin kuntien mittausteknisiä resursse-ja. Tutkimuksessa resursseilla tarkoitettiin mitta-alan henkilöstöä ja laitteistoja. Tutkimuksessa selvitettiin sekä määrällisiä että laadullisia resursseja. Työssä keskityttiin alan kunnallisiin palveluihin, jättäen yksityinen sektori pois. Kunnat ovat yleinen työllistäjä maanmittausalalla niin opiskeluaikana harjoitte-luiden osalta kuin valmistumisen jälkeen työelämään siirryttäessä. Monelle Lapin ammattikorke...

  10. Facebookin hyödyntäminen Yökerhon X markkinoinnissa

    OpenAIRE

    Eerikas, Viljami

    2014-01-01

    Tämän opinnäytetyön tarkoituksena oli suunnitella ja toteuttaa helsinkiläiselle yökerholle kohdennettu Facebook-mainoskampanja. Mainoskampanjan tavoitteena oli saada yökerhon Facebook-sivuille enemmän tykkääjiä eli seuraajia. Opinnäytetyö alkaa ravintola-alan katsauksella, jossa käsitellään alan nykytilannetta, alkoho-lilainsäädäntöä ja markkinointia. Teoriaosuudessa on yleistietoa digitaalisesta markkinoinnis-ta, jonka jälkeen keskitytään enemmän Facebook-markkinointiin ja kohdennetun Fa...

  11. Acerca del trabajo en grupos o equipos

    OpenAIRE

    Gómez Mujica, Aleida; Acosta Rodríguez, Heriberto

    2003-01-01

    Se definen, caracterizan y comparan los grupos y equipos de trabajo. Se señalan las características y funciones que convierten gradual y paulatinamente un grupo en un equipo de trabajo. Se señalan las ventajas y desventajas de cada uno de ellos, tanto para los individuos como para las organizaciones. Se analizan algunas variables estructurales, las normas para la formación de los equipos, las características esenciales y las funciones que desempeñan sus miembros. Se anexa una lista con las ca...

  12. Hoivayrittäjyys — yrityksen perustaminen ja neuvontapalvelut

    OpenAIRE

    Långstedt, Kyllikki

    2013-01-01

    Opinnäytetyön aiheenvalintaan vaikuttivat kiinnostukseni perustaa hoiva-alan yritys sekä osaltaan Laurean hallinnoiman yrityshautomon asiakaskyselyn tulokset. Tämän laadullisen opinnäytetyön tarkoituksena oli kuvata hoivayrittäjyyttä ja sitä, miten aloittava yrittäjä voi hyödyntää olemassa olevia yritysneuvontapalveluja. Tutkimuksen osaongelmina oli selvittää, mitä tukipalveluja toiminimellä aloittava hoiva-alan yrittämiseen tarvitsee, mistä yrittäjä löytää tietoa yrityksen perustamiseen ja m...

  13. MARMARA ÜNİVERSİTESİ’NDE MUHASEBE EĞİTİMİ ALAN ÖĞRENCİLERİN MUHASEBE ALANINA BAKIŞ AÇILARININ DEĞERLENDİRİLMESİNE YÖNELİK BİR ARAŞTIRMA-A RESEARCH FOR THE EVALUATION OF THE STANDPOINT OF THE ACCOUNTING STUDENTS IN RESPECT OF THE FIELD OF ACCOUNTING AT MA

    Directory of Open Access Journals (Sweden)

    Hakan ÇELENK

    2012-06-01

    Full Text Available Ülkemizde muhasebe eğitimi lisans, yüksek lisans ve doktora düzeyinde birçok üniversitede verilmektedir. Öğrencilerin almış oldukları muhasebe eğitimi hem iş dünyası açısından hem de akademik açıdan önemli bir bilgi birikimi sunmaktadır. Ancak öğrencilerin aldıkları muhasebe eğitiminden sonra muhasebeye veya muhasebe alanına karşı tutumları ve muhasebeye ilişkin algıları bilinmeden verilen eğitimin etkileri, başarısı ve sonuçları hakkında bir bilgi sahibi olunamamaktadır. Bu bağlamda Marmara Üniversitesi İktisadi ve İdari Bilimler Fakültesi İşletme Bölümünde lisans ve lisansüstü (yüksek lisans ve doktora eğitimi alan öğrencilerin muhasebe eğitimi üzerine bakış açılarını ölçmeye yönelik bir anket çalışması yapılmıştır. Ankette yöneltilen sorular öğrencilerin; muhasebeye, muhasebe eğitimine, muhasebede hoca faktörüne ve muhasebe ile ilgili mesleklere ilişkin bakış açılarını değerlendirmeye yönelik olarak belirlenmiştir. Anket çalışmasından elde edilen veriler istatistiksel analizlere tabi tutulmuş ve sonuçlar yorumlanmıştır.-In our country, accounting education is given in undergraduate, graduate and doctoral levels in many universities. Accounting education that has been received by the students provides significant knowledge in terms of both business and academic. However, it is not possible to obtain any information pertaining to the effects, success and results of the education without knowing the students’ attitude and perception in respect of the accounting and field of accounting. In this context, a survey study was conducted for the evaluation of the standpoint of the undergraduate and graduate (MA and Ph.D. students in the respect of the field of accounting at the Department of Business of Marmara University Faculty of Economics and Administrative Sciences. Questions that have been asked in the survey were determined to evaluate the

  14. Nocturnal light pollution and underexposure to daytime sunlight: Complementary mechanisms of circadian disruption and related diseases.

    Science.gov (United States)

    Smolensky, Michael H; Sackett-Lundeen, Linda L; Portaluppi, Francesco

    2015-01-01

    Routine exposure to artificial light at night (ALAN) in work, home, and community settings is linked with increased risk of breast and prostate cancer (BC, PC) in normally sighted women and men, the hypothesized biological rhythm mechanisms being frequent nocturnal melatonin synthesis suppression, circadian time structure (CTS) desynchronization, and sleep/wake cycle disruption with sleep deprivation. ALAN-induced perturbation of the CTS melatonin synchronizer signal is communicated maternally at the very onset of life and after birth via breast or artificial formula feedings. Nighttime use of personal computers, mobile phones, electronic tablets, televisions, and the like--now epidemic in adolescents and adults and highly prevalent in pre-school and school-aged children--is a new source of ALAN. However, ALAN exposure occurs concomitantly with almost complete absence of daytime sunlight, whose blue-violet (446-484 nm λ) spectrum synchronizes the CTS and whose UV-B (290-315 nm λ) spectrum stimulates vitamin D synthesis. Under natural conditions and clear skies, day/night and annual cycles of UV-B irradiation drive corresponding periodicities in vitamin D synthesis and numerous bioprocesses regulated by active metabolites augment and strengthen the biological time structure. Vitamin D insufficiency and deficiency are widespread in children and adults in developed and developing countries as a consequence of inadequate sunlight exposure. Past epidemiologic studies have focused either on exposure to too little daytime UV-B or too much ALAN, respectively, on vitamin D deficiency/insufficiency or melatonin suppression in relation to risk of cancer and other, e.g., psychiatric, hypertensive, cardiac, and vascular, so-called, diseases of civilization. The observed elevated incidence of medical conditions the two are alleged to influence through many complementary bioprocesses of cells, tissues, and organs led us to examine effects of the totality of the artificial light

  15. A Behavioral Measure of Costly Helping: Replicating and Extending the Association with Callous Unemotional Traits in Male Adolescents.

    Directory of Open Access Journals (Sweden)

    Joseph T Sakai

    Full Text Available Some conduct-disordered youths have high levels of callous unemotional traits and meet the DSM-5's "with limited prosocial emotions" (LPE specifier. These youths often do aggressive, self-benefitting acts that cost others. We previously developed a task, the AlAn's game, which asks participants to repeatedly decide whether to accept or reject offers in which they will receive money but a planned charity donation will be reduced. In our prior work, more "costly helping" (i.e., rejecting the offered money and protecting the donation was associated with lower callous unemotional traits. Here we extend that prior work in a larger sample of adolescent male patients with serious conduct problems and controls, and test whether this association is mediated specifically by a Moral Elevation response (i.e., a positive emotional response to another's act of virtue.The adolescent male participants were: 45 patients (23 with LPE and 26 controls, who underwent an extensive phenotypic assessment including a measure of Moral Elevation. About 1 week later participants played the AlAn's game.All AlAn's game outcomes demonstrated significant group effects: (1 money taken for self (p = 0.02; (2 money left in the charitable donation (p = 0.03; and, (3 costly helping (p = 0.047. Controls took the least money and did the most costly helping, while patients with LPE took the most money and did the least costly helping. Groups also significantly differed in post-stimulus Moral Elevation scores (p = 0.005. Exploratory analyses supported that the relationship between callous unemotional traits and costly helping on the AlAn's game may be mediated in part by differences in Moral Elevation.The AlAn's game provides a standardized behavioral measure associated with callous unemotional traits. Adolescents with high levels of callous unemotional traits engage in fewer costly helping behaviors, and those differences may be related to blunting of positive emotional responses.

  16. Comentarios al artículo de Alan Sweezy

    Directory of Open Access Journals (Sweden)

    García Mario

    1993-12-01

    Full Text Available

    El New Deal fue impulsado por unos 200 0 300 jóvenes pragmáticos, abogados y economistas en su mayoría, preocupados sobre todo por cuestiones de política y de persuasión. Aunque se consideraban a sí mismo como keynesianos, las ideas de Keynes no tuvieron entonces un impacto muy profundo en sus recomendaciones de política. Los principales desarrollos aparecieron bajo la forma de  actas y memorandos, a menudo de circulación restringida. Aun tenían mucho que aprender de la teoría General y existían muchas ideas y confusiones que era necesario despejar. Los análisis hechos antes del 37 no eran tan sencillos como parece sugerir la analogía del "impulso inicial".  Esta idea, lejos de significar que lo único que se necesitaba era un empujón inicial del gasto para alcanzar la recuperación, planteaba que le gasto debía continuar todo el tiempo que fuera necesario hasta que la construcción, financiada por el sector privado, lograra despegar. En cuanto a las causes de la recesión del 37, Currie ubicaba a la caída en la contribución neta, en conjunto con los cuellos de botella, las fuertes alzas de salarios y el auge de los inventarios como factores explicativos esenciales.

    The New Deal was promoted by 200 or 300 pragmatic young men,lawyers and economists for the most part who were principally principally preoccupied whit questions of policy and persuasion, although they considered themselves Keynesians, Keynes' ideas did not have much impact on their policy recommendations at that time. Principal developments took the form of acts and memorandums which were often classified. They sril1 had a lot to learn about General Theory and there still many ideas and misunderstandings that had to be clarified, the analyses done before 1937 were not as simple as the "pum priming" analogy seems to suggest. This idea, far from signifying that only an initial push in spending had necessary to achieve recovery,suggested that spending had to be continuous for DS long as necessary until construction, financed by the private sector, got off the ground, Currie identified the fall in net construction, the bottlenecks, the high rises in salary and the upsurge of .inventories as the essential causes of the 1937 recession.

  17. Street Food Suomessa ja liiketoimintasuunnitelma katuruokayritykselle

    OpenAIRE

    Hellman, Joonas; Koski, Olli

    2016-01-01

    Tämän opinnäytetyön tarkoituksena oli kerätä tietoa katuruoasta Suomessa ja tuottaa taustatietoa oman yrityksen liiketoimintasuunnitelmaa varten. Teoriatiedot hankittiin pääasiassa alan kirjallisuudesta, Internet-lähteistä sekä käyttäen hyväksi omaa ja alan yleistä tietoa. Tutkimusosa koostuu kyselytutkimuksesta ja sen analysoimisesta. Opinnäytetyön tekijät osallistuivat Ravintolapäivään saadakseen käytännön kokemusta ja tietoa. Kaikkia kolmea edellä mainittua osa-aluetta käytettiin päät...

  18. アメリカの社会保障番号制度と税・社会保険料の一体徴収について

    OpenAIRE

    高山, 憲之

    2008-01-01

    本稿は2007年10月18日(木)、19日(金)に米国のIRSおよびSSAにてThomas E. Steven氏(IRS, International Visitors Program担当課長)、Alan Plumley氏(IRS調査・分析・統計部局のTechinical Adviser)、Eli Donkar氏(SSA, Deputy Chief Actuary)、Alan Lane氏(SSA, Associate Commissioner)等に対して行ったインタビューの結果をとりまとめたものである。

  19. TATN-1 mutations reveal a novel role for tyrosine as a metabolic signal that influences developmental decisions and longevity in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Annabel A Ferguson

    Full Text Available Recent work has identified changes in the metabolism of the aromatic amino acid tyrosine as a risk factor for diabetes and a contributor to the development of liver cancer. While these findings could suggest a role for tyrosine as a direct regulator of the behavior of cells and tissues, evidence for this model is currently lacking. Through the use of RNAi and genetic mutants, we identify tatn-1, which is the worm ortholog of tyrosine aminotransferase and catalyzes the first step of the conserved tyrosine degradation pathway, as a novel regulator of the dauer decision and modulator of the daf-2 insulin/IGF-1-like (IGFR signaling pathway in Caenorhabditis elegans. Mutations affecting tatn-1 elevate tyrosine levels in the animal, and enhance the effects of mutations in genes that lie within the daf-2/insulin signaling pathway or are otherwise upstream of daf-16/FOXO on both dauer formation and worm longevity. These effects are mediated by elevated tyrosine levels as supplemental dietary tyrosine mimics the phenotypes produced by a tatn-1 mutation, and the effects still occur when the enzymes needed to convert tyrosine into catecholamine neurotransmitters are missing. The effects on dauer formation and lifespan require the aak-2/AMPK gene, and tatn-1 mutations increase phospho-AAK-2 levels. In contrast, the daf-16/FOXO transcription factor is only partially required for the effects on dauer formation and not required for increased longevity. We also find that the controlled metabolism of tyrosine by tatn-1 may function normally in dauer formation because the expression of the TATN-1 protein is regulated both by daf-2/IGFR signaling and also by the same dietary and environmental cues which influence dauer formation. Our findings point to a novel role for tyrosine as a developmental regulator and modulator of longevity, and support a model where elevated tyrosine levels play a causal role in the development of diabetes and cancer in people.

  20. TATN-1 Mutations Reveal a Novel Role for Tyrosine as a Metabolic Signal That Influences Developmental Decisions and Longevity in Caenorhabditis elegans

    Science.gov (United States)

    Ferguson, Annabel A.; Dumas, Kathleen J.; Ritov, Vladimir B.; Matern, Dietrich; Hu, Patrick J.; Fisher, Alfred L.

    2013-01-01

    Recent work has identified changes in the metabolism of the aromatic amino acid tyrosine as a risk factor for diabetes and a contributor to the development of liver cancer. While these findings could suggest a role for tyrosine as a direct regulator of the behavior of cells and tissues, evidence for this model is currently lacking. Through the use of RNAi and genetic mutants, we identify tatn-1, which is the worm ortholog of tyrosine aminotransferase and catalyzes the first step of the conserved tyrosine degradation pathway, as a novel regulator of the dauer decision and modulator of the daf-2 insulin/IGF-1-like (IGFR) signaling pathway in Caenorhabditis elegans. Mutations affecting tatn-1 elevate tyrosine levels in the animal, and enhance the effects of mutations in genes that lie within the daf-2/insulin signaling pathway or are otherwise upstream of daf-16/FOXO on both dauer formation and worm longevity. These effects are mediated by elevated tyrosine levels as supplemental dietary tyrosine mimics the phenotypes produced by a tatn-1 mutation, and the effects still occur when the enzymes needed to convert tyrosine into catecholamine neurotransmitters are missing. The effects on dauer formation and lifespan require the aak-2/AMPK gene, and tatn-1 mutations increase phospho-AAK-2 levels. In contrast, the daf-16/FOXO transcription factor is only partially required for the effects on dauer formation and not required for increased longevity. We also find that the controlled metabolism of tyrosine by tatn-1 may function normally in dauer formation because the expression of the TATN-1 protein is regulated both by daf-2/IGFR signaling and also by the same dietary and environmental cues which influence dauer formation. Our findings point to a novel role for tyrosine as a developmental regulator and modulator of longevity, and support a model where elevated tyrosine levels play a causal role in the development of diabetes and cancer in people. PMID:24385923

  1. Some Features of the Functioning of the Northern Branch of the Great Silk Road

    Directory of Open Access Journals (Sweden)

    Anatoliy S. Skripkin

    2017-06-01

    Full Text Available The fact of existing economic relations in the north branch of The Great silk route is usually restored according to Claudius Ptolemey. There are some evidences to connect their activation with the establishment of political domination of Alans in the South-East of Europe. The analysis of archaeological material gives the information that not all findings of Chinese artifacts in Sarmatian burial complexes of the first century AD are the result of trade links and most of them have been brought here in the result of nomads’ migrations. The appearance of the Alans in the steppes of South-Eastern Europe refers to the first century AD. This tribal association was formed in Central Asia. Alans subdue the vast steppes from the Aral sea to the Don. In the early historical stage the Lower Don becomes their political center. In burials belonging to the Alanian nobility, a large number of items of Eastern origin were discovered. A great number of them were brought here upon the arrival of the new nomads. Economic relations in this area begin to improve after the establishment of political stability, which was reflected in the composition of Claudius Ptolemy.

  2. Light pollution is greatest within migration passage areas for nocturnally-migrating birds around the world.

    Science.gov (United States)

    Cabrera-Cruz, Sergio A; Smolinsky, Jaclyn A; Buler, Jeffrey J

    2018-02-19

    Excessive or misdirected artificial light at night (ALAN) produces light pollution that influences several aspects of the biology and ecology of birds, including disruption of circadian rhythms and disorientation during flight. Many migrating birds traverse large expanses of land twice every year at night when ALAN illuminates the sky. Considering the extensive and increasing encroachment of light pollution around the world, we evaluated the association of the annual mean ALAN intensity over land within the geographic ranges of 298 nocturnally migrating bird species with five factors: phase of annual cycle, mean distance between breeding and non-breeding ranges, range size, global hemisphere of range, and IUCN category of conservation concern. Light pollution within geographic ranges was relatively greater during the migration season, for shorter-distance migrants, for species with smaller ranges, and for species in the western hemisphere. Our results suggest that migratory birds may be subject to the effects of light pollution particularly during migration, the most critical stage in their annual cycle. We hope these results will spur further research on how light pollution affects not only migrating birds, but also other highly mobile animals throughout their annual cycle.

  3. MYOMA UTERİ TEDAVİSİNDE LAPARASKOPİK UTERİN ARTER KOAGULASYONUN ETKİSİ; VAKA SERİSİ

    OpenAIRE

    Başar, Hatice; Bostancı, Ahmet; Işık, Hatice; Sarı, Nagihan; Seven, Ali

    2014-01-01

    Amaç: Bu çalışmanın amacı myoma uteri tanısı alan hastalarda laparaskopik bilateral uterin arter koagulasyonunun tedavideki etkisini araştırmaktır.Gereç ve Yöntemler: Haziran 2007-Ekim 2007 tarihleri arasında   29-47 yaş arası   myoma uteri tanısı alan semptomatik 10 hastaya laparaskopik bilateral arter koagulasyonu yapıldı. Postopo- peratif  myom hacimleri Manyetik Rezonans görüntüleme (MRI) ile değerlendirildi ve hastaların semptomlarındaki değişiklikler kaydedildi.Bulgular: Laparaskopik ar...

  4. Hydrogen dynamics in Na3AlH6: A combined density functional theory and quasielastic neutron scattering study

    DEFF Research Database (Denmark)

    Voss, Johannes; Shi, Qing; Jacobsen, Hjalte Sylvest

    2007-01-01

    alanate with TiCl3, and here we study hydrogen dynamics in doped and undoped Na3AlH6 using a combination of density functional theory calculations and quasielastic neutron scattering. The hydrogen dynamics is found to be vacancy mediated and dominated by localized jump events, whereas long-range bulk......Understanding the elusive catalytic role of titanium-based additives on the reversible hydrogenation of complex hydrides is an essential step toward developing hydrogen storage materials for the transport sector. Improved bulk diffusion of hydrogen is one of the proposed effects of doping sodium...... defect motion in sodium alanate could result from vacancy-mediated sodium diffusion....

  5. Elecciones Perú, 2006: complejidades y paradojas de una democracia aún vulnerable.

    Directory of Open Access Journals (Sweden)

    Rodolfo Masías Núñez

    2006-12-01

    Full Text Available This article offers a first approximation to the recent electoral process that took Alan García Pérez to his second presidency. This is a process for which is not possible to give concluding remarks, mostly because of how recent it is and the lack of information available. With the intention to inform, we make some reflections germane to the Peruvian political debate. The article describes the first and second rounds and the factors that help explain the results, especially Alan García’s victory of and the resulting party composition of Congress. In its closing section, the article advances some general conclusions about the process.

  6. Art history in nineteenth-century Estonia? / Rene Mäe

    Index Scriptorium Estoniae

    Jõekalda, Kristjan, 1971-

    2015-01-01

    Kunstiajaloodistsipliini teke Baltikumis, Tartu Ülikooli kunstiajaloo-alane tegevus. Kunstiajaloo esimesed viljelejad Eesti alal: Gotthard von Hansen, Friedrich Amelung, Reinhold Guleke ja Wilhelm Neumann

  7. Grieg: Songs and dramatic works with orchestra. / Alan Blyth

    Index Scriptorium Estoniae

    Blyth, Alan

    1993-01-01

    Uuest heliplaadist "Grieg: Songs and dramatic works with orchestra. Barbara Bonney, Randi Stene, Hakan Hagegard, Ruth Tellefsen, Gothenburg Symphony Chorus and Orchestra, Neeme Järvi." CD 437 519 - 2GH

  8. Granitsõ liberalizma / Alan Wolfe ; tõlk. Nikolai Zhdanovitsh

    Index Scriptorium Estoniae

    Wolfe, Alan

    2007-01-01

    Lääneriikides valitsevatest immigratsiooniprobleemidest, ühtse liberaalse immigratsioonipoliitika puudumisest. Liberaalses ühiskonnas tuleks tähelepanu pöörata sellele, kuidas immigrant võiks riigile kasulik olla, mitte vastupidi. Autori arvamus

  9. Alan Paton's Sublime: Race, Landscape and the Transcendence of ...

    African Journals Online (AJOL)

    This article develops a postcolonial reading of the sublime by suggesting that aesthetic theories of the sublime were, in their classical philosophical formulations by Edmund Burke and Immanuel Kant, founded on problematic assumptions of racial difference. In the colonial sphere, it is argued, the sublime could discursively ...

  10. Vedelkütusevaru on põhjendatud erand / Alan Vaht

    Index Scriptorium Estoniae

    Vaht, Alan, 1976-

    2005-01-01

    Vastus Henn Pärna artiklile "Vedelkütusevaru tuleb soetada kindlasti riigihankega" 17. märtsi Äripäevas. Majandus- ja kommunikatsiooniministeerium on veendunud, et kõik vedelkütusevarude moodustamisega seotud riigihanked teostati kooskõlas Eesti seadustega

  11. Minu positsioon on kaugel kodakondsuse nullvariandist / Paul Alan Goble

    Index Scriptorium Estoniae

    Goble, Paul Alan, 1949-

    1998-01-01

    Vastukaja artiklile: Rüütel, Ingrid. Kodakondsuse uus nullvariant seadustamisel // Sõnumileht, 19. okt.. 1998. Kodakondsusseaduse muutmise seaduse eelnõust, mille kohaselt antakse kõikidele Eestis sündinud lastele Eesti kodakondsus

  12. Organizational Communication: An Analysis of the Main Perspectives, Main Concepts and Future Directions of the Field

    Directory of Open Access Journals (Sweden)

    Yusuf Yüksel

    2013-09-01

    Full Text Available There is a scholarly debate since the 1980s regarding the content, theory, methodology and applications that define the scope of organizational communication and separate it from other related disciplines. This debate is critical in the sense that it enables to identity organizational communication in a rich manner and helps us define the scope of the field and its unique characteristics. Based on this main assumption, this study addressed the major theoretical/methodological dimensions of the field (functional, interpretive, and critical, conceptualization of the most critical concepts (organization, communication, culture, voice/control in these dimensions, and current gaps and future directions of the field. This study revealed that the field of organizational communication has made great improvements since the field emerged in the last three decade with its own content, methodology, and applications and generated an adequate body of research within these different perspectives. It is shown that representation of the field by different perspectives provides richness to the field compared with the time when organizational communication was solely dominated by functional, positivist research. Key words: Functional/interpretive/critical perspectives, communication, organization, culture, control, effectiveness. Örgütsel İletişim: Alanın Ana Yaklaşımları, Ana Kavramları ve Gelecek Yönelimlerinin AnaliziÖzÖrgütsel iletişim alanının kapsamı ve bu alanı ilgili displinlerden ayıracak içerik, teori, yöntem, ve uygulamalar üzerine akademik tartışmalar 1980’li yıllardan beri devam etmektedir. Bu tartışmalar, örgütsel iletişim alanının derinlemesine anlaşılması, sınırlarının belirlenmesi ve diğer disiplinlerden ayrılan özelliklerinin anlaşılması noktasında hayati öneme sahiptir. Bu temel varsayımdan hareketle, bu çalışma alandaki temel teorik/yöntemsel yaklaşımları (işlevsel, yorumlayıcı, ele

  13. BİLGİSAYAR VE ÖĞRETİM TEKNOLOJİLERİ EĞİTİMİ BÖLÜMÜ ÖĞRETMEN ADAYLARININ VİDEO PAYLAŞIM SİTELERİNE İLİŞKİN GÖRÜŞLERİNİN İNCELENMESİ

    OpenAIRE

    ELÇİÇEK, Mithat; BAHÇECİ, Ferhat

    2018-01-01

    Yeni nesil teknolojilerin hızla yaygınlaştığı günümüz bilgi toplumunda, internet ve web teknolojilerine olan ihtiyaç sürekli artmaktadır. Artan ihtiyaçlar doğrultusunda web teknolojilerinin kullanım alanları genişlemekte ve bu alanlara erişim yolları yeni teknolojilerle sürekli geliştirilmektedir. Hayatın her alanında yaşanan bu gelişmeler şüphesiz ki eğitim alanında da yeni arayışları beraberinde getirmektedir. Eğitim teknolojilerinin etkin kullanılması ve bu teknolojilerin web tabanlı siste...

  14. El ajuste en Cuba: ¿Medidas de sobrevivencia o nuevo modelo de desarrollo?

    Directory of Open Access Journals (Sweden)

    Hugo Fazio Vengoa

    1997-06-01

    Full Text Available El propósito del trabajo consiste en analizar la actual etapa por la que atraviesa Cuba y precisar la esencia de las reformas en curso. En una primera parte se señalan las características del modelo cubano de socialismo y los factores internos e internacionales que lo condujeron a una gran crisis. Después de pasar revista sobre la naturaleza del periodo especial, los autores señalan los límites que existen para que los sectores dinámicos en la actual economía cubana puedan convertirse en un nuevo modelo de desarrollo en la isla que le permita preservar su sistema socialista.

  15. Milestones in welding technology

    Science.gov (United States)

    Dolby, Richard E.

    2013-09-01

    Sir Alan's PhD thesis describes his research into cracking during arc welding of armour steels. Throughout his career, he had a strong interest in defects of all types, how they formed in metallic structures and how the larger ones could be detected and sized by non-destructive techniques. He was also vitally concerned with how defects impacted on the engineering integrity of welded structures, particularly the risk of fracture in nuclear plant. This study presents a view of some of the major milestones in global welding technology that took place over the 60 or more years of Sir Alan's career and highlights those where he had a personal and direct involvement.

  16. Bal Verimini Etkileyen Bazı Faktörlerin Path Analizi Yöntemi ile İncelenmesi

    Directory of Open Access Journals (Sweden)

    Melis Çelik Güney

    2016-10-01

    Full Text Available Path analizi, korelasyon katsayısını, kısmi korelasyon katsayısını ve path katsayısını kullanarak değişkenler arasındaki ilişkileri belirlemektedir. Bu çalışmada, bal verimi üzerine etki eden; yavrulu alan, uçuş etkinliği, polen toplama, nektar toplama ve temizleme davranışı faktörlerinin doğrudan ve dolaylı etkileri incelenmiştir. Araştırmada, Ç.Ü.Z.F. Zootekni Bölümü, Arıcılık Araştırma Ünitesi'nde bulunan kolonilerden alınan kayıtlar kullanılmıştır. Araştırma sonucunda, bal verimi üzerine yavrulu alanın etkisi istatistiksel olarak önemli bulunmuştur. Deneme kolonilerinde yavrulu alanın, bal verimi üzerine en yüksek doğrudan etkiye sahip bir faktör, nektar toplama davranışının ise bal verimi üzerine en yüksek dolaylı etkiye sahip bir faktör olduğu ortaya konmuştur.

  17. Çocuk Kitaplarına Yeni Bir Yaklaşım: İnternet'te Resimli Çocuk Kitapları (e-books

    Directory of Open Access Journals (Sweden)

    Mübeccel Gönen

    2002-06-01

    Full Text Available Elektronik kitaplar (e-books yurtdışında oldukça yaygın bir biçimde kullanılmakta ve kullanıcı sayısı da giderek artmaktadır. İnternette yer alan bu kitaplar, her yaştaki insanın ilgi alanına hizmet edecek kadar çok ve çeşitlidir. Bu tür kitaplara internette yer alan kütüphanelerden, yayınevlerinden ve yazarlardan ulaşılmaktadır. Çocuk edebiyatı ile ilgili sitelerden de her konuda resimli çocuk kitaplarına ulaşılabilir. İnternette Türkçe resimli çocuk kitapları ve çocuk edebiyatı ile ilgili sitelere rastlanmamaktadır. Ancak elektronik çocuk kitaplarına yabancı sitelerden ulaşılabilir ve bazı sitelerden ücretsiz olarak da temin edilebilir. Bu yeni uygulama ile ülkemizde bulunan yayınevleri ve yazarların, iletişim ve bilgi teknolojisinden yararlanarak daha fazla aileye, okul ve çocuğa hizmet götürebileceği düşünülmektedir.

  18. A Teaching Experiment That Aims to Develop Pre-Service Mathematics Teachers’ Technological Pedagogical and Content Knowledge [Matematik Öğretmeni Adaylarının Teknolojik Pedagojik Alan Bilgilerinin Gelişimini Amaçlayan Bir Öğretim Deneyi

    Directory of Open Access Journals (Sweden)

    Melike Yiğit Koyunkaya

    2017-08-01

    Full Text Available The main purpose of this study was to examine pre-service secondary mathematics teachers’ (PSMTs levels and development of technological, pedagogical and content knowledge (TPACK. In line with this purpose, this study was designed to use teaching experiment methodology within a course. Therefore, while examining PSMTs’ development of TPACK, an appropriate teaching method that supported development of PSMTs’ TPACK was shared in this article. The participants of the study were 28 fourth grade PSMTs. The teaching experiment methodology, one of the methods of qualitative research design, was used in the study. By using this method, PSMTs were taught about how to integrate technology into mathematics education, how to use varios mathematics and geometry dynamic software, interactive applications that are used in mathematics education and various websites related to education during 16 weeks and four hours in each week. The data was collected during the experiment, and analyzed by using content analysis and document analysis methods. The results show that PSMTs’ TPACK levels were developed by applying the teaching experiment methodology. Particularly, in the activities they designed, lesson plans, reflections and free writings, it was observed that PSMTS’ skills about how to integrate technology in order to ease the learning and teaching of mathematics and utilizing it were developed. Within this context, it is thought that technology integrated courses or technology based courses should be taught in the education programs. [Bu çalışmanın temel amacı, ortaöğretim matematik öğretmeni adaylarının teknolojik pedagojik alan bilgi (TPAB düzeylerinin ve gelişimlerinin incelenmesidir. Bu amaç doğrultusunda, bu çalışma bir ders kapsamında öğretim deneyi yöntemi kullanılarak tasarlanmıştır. Çalışmanın katılımcıları, bir devlet üniversitesinin Ortaöğretim Matematik Öğretmenliği bölümünde öğrenim gören 28

  19. Ortaöğretim Tarih Ders Kitaplarında Yer Alan Barış ve Antlaşmalar Üzerine Bir Değerlendirme

    Directory of Open Access Journals (Sweden)

    Özgür Aktaş

    2013-05-01

    Full Text Available Bu çalışmanın amacı ortaöğretim tarih ders kitaplarında yer alan antlaşma ve barış konularının içeriğinin nasıl düzenlendiğini değerlendirmektir. Araştırmanın yöntemi doküman analizine dayanmaktadır. Bu çalışmada ders kitaplarında anlatılan antlaşmaların anlatılış tarzları tespit edilmiştir. Antlaşmalar iki gruba ayrılarak değerlendirilmiştir. Birincisi doğrudan anlatılan antlaşmalar, ikincisiyse bir parça ya da metin içerisinde anlatılan antlaşmalardır. Ortaöğretim tarih ders kitaplarına bakıldığında antlaşmalar ve barışlar önemli oranda yer tutmaktadır. Tarih ders kitaplarında savaşlar ve antlaşmalar anlatılırken zengin görsellerin kullanıldığı görülmektedir. Bununla beraber antlaşmalar anlatılırken akıl yürütme, tartışma, eleştirel düşünme gibi tekniklerin kullanılmasında eksiklikler olduğu görülmektedir. Türkiye Cumhuriyeti İnkılâp Tarihi ve Atatürkçülük tarih ders kitabında antlaşmalar çoğunlukla doğrudan anlatılmıştır. Çağdaş Türk ve Dünya Tarihi dersinin programına alınması öğrencilerinde bilmeleri gereken savaşları ve antlaşmaları da fazlasıyla arttırmıştır. Bu antlaşmaların daha iyi anlatılmasının en iyi yolunun konunun öğretimini kolaylaştıracak etkinlik kitaplarının geliştirilmesi olduğu düşünülmektedir. Anahtar Kelimeler: Savaş, Antlaşma, Barış, Tarih, Tarih Eğitimi  A Study into Peaces and Treaties in the History Course Books of Secondary EducationAbstract: The purpose of the current study was to investigate how the content of the treaties and peace subjects in the history course books of secondary education was arranged. The method of the research based on document analysis. In this study, the styles of giving the treaties told in the course books were determined. The treaties were classified in two groups and analysed. First one was the treaties directly told and the second one was

  20. Improving the resilience of the healthcare workforce.

    Science.gov (United States)

    Glasper, Alan

    2016-11-24

    Emeritus Professor Alan Glasper, from the University of Southampton, discusses government strategies to ensure a future healthcare workforce that is sustainable and does not rely on overseas recruitment.

  1. Improving the resilience of the healthcare workforce

    OpenAIRE

    Glasper, Alan

    2016-01-01

    Emeritus Professor Alan Glasper, from the University of Southampton, discusses government strategies to ensure a future healthcare workforce that is sustainable and does not rely on overseas recruitment

  2. Vastuolude sajand matemaatika alustes / Gregory Chaitin ; tõlk. Jaak Lõhmus

    Index Scriptorium Estoniae

    Chaitin, Gregory

    2006-01-01

    Georg Cantori lõpmatute hulkade teooria. Bertrand Russelli loogikaparadoksid. David Hilberti formaalsed aksiomaatilised teooriad. Gurt Gödel avastab mittetäielikkuse. Alan Turing avastab mittearvutatavuse. Juhuslikkusest puhtas matemaatikas

  3. Rahvusarhiivi osalemine COST-i projektis D42 "EnviArt" / Jaan Lehtaru

    Index Scriptorium Estoniae

    Lehtaru, Jaan

    2011-01-01

    Rahvusvahelisest projektist COST (Euroopa teaduse ja tehnika alane koostöö) , milles rahvusarhiiv osales ja mille huviorbiidis olid keskkonna- ja seisundiuuringud ning arhivaalide säilitamisega seonduvad teemad

  4. Intellektuaalse plära mehaanika / Dan Steinbock ; tlk. Aivo Lõhmus

    Index Scriptorium Estoniae

    Steinbock, Dan

    1997-01-01

    Refereeritakse New Yorki ülikooli füüsikaprofessori Alan Sokali paroodiat kaasaegsete kultuuriteooriate, eriti postmodernistliku kirjandusteaduse kohta 'Piiride transgessioon: kvantgravitatsiooni transformatiivse hermeneutika poole' (ilmus ajakirjas Social Text)

  5. Noor filoloog uuris karupoeg Puhhi ja Peeter Paani seiklusi / Anu Mõistlik

    Index Scriptorium Estoniae

    Mõistlik, Anu, 1980-

    2003-01-01

    Maarit Maimetsa bakalaureusetöö uurib kolme inglise lasteraamatu fantaasiaelemente: Lewis Carrolli "Alice imedemaal", James Matthew Barrie' "Lood Peeter Paanist" ja Alan Alexander Milne'i "Jutustus karupoeg Puhhist"

  6. Complex Hydride Compounds with Enhanced Hydrogen Storage Capacity

    Energy Technology Data Exchange (ETDEWEB)

    Mosher, Daniel A.; Opalka, Susanne M.; Tang, Xia; Laube, Bruce L.; Brown, Ronald J.; Vanderspurt, Thomas H.; Arsenault, Sarah; Wu, Robert; Strickler, Jamie; Anton, Donald L.; Zidan, Ragaiy; Berseth, Polly

    2008-02-18

    The United Technologies Research Center (UTRC), in collaboration with major partners Albemarle Corporation (Albemarle) and the Savannah River National Laboratory (SRNL), conducted research to discover new hydride materials for the storage of hydrogen having on-board reversibility and a target gravimetric capacity of ≥ 7.5 weight percent (wt %). When integrated into a system with a reasonable efficiency of 60% (mass of hydride / total mass), this target material would produce a system gravimetric capacity of ≥ 4.5 wt %, consistent with the DOE 2007 target. The approach established for the project combined first principles modeling (FPM - UTRC) with multiple synthesis methods: Solid State Processing (SSP - UTRC), Solution Based Processing (SBP - Albemarle) and Molten State Processing (MSP - SRNL). In the search for novel compounds, each of these methods has advantages and disadvantages; by combining them, the potential for success was increased. During the project, UTRC refined its FPM framework which includes ground state (0 Kelvin) structural determinations, elevated temperature thermodynamic predictions and thermodynamic / phase diagram calculations. This modeling was used both to precede synthesis in a virtual search for new compounds and after initial synthesis to examine reaction details and options for modifications including co-reactant additions. The SSP synthesis method involved high energy ball milling which was simple, efficient for small batches and has proven effective for other storage material compositions. The SBP method produced very homogeneous chemical reactions, some of which cannot be performed via solid state routes, and would be the preferred approach for large scale production. The MSP technique is similar to the SSP method, but involves higher temperature and hydrogen pressure conditions to achieve greater species mobility. During the initial phases of the project, the focus was on higher order alanate complexes in the phase space

  7. Promoting mental health first aid literacy in secondary schools

    OpenAIRE

    Glasper, Alan

    2017-01-01

    Emeritus Professor Alan Glasper, from the University of Southampton, discusses a new initiative designed to help teachers in secondary schools better understand and identify mental health issues in children.

  8. Postmodernistlikust teadusfantastikast = Postmodern science fiction / Märt Väljataga

    Index Scriptorium Estoniae

    Väljataga, Märt, 1965-

    2010-01-01

    New Yorgi ülikooli teoreetilise füüsika professor Alan Sokali 1994. aastal postmodernistlikust teadusest ilmunud paroodiaartiklist "Piire rikkudes: kvantgravitatsiooni hermeneutilise transformatsiooni poole" ja selle ümber tekkinud poleemikast

  9. Bogi i monstrõ, ili biografija Supermena / Olga Marsheva

    Index Scriptorium Estoniae

    Marsheva, Olga

    2007-01-01

    Ameerika tuntuimad koomiksikunstnikud Larry Hama, Stan Lee, Jerry Seagel, Bob Kain, Frank Miller ja nende loodud tegelaskujud. Ka briti kirjanik Alan Moore, kellele ei meeldi oma kangelastest tehtud ekraniseeringuid vaadata

  10. Composite materials for aircraft structures

    National Research Council Canada - National Science Library

    Baker, A. A; Dutton, Stuart; Kelly, Donald

    2004-01-01

    ... materials for aircraft structures / Alan Baker, Stuart Dutton, and Donald Kelly- 2nd ed. p. cm. - (Education series) Rev. ed. of: Composite materials for aircraft structures / edited by B. C. Hos...

  11. Genomes of foodborne and waterborne pathogens

    National Research Council Canada - National Science Library

    Fratamico, Pina M; Liu, Yanhong; Kathariou, Sophia

    2011-01-01

    ... of Pathogenic Vibrio cholerae * 85 Salvador Almagro-Moreno, Ronan A. Murphy, and E. Fidelma Boyd 8. Genomics of the Enteropathogenic Yersiniae * 101 Alan McNally, Nicholas R. Thomson, and Brendan W. ...

  12. Bamboo structures: evoke the spirit workshop [organisation, facilitation, research] Brescia, Italy; 1-14 July 2009

    OpenAIRE

    Kolakowski, Marcin M.; Thompson, Alan

    2010-01-01

    Student workshop run by MM Kolakowski and Alan Thompson for architectural students. Construction of large scale bamboo structures: 18-metre high tower, 9-metre high wheel arches and other bamboo constructions.

  13. Täiskasvanute kursusi saadab suur menu / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Euroopa Sotsiaalfondi projekti "Täiskasvanute tööalane koolitus kutseõppeasutustes" raames toimuvad tasuta kursused 37 kutseõppeasutuses ja rakenduskõrgkoolis üle Eesti. Tasuta koolitusi pakuvad ka vabahariduskeskused maakondades

  14. 77 FR 5751 - Marine Recreational Fisheries of the United States; National Saltwater Angler Registry and State...

    Science.gov (United States)

    2012-02-06

    ... Fisheries, Fishing, Fishing vessels, Statistics. Dated: February 1, 2012. Alan D. Risenhoover, Acting Deputy.... 600.1416: a. Revise paragraphs (a), (b)(1), (c), introductory text (d) and (d)(1); and b. Add...

  15. Putting Science FIRST: Memories of Family Science Experiences.

    Science.gov (United States)

    Science and Children, 1996

    1996-01-01

    Presents anecdotes from prominent citizens including Bill Clinton, Alan Alda, Carl Sagan, Gerald Wheeler, JoAnne Vasquez, and Lynn Margulis in which they reminisce about interesting science experiences with their families. (JRH)

  16. Sığır Etinde Su Tutma Kapasitesi ve Serbest Su Oranı Değişimi Üzerine bir Araştırma

    Directory of Open Access Journals (Sweden)

    Aydın Öztan

    2015-02-01

    Full Text Available Kesimden sonra ette pH değişimi, etin serbest su oranı ve su tutma kapasitesinin belirlenmesinde en önemli kriterdir. Bu araştırmada; 12 adet sığır karkasında M. Trapezius kasında kesimde, kesimden 1 saat 24 saat ve 48 saat sonra pH ölçümleri yapılmış, kompressium yöntemi ile serbest su oranı ve üç farklı yöntemle su tutma kapasitesi saptanmıştır. Pres yönteminde; süzgeç kağıtlarında toplam su alanı (T ve et alanı (Ev ek scanner ile taranmış, bilgisayarda alan ölçümleri yapılmıştır. PH-değeri bakımından zaman ve hayvan değişkenleri önemli bulunmuştur. Ette serbest su oranı rigor mortis döneminde (24 saat artmış, daha sonra düşmeye başlamıştır. Örneklerde su tutma kapasitesi kesimden başlayarak olgunlaşma periyodunda rigor mortis sonuna kadar düşmüş, daha sonra yükselmeye başlamıştır.

  17. Bookeri lühinimekiri on valitud

    Index Scriptorium Estoniae

    2004-01-01

    Briti prestiizhseima kirjandusauhinna "The Man Booker Prize" lühinimekirja on jõudnud järgmised autorid: Achmat Dangor, Sarah Hall, Alan Hollinghurst, David Mitchell, Colm T̤ibín, Gerard Woodward jt.

  18. 78 FR 77431 - Appointments to a Recreational Fisheries Working Group by the Marine Fisheries Advisory Committee

    Science.gov (United States)

    2013-12-23

    ... Secretary of the Senate and the Clerk of the House of Representatives within two years of the date of... . Dated: December 17, 2013. Alan D. Risenhoover, Director, Office of Sustainable Fisheries, performing the...

  19. An Evaluation On Typology Of Fountains To The Villages Located In Uşak Center / Uşak Merkez Köylerinde Yer Alan Çeşmelerin Tipolojisi Üzerine Bir Değerlendirme

    Directory of Open Access Journals (Sweden)

    Türkan Acar

    2018-04-01

    terms of facade features. In our study, a typology evaluation was carried out with the locations, physical formations and architectural details of these fountains. In our evaluation of typology, we stated four main groups according to the positions and their physical formations, then subgroups of each group were formed. [TR: Ege Bölgesi’nde, İç Batı Anadolu eşiğinde yer alan Uşak, beş ilçeye ayrılmaktadır. İlin, merkeze ve ilçelere bağlı 265 köyü vardır. 2014-2016 yıllarında il merkezine bağlı doksan köyde araştırmalar yapılmış ve 75 çeşme tespit edilmiştir. Söz konusu 75 çeşmeden sadece 12’si tescillidir. Çalışmamızda bu çeşmelerin konumları, kütle biçimlenişleri ve mimari detayları ile bir tipoloji değerlendirmesi yapılmıştır. Tipoloji değerlendirmemizde çeşmeler konum ve fiziksel biçimlenişe göre dört ana grupta toplanmış; bu gruplar kendi içlerinde alt gruplara ayrılarak değerlendirilmiştir. Uşak merkez köylerde yer alan çeşme örnekleri kütle biçimlenişi bakımından çeşitlilik gösterse de cephe özellikleri açısından tek cephe tasarımıyla dikkat çekmektedir. Fiziksel biçimlenişinde kütle, genellikle dikey dikdörtgendir. Az sayıda da olsa yatay dikdörtgen örneklere de rastlanmaktadır. Cephe kompozisyonunun ana öğesi, sivri, yarım daire, basık ya da dilimli bir kemerdir. Bazı çeşmeler kemersiz olup dikdörtgen bir kütle şeklindedir. Cephe kompozisyonunda kemerlerden sonra ikinci öğe plasterlerdir. Merkez köylerindeki çeşmelerin 28’inde dikey dikdörtgen, 2’sinde yarım silindirik formlu plaster vardır. Çeşme mimarisinde cephe kompozisyonunun bir diğer elemanı ayna taşlarıdır. Bir ayna taşına sahip 22 çeşmenin 17’sinin ayna taşı devşirme mermer, 1’inin mermer ve 4’ünün kesme taştır. İncelediğimiz çeşmelerin 66’sında çeşmeye gelen su, metal bir borudan devamlı akar şekilde gelmektedir. Onarımlar sonrasında bazı

  20. WATER TEMPERATURE and Other Data from MULTIPLE SHIPS From World-Wide Distribution from 19610101 to 19901212 (NODC Accession 9400138)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Sixty-two (62) data files and one doc file from Dr. Alan Longhurst, Bedford Institute of Oceanography, Dartmouth, Nova Scotia, Canada. These contain chlorophyll data...

  1. Teatrireisikiri. USA. Chicago. Aprill 2009 / Rednar Annus

    Index Scriptorium Estoniae

    Annus, Rednar, 1970-

    2009-01-01

    Chicago Improv Festivalist. Kahest nähtud lavastustest: William Gibsoni "The Miracle worker" ja Alan Bennetti "Ajaloopoisid". Kahest nähtud muusikalist: Michael Bennetti "A Corus Line" ja Disney ning Cameron Macintoshi "Mary Poppins"

  2. Uued videod ja DVD-d / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2007-01-01

    Hiina võitluskunstide film "Seitse mõõka" (režii Tsui Hark), USA õudusfilm "100 laiba maja" (Rob Zombie), Suurbritannia - Prantsusmaa komöödiafilm "Olla Stanley Kubrick" (Alan Conway, peaosas John Malkovich)

  3. 78 FR 11604 - Deposit Insurance Regulations; Definition of Insured Deposit

    Science.gov (United States)

    2013-02-19

    ..., and the banks would have to provide a legal opinion explaining how the measure eliminates the...\\ \\2\\ See FDIC Advisory Opinion 96-6, Letter of Assistant General Counsel Alan J. Kaplan (Mar. 5, 1996...

  4. Meresõiduohutus, kontroll ja järelevalve : [bakalaureusetöö] / Margit Markus ; Tartu Ülikool, õigusteaduskond ; juhendaja: Tanel Kerikmäe

    Index Scriptorium Estoniae

    Markus, Margit

    1999-01-01

    Meresõiduohutus - mõisted ja määratlused, rahvusvahelised meresõiduohutust reguleerivad aktid (konventsioonid, SOLAS, MARPOL, LL, COLREG), meresõiduohutuse alane kontroll ja järelevalve, laevade klassifitseerimine ja klassifikatsiooniühingud, vastutus

  5. Complex Hydrides for Hydrogen Storage

    Energy Technology Data Exchange (ETDEWEB)

    Slattery, Darlene; Hampton, Michael

    2003-03-10

    This report describes research into the use of complex hydrides for hydrogen storage. The synthesis of a number of alanates, (AIH4) compounds, was investigated. Both wet chemical and mechano-chemical methods were studied.

  6. How to Spot and Prevent Deep Vein Thrombosis

    Science.gov (United States)

    ... long time (such as during long car or airplane rides). Having other diseases or conditions can also ... D. Illustrator: Alan Defibaugh Attention Editors: Reprint our articles and illustrations in your own publication. Our material ...

  7. Progerock-passioon / Mari Laaniste

    Index Scriptorium Estoniae

    Laaniste, Mari, 1977-

    2006-01-01

    Briti ansambli Pink Floydi heliplaadi "The Wall" (1979) filmiversioonist. Muusikafilm "Müür" ("Pink Floyd The Wall") : stsenarist Roger Waters : režissöör Alan Parker Pinki rollis Bob Geldof : Suurbritannia 1982

  8. Mind Your Mouth: Preventing Gum Disease

    Science.gov (United States)

    ... that are red, swollen, tender or bleeding; painful chewing; and loose or sensitive teeth. In periodontitis, the ... Editor: Tianna Hicklin, Ph.D. Illustrator: Alan Defibaugh Attention Editors: Reprint our articles and illustrations in your ...

  9. What Your Nose Knows: Sense of Smell and Your Health

    Science.gov (United States)

    ... is also important for your perception of taste. Chewing your food releases aromas that travel from your ... Editor: Tianna Hicklin, Ph.D. Illustrator: Alan Defibaugh Attention Editors: Reprint our articles and illustrations in your ...

  10. Potts glass reflection of the decoding threshold for qudit quantum error correcting codes

    Science.gov (United States)

    Jiang, Yi; Kovalev, Alexey A.; Pryadko, Leonid P.

    We map the maximum likelihood decoding threshold for qudit quantum error correcting codes to the multicritical point in generalized Potts gauge glass models, extending the map constructed previously for qubit codes. An n-qudit quantum LDPC code, where a qudit can be involved in up to m stabilizer generators, corresponds to a ℤd Potts model with n interaction terms which can couple up to m spins each. We analyze general properties of the phase diagram of the constructed model, give several bounds on the location of the transitions, bounds on the energy density of extended defects (non-local analogs of domain walls), and discuss the correlation functions which can be used to distinguish different phases in the original and the dual models. This research was supported in part by the Grants: NSF PHY-1415600 (AAK), NSF PHY-1416578 (LPP), and ARO W911NF-14-1-0272 (LPP).

  11. İletişim Çalışmalarında Yeni Bir Mecra: Finansal İletişim

    Directory of Open Access Journals (Sweden)

    Gökhan Gökgöz

    2013-09-01

    Full Text Available 1970’li yıllar toplumsal ve politik tarih açısından önemli bir uğrağı temsil eder. Bu yılların başında yaşanan kriz, ekonominin işleyiş süreçlerini, devletin yapısını ve toplumsal alanın tasavvur edilme biçimini büyük ölçüde değiştirmiştir. Bu dönemde, finansal sermaye, kapitalizm içerisinde bir hegemonik lider olarak ön plana çıkmış; devlet, bir yandan üretimin çekirdeğinden uzak bir yerde konumlandırılırken diğer yandan paranın dolaşım kanallarının rehabilitasyonu işine odaklanmış; insana ilişkin değerler, kültürel mefhumlar ve toplumsal pratikler ise birer değişken olarak ekonomi-politikanın merkezine taşınmıştır. Kültür ile ekonomi arasındaki geleneksel ilişki bozulmuş; bir ekonomi-politikanın başarısı, toplumsal aktörlere temas etme kabiliyeti ile paralel hale gelmiştir. Finansallaşma sürecinde bu temas, iletişim politikaları vasıtasıyla sağlanır; ekonomi-politika ve bundan sorumlu merkezi kurumlarla toplumsal alan arasındaki bağ, iletişim stratejileri üzerinden kurulur; ekonomik alan ile kültürel alan arasındaki boşluk, iletişim kanalları içerisinden taşınan enformasyon marifetiyle doldurulur; insana ilişkin öngörülemezlikler, iletişim süreçleri vasıtasıyla öngörülebilir kılınır. Bu çalışmada, iletişim çalışmaları içerisinde yeni bir mecra olarak çağrılan “finansal iletişim”in farklı temas noktalarına işaret edilecek ve her bir uğrağın finansal iletişim alanına bağlandığı nokta, modeller üzerinden gösterilecektir. 

  12. La traducción intersemiótica en el cine de ficción

    Directory of Open Access Journals (Sweden)

    Lauro Zavala

    2009-01-01

    Full Text Available Se presenta un modelo teórico para el análisis de la traducción intersemiótica, especialmente útil en el estudio de los sistemas semióticos que son traducidos al cine (literatura, teatro, arquitectura, música, filosofía, historieta, etc.. Este modelo se apoya en la glosemática de Louis Hjelmslev, a partir de la distinción entre cuatro planos semióticos: sustancia y forma de la expresión, y forma y sustancia del contenido. El trabajo se centra en la argumentación del modelo, y en el apéndice se señalan diversos análisis de casos que expanden el alcance del artículo y señalan diversos terrenos por explorar.

  13. System level permeability modeling of porous hydrogen storage materials.

    Energy Technology Data Exchange (ETDEWEB)

    Kanouff, Michael P.; Dedrick, Daniel E.; Voskuilen, Tyler (Purdue University, West Lafayette, IN)

    2010-01-01

    A permeability model for hydrogen transport in a porous material is successfully applied to both laboratory-scale and vehicle-scale sodium alanate hydrogen storage systems. The use of a Knudsen number dependent relationship for permeability of the material in conjunction with a constant area fraction channeling model is shown to accurately predict hydrogen flow through the reactors. Generally applicable model parameters were obtained by numerically fitting experimental measurements from reactors of different sizes and aspect ratios. The degree of channeling was experimentally determined from the measurements and found to be 2.08% of total cross-sectional area. Use of this constant area channeling model and the Knudsen dependent Young & Todd permeability model allows for accurate prediction of the hydrogen uptake performance of full-scale sodium alanate and similar metal hydride systems.

  14. The Consortium for Dark Sky Studies: A Transdisciplinary Institute for Understanding the Loss of the Night

    Science.gov (United States)

    Barentine, John; Kieda, David; Goldsmith, Stephen; Foott, Bettymaya; Muir, Janet

    2018-01-01

    Research into the effects of artificial light at night (ALAN) has grown from a niche speciality into a broad field touching on aspects of life science, physics, astronomy, social science, and more, reflecting the highly interconnected subjects whose common characteristic is the alteration of the natural nighttime environment by anthropogenic light pollution. Until recently, there was no focal point for these diverse efforts to foster connections between researchers and initiate new topics of study in ALAN research. In 2016, the Consortium for Dark Sky Studies (CDSS), the world’s first organization dedicated to the study of the night and the influence of human nighttime activities on the integrity of natural darkness, was founded at the University of Utah. We describe the motivations for establishing the Consortium, its early activities, and initial outcomes of the effort.

  15. Guadalajara: ¿en búsqueda de una nueva función urbana?

    Directory of Open Access Journals (Sweden)

    Fernando Pozos Ponce

    2004-01-01

    Full Text Available En este artículo se evalúan las principales transformaciones en la estructura económica de la zona metropolitana de Guadalajara (ZMG durante la década de los años noventa y se señalan las implicaciones que éstas tienen en la función urbana de esta metrópoli y en su centralidad en la región Centro-Occidente. Además, se señalan algunas implicaciones de la llegada de inversión extranjera directa en el espacio urbano de esta ciudad, en el sentido de la dependencia que esta metrópoli regional ha desarrollado ante las estrategias de expansión y competitividad de las grandes transnacionales de la industria electrónica y de telecomunicaciones.

  16. Çevre sorunlarına etik bir yaklaşım: felsefi bir sorgulama

    OpenAIRE

    Ağbuğa, Fatma

    2016-01-01

    Çevre olmadan yaşamdan bahsetmenin mümkün olmayacağının bilincinde olan filozoflar doğal dengeyi bozucu, yok edici faaliyetlerin tek sorumlusunun insan olduğunu görmüşler ve çözüm olarak etiğin uygulamalı bir alanı olan “çevre etiği” kavramını ortaya koymuşlardır. Ancak çevre etiği 1970’lere kadar felsefenin bir disiplin alanı olarak tanınmadı. Uluslararası bilimsel alanda çevre sorunlarına felsefi bir bakış açısıyla bakan çok sayıda araştırmalar yapılmaya devam edilmesine rağmen, ülkemizde b...

  17. Interview of David Elliston Allen

    OpenAIRE

    Allen, David

    2009-01-01

    Interviewed on 12 April 1983 by Jack Goody and Alan Macfarlane and filmed and edited by Sarah Harrison. Made on old and low quality equipment. An interview of the historian and naturalist David Elliston Allen

  18. Sokali afäär : 'postmodernismi' kriitikat / Marek Tamm

    Index Scriptorium Estoniae

    Tamm, Marek, 1973-

    1997-01-01

    Kaasaegsete kultuuriteooriate kriitikast, eriti Alan D. Sokali paroodiast 'Piiride rikkudes: kvantgravitatsiooni hermeneutilise transformatsiooni poole' (Social Text 1996 (kevad-suvi), nr. 46/47) ning A. D. Sokali ja Jean Bricmont'i pamfletist 'Intellektuaalsed pettused' (Paris, 1997)

  19. Creating Healthy Habits: Make Better Choices Easier

    Science.gov (United States)

    ... O'Donnell S, Oluyomi DT, Epstein LH. Consciousness and Cognition. 2017 May;51:10-16. doi: 10.1016/ ... Editor: Tianna Hicklin, Ph.D. Illustrator: Alan Defibaugh Attention Editors: Reprint our articles and illustrations in your ...

  20. eGFR

    Science.gov (United States)

    ... Diabetes Diarrhea Disseminated Intravascular Coagulation (DIC) Down Syndrome Ebola Virus Infection Endocrine System and Syndromes Epilepsy Excessive ... See More See Less Related Images View More × Structure of a kidney. Image credit: Alan Hoofring, National ...

  1. Publications | Page 272 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Fighting the violet vampire. In the fields of sub-Saharan Africa, Alan Watson and McGill University's Weed Research Group are battling devastating parasites — naturally. Something big was happening in these agricultural fields of.

  2. Pantvangide pered loodavad valitsuse pingutustele / Anneli Ammas ; kommenteerinud Alan Fraser

    Index Scriptorium Estoniae

    Ammas, Anneli, 1962-

    2011-01-01

    Liibanonis röövitud eestlaste lähedaste kommentaare pantvangide uue videopöördumise kohta. President Toomas Hendrik Ilves algatas pantvangide toetuseks kollase lindi kandmise kampaania. Vt. ka juhtkiri lk. 2: Lootuse lindid

  3. Structural study of ball-milled sodium alanate under high pressure

    Energy Technology Data Exchange (ETDEWEB)

    Selva Vennila, R. [Center for Study of Matter at Extreme Conditions, Florida International University, Miami, FL 33199 (United States)], E-mail: selva.raju@fiu.edu; Drozd, Vadym; George, Lyci; Saxena, Surendra K. [Center for Study of Matter at Extreme Conditions, Florida International University, Miami, FL 33199 (United States); Liermann, Hanns-Peter [High Pressure Collaboration Access Team (HPCAT) and Geophysical Laboratory, Advanced Photon Source, Argonne National Laboratory, Argonne, IL 60439 (United States); Liu, H.Z. [HPCAT, Geophysical Laboratory, Carnegie Institution of Washington, Building 434E, 9700 South Cass Avenue, Argonne, Illinois 60439 (United States); Stowe, Ashley C.; Berseth, Polly; Anton, Donald; Zidan, Ragaiy [Savannah River National Laboratory, Energy Security Department, Aiken, SC 29808 (United States)

    2009-04-03

    Ball-milled NaAlH{sub 4} was studied up to 15 GPa in a diamond anvil cell (DAC) by X-ray diffraction using a synchrotron radiation source. Lattice parameters were determined from the X-ray diffraction data at various pressures up to 6.5 GPa. Intensity of the powder diffraction patterns decreased with increasing pressure. Amorphisation started at a pressure of {approx}6.5 GPa and completed at 13.5 GPa. Reversible phase transformation from amorphous phase to the tetragonal phase was observed. A fit to the pressure-volume data equation of state was obtained using the Birch-Murnaghan equation of state and the bulk modulus was found to be 52.16 {+-} 0.9 GPa which is twice higher than the unmilled NaAlH{sub 4}.

  4. Structural study of ball-milled sodium alanate under high pressure

    International Nuclear Information System (INIS)

    Selva Vennila, R.; Drozd, Vadym; George, Lyci; Saxena, Surendra K.; Liermann, Hanns-Peter; Liu, H.Z.; Stowe, Ashley C.; Berseth, Polly; Anton, Donald; Zidan, Ragaiy

    2009-01-01

    Ball-milled NaAlH 4 was studied up to 15 GPa in a diamond anvil cell (DAC) by X-ray diffraction using a synchrotron radiation source. Lattice parameters were determined from the X-ray diffraction data at various pressures up to 6.5 GPa. Intensity of the powder diffraction patterns decreased with increasing pressure. Amorphisation started at a pressure of ∼6.5 GPa and completed at 13.5 GPa. Reversible phase transformation from amorphous phase to the tetragonal phase was observed. A fit to the pressure-volume data equation of state was obtained using the Birch-Murnaghan equation of state and the bulk modulus was found to be 52.16 ± 0.9 GPa which is twice higher than the unmilled NaAlH 4

  5. Poliitbüroo Moskva välispoliitika kujundajana / Tõnu Tannberg

    Index Scriptorium Estoniae

    Tannberg, Tõnu, 1961-

    2001-01-01

    Rets.: Ken, O., Rupasov, A. Politbjuro TsK VKP(b) i otnoshenija SSSR s zapadnõmi sosednimi gosudarstvami. Sankt-Peterburg, 2000. NSV Liidu 1920. aastate lõpu ja 1930. aastate alguse välispoliitika alane uurimus

  6. Lectures on the basis of physics

    International Nuclear Information System (INIS)

    Cook, A.

    1990-09-01

    The paper contains the following three lectures given by Alan Cook at ICTP Trieste in August, 1990: ''Metrology and the Structure of Physics'', ''Why does Mathematical Physics Work?'' and ''Probability, Chaos and the Environment. 9 refs

  7. Temporal trends of preservative allergy in Denmark (1985-2008)

    DEFF Research Database (Denmark)

    Thyssen, Jacob P; Engkilde, Kåre; Lundov, Michael D

    2010-01-01

    Most cosmetics and industrial products contain preservatives. Preservative allergy is common and, historically, changing contact allergy epidemics caused by preservatives have been observed. In 1997, Alan Dillarstone predicted a stable development of preservative allergy following mandatory...

  8. Loodi töötervishoiu ja -ohutuse alase hariduse ja koolituse võrgustik Euroopas / Ulrike Bollmann

    Index Scriptorium Estoniae

    Bollmann, Ulrike

    2006-01-01

    1. oktoobril 2005. a. Hispaanias Bilboas algatatud Leonardo da Vinci projektist ENETOSH (European Network Education and Training in Occupational Safety and Health ehk Euroopa töötervishoiu ja -ohutuse alane hariduse ja koolituse võrgustik)

  9. 78 FR 10250 - Qualification of Drivers; Exemption Applications; Vision

    Science.gov (United States)

    2013-02-13

    ...) Glen T. Garrabrant (NJ) Richard A. Guthrie (MT) Glen T. Garrabrant (NJ) Richard A. Guthrie (MT) Alan L. Johnston (IL) Bryon K. Lavender (OH) Victor M. McCants (AL) James E. Menz (NY) Dennis I. Nelson (WI...

  10. Paremad filmid 6 : Põrgulik amet / Jaanus Noormets

    Index Scriptorium Estoniae

    Noormets, Jaanus

    2006-01-01

    Hongkongi põnevusfilm "Põrgulik amet" ("Mou gaan dou") : režissöörid Andrew Lau, Alan Mak : 2002. Film on aluseks Martin Scorsese uuele filmile "Kahe tule vahel" ("The Departed"). Lisa "Originaali tegija kiitis uut filmi"

  11. Antik Yunan Dönemi Karşılaştırmalı Siyaset Biliminde Siyasal Sistem Sınıflandırmalarına Genel bir Bakış

    Directory of Open Access Journals (Sweden)

    Nihat YILMAZ

    2014-01-01

    Full Text Available Siyaset Biliminin bir alt disiplini olarak karşılaştırmalı siyaset biliminin popülaritesi günümüzde gittikçe artmaktadır. Bu disiplin, farklı ülkelerin siyasal sistemleri hakkında detaylı bilgiler vermesinden dolayı fazlaca önemsenmektedir. Günümüzde ilginin giderek arttığı böyle bir alanın tarihsel geçmişi ise oldukça eski dönemlere dayanmaktadır. karşılaştırmalı siyaset bilimi alanında yapılan ilk siyasal sistem sınıflandırmaları Antik Yunan döneminde ortaya çıkmıştır. Bundan dolayı bu makalede, batı siyasal düşüncesi içerisinde yer alan Antik Yunan dönemindeki siyasal sistem sınıflandırmalarının bazı düşünürler bağlamında incelenmesi amaçlanmaktadır. Makalede, öncelikle temel kavramlar olan karşılaştırmalı siyaset bilimi ve siyasal sistem kavramlarına değinilmekte ve daha sonra Antik Yunan dönemi siyasal sistem sınıflandırmaları Heredotos, Platon ve Aristoteles örnekleri ile incelenmektedir.

  12. USA folkloristid tutvustavad Eestis afroameerika rahvamuusikat / Andres Roost

    Index Scriptorium Estoniae

    Roost, Andres

    2008-01-01

    9. veebruaril tutvustavad USA folkloristid Anna Lomax Wood ja Todd Dunham Harvey Eesti Kirjandusmuuseumi saalis Tartus John A. Lomaxi (1867-1948) ja Alan Lomaxi (1915-2002) kogutud afroameerika folkloori, näidatakse dokumentaalfilmi "Land Where the Blues Began"

  13. Reflections on Cambridge: John Maynard Keynes at King's College Cambridge

    OpenAIRE

    Macfarlane, Alan

    2012-01-01

    .mp4 video file The economist John Maynard Keynes spent much of his life in Cambridge, connected to King's College. Alan Macfarlane reflects on a few aspects of his life and work. Filmed by Xu Bei in 2010

  14. Synthesis of the hydride mixtures (1 - x)AlH3/xMgH2 (0 ≤ x ≤ 0.3) by ball milling and their hydrogen storage properties

    International Nuclear Information System (INIS)

    Iosub, V.; Matsunaga, T.; Tange, K.; Ishikiriyama, M.; Miwa, K.

    2009-01-01

    In an effort to thermodynamically stabilize the alane (i.e., to increase the desorption enthalpy), partial substitution of Mg for Al was investigated by ball milling the mixtures (1 - x)AlH 3 /xMgH 2 (x = 0.1, 0.2 and 0.3). Rietveld analysis of the XRD profiles showed that the cell volume of α-AlH 3 increased with the Mg substitution rate, and thereby formation of solid solutions was assumed (x ≤ 0.05). In agreement with the experimental results, theoretical calculations indicated that a hypothetical supercell structure (MgAl 15 )H 47 (x = 0.0625), which contained a hydrogen vacancy, was at least metastable. However, the effect of alane stabilization by Mg substitution for Al was not observed, either by experiment or by simulation, and only an increase in the activation energy was measured.

  15. Learn Unity for 2D game development

    CERN Document Server

    Thorn, Alan

    2013-01-01

    The only Unity book specifically covering 2D game development Written by Alan Thorn, experience game developer and author of seven books on game programming Hands-on examples of all major aspects of 2D game development using Unity

  16. Poliitikauuringud ja õiguspoliitika kujundamine Eestis / Peep Pruks

    Index Scriptorium Estoniae

    Pruks, Peep, 1963-

    2000-01-01

    Poliitikauuringutest lääneriikides (USA-s) ning Ida- ja Kesk-Euroopa üleminekuühiskondades. Mõttekeskustest (think tank), Eesti poliitikauuringute keskusest PRAXIS ning projektidest "Avaliku sektori ja kolmanda sektori õigusloome alane koostöö" ja "Eesti kriminaalmenetluse optimeerimine"

  17. Koinonia: The Requirements and Vision for an Unclassified Information-Sharing System

    Science.gov (United States)

    2013-06-01

    Dron 2009). Several examples are used to illustrate the cost- effective use of COTS and of secured but unclassified data stores. Obtaining...Classification Guidance Findings and Recommendations 60 Report. Government Report, Arlington: Government printing office, 2008. Dron , Alan. Special

  18. 78 FR 68037 - Membership of the National Telecommunications and Information Administration's Performance Review...

    Science.gov (United States)

    2013-11-13

    ... Human Resources Management, Office of Executive Resources, 14th and Constitution Avenue NW., Room 51010... for Spectrum Management, Career SES Alan W. Vincent, Associate Administrator for Telecommunication..., Office of Staffing, Recruitment and Classification, Department of Commerce Human Resources Operations...

  19. New TRIUMF bolsters Canadian physics

    CERN Document Server

    Gwynne, P

    2001-01-01

    Alan Shotter has been appointed director of TRIUMF. The ISAC accelerator there will be used to simulate astrophysical phenomena but the director will also be looking at ways to expand the research programme into other areas (1/2 page).

  20. Habermas, O'Connor, and Wolfe, and the Crisis of the Welfare-Capitalist State: Conservative Politics and the Roots of Educational Policy in the 1980s.

    Science.gov (United States)

    Shapiro, H. Svi

    1983-01-01

    The works of Jurgen Habermas, James O'Connor, and Alan Wolfe, key authors in the field of current U.S. educational policies, are reviewed to further understanding of current educational change in the present politics of capitalist society. (CJB)

  1. Nuclear Magnetic Resonance Spectroscopy Applications: Proton NMR In Biological Objects Subjected To Magic Angle Spinning

    International Nuclear Information System (INIS)

    Wind, Robert A.; Hu, Jian Zhi

    2005-01-01

    Proton NMR in Biological Objects Submitted to Magic Angle Spinning, In Encyclopedia of Analytical Science, Second Edition (Paul J. Worsfold, Alan Townshend and Colin F. Poole, eds.), Elsevier, Oxford 6:333-342. Published January 1, 2005. Proposal Number 10896

  2. Natalie Portman plaanib veritasu / Timo Diener

    Index Scriptorium Estoniae

    Diener, Timo

    2006-01-01

    Natalie Portman ulmepõnevikus "V nagu veritasu" ("V for Vendetta") : režissöör James McTeigue : USA - Saksamaa 2005. Aluseks on Alan Moore'i samanimeline koomiks, mille vennad Larry ja Andy Wachowski stsenaariumiks töötlesid

  3. Case Studies - Cervical Cancer

    Centers for Disease Control (CDC) Podcasts

    Dr. Alan Waxman, a professor of obstetrics and gynecology at the University of New Mexico and chair of the American College of Obstetricians and Gynecologists (ACOG) committee for the underserved, talks about several case studies for cervical cancer screening and management.

  4. ACOG Recommendations and Guidelines for Cervical Cancer Screening and Management

    Centers for Disease Control (CDC) Podcasts

    Dr. Alan Waxman, a professor of obstetrics and gynecology at the University of New Mexico and chair of the American College of Obstetricians and Gynecologists (ACOG) committee for the underserved, talks about ACOG's recommendations for cervical cancer screening and management.

  5. The development of coke smelting and the industrial revolution

    OpenAIRE

    Macfarlane, Alan

    2004-01-01

    Abraham Darby and the origins of the industrial revolution in Britain. Alan Macfarlane talks to John about the reasons for the area near Birmingham becoming the epi-centre of the industrial development, and the development of coke furnaces and iron smelting.

  6. Ostrich: Journal of African Ornithology - Vol 89, No 1 (2018)

    African Journals Online (AJOL)

    Habitat variables associated with encounters of Hottentot Buttonquail Turnix hottentottus during flush surveys across the Fynbos biome · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Alan TK Lee, Dale R Wright, Brian Reeves, 13-18 ...

  7. staff/bed and staff/patient ratios in south african public sector mental

    African Journals Online (AJOL)

    Alan J Flisher, MSc, MMed (Psych), PhD, FCPsych (SA), DCH service. ... Within the shifting ground of human resources in psychiatric care, it has become important ..... therefore provided the cruder overall figure of staff to total beds. Third, this ...

  8. Temporal trends of preservative allergy in Denmark (1985-2008)

    DEFF Research Database (Denmark)

    Thyssen, Jacob P; Engkilde, Kåre; Lundov, Michael D

    2010-01-01

    Most cosmetics and industrial products contain preservatives. Preservative allergy is common and, historically, changing contact allergy epidemics caused by preservatives have been observed. In 1997, Alan Dillarstone predicted a stable development of preservative allergy following mandatory...... ingredient labelling on cosmetic products....

  9. Future Directions - Cervical Cancer

    Centers for Disease Control (CDC) Podcasts

    Dr. Alan Waxman, a professor of obstetrics and gynecology at the University of New Mexico and chair of the American College of Obstetricians and Gynecologists (ACOG) committee for the underserved, talks about possible changes in cervical cancer screening and management.

  10. Anarchy in the U.K. / Alar Niineväli

    Index Scriptorium Estoniae

    Niineväli, Alar

    2006-01-01

    USA - Saksamaa ulmepõnevik "V nagu vendetta" ("V for Vendetta") : režissöör James McTeigue : osades Natalie Portman, Hugo Weaving : 2005. Aluseks on Alan Moore'i samanimeline koomiks, mille vennad Wachowskid stsenaariumiks töötlesid

  11. Filmitäht Johnny Depp hakkab Aleksandr Litvinenkost filmi tegema / M. P.

    Index Scriptorium Estoniae

    M. P.

    2007-01-01

    Populaarse näitleja Johnny Deppi filmistuudio Infinitum Nihil teeb põnevusfilmi näitlejaga peaosas vene hiljuti plutooniumimürgitusse surnud dissidentliku luuraja A. Litvinenko elust, aluseks veel ilmumata Alan Cowelli raamat "Sasha lugu : Vene spiooni elu ja surm"

  12. Information and Communication Technologies for Reconstruction and Development: Afghanistan Challenges and Opportunities

    Science.gov (United States)

    2008-01-01

    market advantages and provide business and employment opportunities. Businesses can use cell phones to gain access to information about their domains...and UNDP, New York, 2001. District Communications Network (DCN) Franchisee Business Case Preliminary Recommendation for the MCIT, Alan Chelko, USAID

  13. Cloning and construction of recombinant palI gene from Klebsiella oxytoca on pET-32b into E. coli BL21 (DE3) pLysS for production of isomaltulose, a new generation of sugar

    Energy Technology Data Exchange (ETDEWEB)

    Moeis, Maelita R., E-mail: sony@sith.itb.ac.id; Berlian, Liska, E-mail: sony@sith.itb.ac.id; Suhandono, Sony, E-mail: sony@sith.itb.ac.id; Prima, Alex, E-mail: sony@sith.itb.ac.id; Komalawati, Eli, E-mail: sony@sith.itb.ac.id; Kristianti, Tati, E-mail: sony@sith.itb.ac.id

    2014-03-24

    Klebsiella oxytoca produces sucrose isomerase which catalyses the conversion of sucrose to isomaltulose, a new generation of sugar. From the previous study, palI gene from Klebsiella oxytoca was succesfully isolated from sapodilla fruit (Manilkara zapota). The full-length palI gene sequence of Klebsiella oxytoca was cloned in E. coli DH5α. The deduced amino acid sequence shows 498 residues which includes conserved motif for sucrose isomerisation {sup 325}RLDRD{sup 329} and 97% identical to palI gene from Klebsiella sp. LX3 (GenBank:AAK82938.1). This fragment was succesfullly ligated into the expression vector pET-32b using overlap-extension PCR and cloned in Escherichia coli BL21 (DE3) pLysS. DNA sequencing result shows that palI gene of Klebsiella oxytoca was inserted in-frame in pET-32b. This is the first report on cloning of palI gene from Klebsiella oxytoca.

  14. Littoral Fauna of Oligochaeta (Annelida of Lake Eğirdir (Isparta.

    Directory of Open Access Journals (Sweden)

    Naime Arslan

    2015-12-01

    Full Text Available Egirdir Gölü (Isparta litoral Oligochaeta (Annelida faunası. Bu çalışma Türkiye’nin güney batısında 918 m yükseklikte yer alan (38°00'N, 30°54'E ve önemli bir kuş alanı olan Eğirdir Gölü’nün litoral Oligochaeta faunasını belirlemek amacıyla yapılmıştır. Örnekler Mayıs 2002 ile Ekim 2002 tarihleri arasında 17 istasyondan toplanmıştır. Araştırma sonucunda 17 istasyondan 15 cinse ait 22 tür; Lumbriculidae familyasından 1, Haplotaxidae familyasından 1, Tubificidae familyasından 9 ve Naididae familyasından 11 tür belirlenmiştir. Eğirdir Gölü’nün litoral Oligochaeta faunası geniş dağılım gösteren tubificid ve naidid taxalarından oluşmaktadır. Çalışma alanında Tubifex tubifex (%19.2, Limnodrilus hoffmeisteri (%17.9, ve Potamothrix hammoniensis (%11.3 ve Ophidonais serpentina (%9.3 en yüksek bolluğa sahip türler olarak belirlenmiştir. Shannon-Wiener çeşitlilik indeksine göre, Eğirdir Gölü 1.45 zenginliğe sahip olarak bulunmuş, 5. istasyon en yüksek çeşitliliği gösterirken (1.93, 11. istasyon en düşük çeşitliliğe sahip (0.97 olarak belirlenmiştir. Çalışma alanında Tubificidae populasyonunun yüksek olması ve gölün 1, 45 oranında düşük bir Oligochaeta tür çeşitliliğine sahip olması, gölün geleceğinin belirlenmesi için benzer çalışmaların periyodik olarak yapılması gerektiğini göstermektedir

  15. The revolutionary importance of coal

    OpenAIRE

    Macfarlane, Alan

    2004-01-01

    Alan Macfarlane discusses the coal revolution, the change from energy harvested from the sun through plants and animals, to the stored carbon energy of millions of years of sunlight. Filmed on a coal heap in Coalbrookdale, where the industrial revolution in England began.

  16. The Interactionist Imagination

    DEFF Research Database (Denmark)

    to the works of: Georg Simmel, Robert E. Park, George Herbert Mead, Everett C. Hughes, Herbert Blumer, Manford H. Kuhn, Erving Goffman, Harold Garfinkel, Anselm L. Strauss, Jack D. Douglas, Howard S. Becker, Stanford M. Lyman, Arlie R. Hochschild and Gary Alan Fine....

  17. Assessing the Army’s Software Patch Management Process

    Science.gov (United States)

    2016-03-04

    software maker or to antivirus vendors (Zetter, 2014). Fixing such a vulnerability within the zero-day period requires teamwork across multiple...Assessing the Army’s Software Patch Management Process Benjamin Alan Pryor March 4, 2016 PUBLISHED...19 Commercial-Off-the-Shelf Software

  18. Auger Physicists visit CMS

    CERN Multimedia

    Hoch, Michael

    2012-01-01

    Visit at CERN P5 CMS in the experimental cavern Alan Watson, Auger Spokesperson Emeritus, University of Leeds; Jim Cronin, Nobel Laureate, Auger Spokesperson Emeritus, University of Chicago; Jim Virdee, CMS Former Spokesperson, Imperial College; Jim Matthews, Auger Co-Spokesperson, Louisiana State University

  19. 76 FR 25763 - Qualification of Drivers; Exemption Applications; Vision

    Science.gov (United States)

    2011-05-05

    ... with the vision deficiency: Christopher Kahl, Althea Renita Dowell, Steven DuBois, Steve Campbell... Pulido, Oliver Murphy, Jerome Smalls, Alan Jenkins, Ryan Forsythe, Terry L. Randoll, Edward Joseph... for an exemption. Thomas L. Newingham, Joseph Barlow. The following 2 applicants do not have...

  20. Constructing, Confirming, and Contesting Icons

    DEFF Research Database (Denmark)

    Mortensen, Mette

    2017-01-01

    link between icons and their appropriations. Three sets of appropriations are analyzed of the iconic imagery of Alan Kurdi, the refugee boy drowning in the Mediterranean in 2015. First, the numerous appropriations circulated under the Twitter hashtag #humanitywashedashore. Based on genre analysis...

  1. Manganese Health Research Program (MHRP)

    Science.gov (United States)

    2008-01-01

    to Prion 21 Klein Bradley Dept. of Biomedical Sciences & Pathobiology College of Veterinary Medicine Virginia Tech, Blacksburg, VA...PhD Struve, Melanie , BS Norris, Amy, PhD Higgins, Alan, PhD 5f. WORK UNIT NUMBER 8. PERFORMING ORGANIZATION REPORT NUMBER 7

  2. Sõrve 2008 / Nicholas Wurm, Steven Buchert, Mai Buchert, Sandra Buchert...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    lapsed ja lapsevanemad Austraaliast meenutavad oma viibimist Sõrve lastelaagris: This is a story of a family from Sõrve; Nicholas Wurm - Age 9 (Adelaide); Alan and Debbie Mikkor (Melbourne); Jesse Mikkor's point of view: Age 8; Lauren Mikkor's point of view: Age 13

  3. Advanced Processing and Characterization Technologies. Fabrication and Characterization of Semiconductor Optoelectronic Devices and Integrated Circuits Held in Clearwater, Florida on 8-10 May 1991. American Vacuum Society Series 10

    Science.gov (United States)

    1992-07-01

    ichi Gonda, Osaka University, Co-Chair Yasuhiko Arakawa, University of Tokyo Hiroyoshi Matsumura, Hitachi Alan Miller, University of Central Florida...M.H.Meynadier, et al. Phys. Rev. Lett. 29(12), (1984), 7042. 84 Mesoscopic Size Fabrication Technology Yasuhiko Arakawa Research Center for Advanced

  4. Teorías del reconocimiento en la comprensión de la problemática de los campesinos y las campesinas en Colombia

    Directory of Open Access Journals (Sweden)

    María Teresa Matijasevic Arcila

    2012-07-01

    señalan los elementos de mayor relevancia para la mejor comprensión de la realidad que vive el campesinado colombiano, para retomar algunas discusiones que se han dado en el país en torno a esta temática.

  5. The Turing guide

    CERN Document Server

    Copeland, Jack; Sprevak, Mark; Wilson, Robin

    2017-01-01

    This carefully edited resource brings together contributions from some of the world's leading experts on Alan Turing to create a comprehensive guide that will serve as a useful resource for researchers in the area as well as the increasingly interested general reader.

  6. Thermal coupling of a high temperature PEM fuel cell with a complex hydride tank

    DEFF Research Database (Denmark)

    Pfeifer, P.; Wall, C.; Jensen, Jens Oluf

    2009-01-01

    the possibilities of a thermal coupling of a high temperature PEM fuel cell operating at 160-200 degrees C. The starting temperatures and temperature hold-times before starting fuel cell operation, the heat transfer characteristics of the hydride storage tanks, system temperature, fuel cell electrical power......Sodium alanate doped with cerium catalyst has been proven to have fast kinetics for hydrogen ab- and de-sorption as well as a high gravimetric storage density around 5 wt%. The kinetics of hydrogen sorption can be improved by preparing the alanate as nanocrystalline material. However, the second...... decomposition step, i.e. the decomposition of the hexahydride to sodium hydride and aluminium which refers to 1.8 wt% hydrogen is supposed to happen above 110 degrees C. The discharge of the material is thus limited by the level of heat supplied to the hydride storage tank. Therefore, we evaluated...

  7. GATT VE URUGUAY-RAUNT: GELİŞMEKTE OLAN ÜLKELERİN DÜNYA TİCARETİNDEKİ YAPISAL BAĞIMLILIKLARININ ARTMASI

    OpenAIRE

    Kartal, Zeki

    2018-01-01

       Bu makalenin problem alanını dünya pazarı ile bu pazarda ticaretin en büyük bölümünü düzenleyen GATT ve Uruguay-Raunt'u oluşturdu. Bu alanın aktörleri olarak da sanayi ülkeleri ve gelişmekte olan ülkeler seçildi. Çalışma bakımından anlamlı bulunan sorular şöyle formüle edildi: GATT ve Uruguay-Raunt'un dünya pazarında gelişmekte olan ülkelerin bağımlılığını arttırdı mı yoksa azalttı mı? GATT ve Uruguay-Raunt'un kazananları ve kaybedenleri kimlerdir?   Yukarıdaki sorulara şu m...

  8. Sosyal Pazarlama Literatür İncelemesi: Prensipler ve Teknikler Kapsamında Ele Alınan Temel Konular (1971-2014)

    OpenAIRE

    Kitapcı, Olgun; Dörtyol, İbrahim Taylan; Gülmez, Mustafa

    2018-01-01

    SosyalPazarlama kavramının doğduğu tarihten günümüze yazılmış ve Web of Science (WOS)veri tabanında yayınlanmış makalelerin, Lee ve Kotler’in 2011 yılındayazdıkları kitapta yer alan sınıflandırma çerçevesinde yorumlanmasını amaçlayanbu çalışma sözkonusu alanda zaman içerisinde hakim olan araştırma eğilimlerini ortayakoymaktadır. Bu kapsamda, ilgili veri tabanında yer alan makalelerin tamamıtaranmış ve sınıflandırılmıştır. Makalelerin temel odakları sosyal pazarlamabağlamında ele alınan temel ...

  9. Kültürel Miras için Zenginleştirilmiş Gerçeklik Uygulamaları

    Directory of Open Access Journals (Sweden)

    Erkan Bostancı

    2011-03-01

    Full Text Available Bu makale bilgisayar grafiği alanının iki ilgi çekici konusu üzerinde yapılan güncel çalışmaların bir incelemesini sunmaktadır. Geniş çalışma alanları olan Zenginleştirilmiş Gerçeklik ve İzleme alanlarında yapılan yeni çalışmalar incelenirken, özellikle de makalede bahsedilen sebeplerden dolayı kültürel miras üzerine yapılan çalışmalar vurgulanmıştır. Belirtilen uygulama türü için birçok kaynağa sahip olan ülkemizde yeni bir çalışma alanı başlamasına yardımcı olmak amacıyla bu iki çalışma alanından birçok yöntem ve örnek uygulama yüzeysel fakat açık bir dille anlatılmıştır. Bu uygulamalarda genel olarak karşılaşılan sorunlar ortaya konulup, olası çözüm önerileri sunulmuştur. Ülkemizde yapılan ilgili çalışmalardan da örnekler verildikten sonra geliştirilen örnek "Masaüstü Tarih" çalışmasıyla da anlatım pekiştirilerek somut bir örnek ortaya konmuştur.

  10. At R207

    CERN Multimedia

    CERN PhotoLab

    1976-01-01

    The photo shows the fast electronics racks of the experiment R207 by the CERN-Holland-Manchester Collaboration. R207 aimed at the study of diffraction dissociation and formation at small momentum transfers. Gerjan Bobbink and Alan Rudge stand in front of the racks.

  11. Central bank independence and political pressure in the Greenspan era

    NARCIS (Netherlands)

    Kuper, Gerard; Veurink, Jan Hessel

    2014-01-01

    This paper investigates whether political pressure from incumbent presidents influences the Fed’s monetary policy during the period that Alan Greenspan was the chairman of the United States Federal Reserve Board. A modified Taylor rule - featuring the inflation rate and the unemployment gap rather

  12. Stroke due to Familial Marfan Syndrome

    Directory of Open Access Journals (Sweden)

    M.Taylan Pekoz

    2013-04-01

    Full Text Available Marfan sendromu iskelet, okuler, kardiyovaskuler, akciger, deri ve dura anormalliklerine yol acan otozomal dominant gecisli multisistem bir hastaliktir. Bu makalede Ailesel Marfan Sendromu tanisi alan ve takip periyodunda inme gelisen bir olgu sunulmustur. . [Cukurova Med J 2013; 38(2.000: 285-289

  13. Advances in Accounting Education: Teaching and Curriculum Innovations, Volume 2.

    Science.gov (United States)

    Schwartz, Bill N., Ed.; Ketz, Edward, Ed.

    This book, published annually, contains a collection of 12 refereed, academic research papers devoted to accounting education. Papers are: (1) "The Dual Role of Critical Thinking in Accounting Education" (Mohamed E. Bayou and Alan Reinstein); (2) "Fostering Critical Thinking in Accounting Education: Implications of Analytical…

  14. 76 FR 64075 - Membership of the National Telecommunications and Information Administration's Performance Review...

    Science.gov (United States)

    2011-10-17

    ... Human Resources Operations Center (DOCHROC), Office of Staffing, Recruitment, and Classification.... Karl B. Nebbia, Associate Administrator for Spectrum Management, Career SES. Alan W. Vincent, Associate... Human Resources Operations Center. [FR Doc. 2011-26736 Filed 10-14-11; 8:45 am] BILLING CODE 3510-25-P ...

  15. 76 FR 66043 - Membership of the National Telecommunications and Information Administration's Performance Review...

    Science.gov (United States)

    2011-10-25

    ... Human Resources Operations Center (DOCHROC), Office of Staffing, Recruitment, and Classification..., Career SES. Karl B. Nebbia, Associate Administrator for Spectrum Management, Career SES. Alan W. Vincent... Commerce Human Resources Operations Center. [FR Doc. 2011-27486 Filed 10-24-11; 8:45 am] BILLING CODE 3510...

  16. South African Medical Journal - Vol 89, No 9 (1999)

    African Journals Online (AJOL)

    Measurements of iron status and survival in African iron overload · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Patrick MacPhail, Eberhard M Mandishona, Peter D Bloom, Alan C Paterson, Tracey A Rouault, Victor R Gordeuk ...

  17. Bosons & More: Celebrating CERN / Part 2

    CERN Multimedia

    Team, CERN

    2013-01-01

    The "Bosons & More" event for CERN people this evening celebrated the success of the Open Days, and the exceptional achievements of the Large Hadron Collider (LHC). The British progressive rock band the Alan Parsons Live Project lead the celebrations until late in the night.

  18. ANALYSIS OF DNA DAMAGE AND REPAIR IN SKIN FIBROBLASTS OF INFANT AND OLDER CHILDREN USING THE IN VITRO ALKALINE COMET ASSAY

    Science.gov (United States)

    ANALYSIS OF DNA DAMAGE AND REPAIR IN SKIN FIBROBLASTS OF INFANT AND OLDER CHILDREN USING THE IN VITRO ALKALINE COMET ASSAY, Alan H. Tennant1, Geremy W. Knapp1 and Andrew D. Kligerman1, 1Environmental Carcinogenesis Division, National Health and Environmental Effects Research Lab...

  19. Journal of Child and Adolescent Mental Health - Vol 21, No 2 (2009)

    African Journals Online (AJOL)

    Review Sexual coercion and adolescent risk behaviour: a systematic literature review · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Jerusha N Soomar, Alan J Flisher, Catherine Mathews. http://dx.doi.org/10.2989/JCAMH.2009.21.2.3.1011 ...

  20. Film Review Jerusalema (2008) | Hees | Journal of the Musical Arts ...

    African Journals Online (AJOL)

    Original Music: Alan Ari Lazar. Cast: Rapulana Seiphemo, Ronnie Nyakale, Jeffrey Zekele, Kenneth Nkosi, helley Meskin, Robert Hobbs, Eugene Khumbanyiwa, Jafta Mamabolo, Motlatsi Mahloko. Approx 120 min. Distributor: Next Video, Fountain Grove, 5 Second Street, Hyde Park. . Journal of the Musical Arts in Africa ...

  1. Opinion feedback

    CERN Multimedia

    2002-01-01

    Alan Clark, at the end of a holiday in Switzerland, visited the Microcosm exhibition at CERN. He was gravely disappointed. Robert Caillau [sic] explained that one of the reasons they invented the web was to avoid answering emails about their work (0.25 page)

  2. Enam-vähem otse põrgust / Mari Laaniste

    Index Scriptorium Estoniae

    Laaniste, Mari, 1977-

    2002-01-01

    Mängufilm "Põrgust" ("From Hell") : režissöörid Albert ja Allen Hughes : Ameerika Ühendriigid - Tšehhi Vabariik 2001. Analüüsitud filmi lähtekohaks olnud Alan Moore'i 1988. a. ilmunud raamatu, selle varasemate eeskujude ja filmi vahekorda

  3. 76 FR 13010 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Designation of Longer Period for...

    Science.gov (United States)

    2011-03-09

    ...; Mark G. Heesen, President, National Venture Capital Association, dated January 21, 2011; Alan F...., dated October 3, 2010; and Tom A. Alberg, Managing Director and Founder, Madrona Venture Group, dated... capitalization contemplating an initial exchange listing to raise capital, and in turn promote job creation...

  4. The social impact of sport: cross-cultural perspectives

    NARCIS (Netherlands)

    Spaaij, R.

    2011-01-01

    1. Introduction: The Social Impact of Sport: Diversities, Complexities and Contexts Ramon Spaaij Part 1: Sport development and social change: intended and unanticipated consequences 2. The Transnational View of Sport and Social Development: The Case of Dominican Baseball Alan Klein 3. The Glue that

  5. Small Classes 1, Vouchers 0.

    Science.gov (United States)

    Bracey, Gerald W.

    2000-01-01

    Alan Krueger's reanalyses of Eric Hanushek's school-productivity data show that Hanushek's "money doesn't matter" conclusions (influential in several states' education-finance hearings) have no factual basis. Hanushek excluded Tennessee's student/teacher ratio study (Project STAR). Also, class size is influencing students' success in…

  6. Savaş Alanı Turizmi: Bir Literatür Taraması

    Directory of Open Access Journals (Sweden)

    Yrd. Doç. Dr. Ozan ÇATIR

    2017-06-01

    Full Text Available The aim of this study is to examine the articles published between 1997 and 2015 on national and international issues related to battlefield tourism. The literature survey on battlefield tourism was obtained from the database of the Uşak University e-library. 51 articles from 1997 to 2015 were taken into consideration. As a result of the study, it was determined that the tourists related to the battlefields were made to determine the reasons of satisfaction, motivation and visit

  7. Yes : Aega, Sõna ja Muusikat puudutades / Alan White ; interv. Raoul Kurvitz

    Index Scriptorium Estoniae

    White, Alan

    2001-01-01

    Instrumentalistidest koosnevast briti "intellektuaal-rock"-bändist Yes. Rauno Remme ja Tõnu Kaalepi isiklikud Yesi parimate plaatide edetabelid ja arvustused: 90125 (Atlantic 1983), Close To The Egde (Atlantic 1972), Anderson, Bruford, Wakeman, Howe (Arista 1989), Union (Arista 1991), Drama(1980), Fragile(1972),Tormato(1978), Magnification(2001)

  8. 76 FR 20025 - Alan H. Olefsky, M.D.; Denial of Application

    Science.gov (United States)

    2011-04-11

    ... had received a phone call from a Ms. Schwartz, whom he did not know, and that she had asked him if he... suffer from a drug problem, an addiction to drugs based on her interviewing me and the Xanax that was... psychiatrist and addiction specialist who was involved in treating Respondent, explained that while he engaged...

  9. Are Resources Important? (Testimony of Eric Alan Hanushek, March 11, 1996).

    Science.gov (United States)

    Hanushek, Eric Alan

    1997-01-01

    E. A. Hanushek analyzed the possibility that the St. Louis (Missouri) school district could operate a quality school system with the resources it would get under the state's transition plan that would phase out state financial support for school desegregation. The witness projected no adverse effect on the quality of education in the city. (SLD)

  10. Well-Founded Belief and Perceptual Justification

    DEFF Research Database (Denmark)

    Broncano-Berrocal, Fernando

    2016-01-01

    According to Alan Millar, justified beliefs are well-founded beliefs. Millar cashes out the notion of well-foundedness in terms of having an adequate reason to believe something and believing it for that reason. To make his account of justified belief compatible with perceptual justification he...

  11. The Florida Prostate Cancer Research Training Opportunities for Outstanding Leaders (ReTOOL (registered trademark)) Program: Creating Opportunities for Minority HBCU Students

    Science.gov (United States)

    2013-03-01

    underserved. (MA Haynes & BD Smedley (Eds). National Academy Press, Washington DC. 2. Norris KC, Agodoa LY (2005). The need for health professionals... Robert Vessella, PhD University of Washington Medical Center 44 10:30 – 10:45 am S-10 A Targeted Approach to Prostate Radiotherapy Alan

  12. Kadunud linna otsinguil / Richard Woods

    Index Scriptorium Estoniae

    Woods, Richard

    2000-01-01

    University of East Londoni arheoloogiatudeng Alan Robinson leidis 1998. a. Mehhiko dzhunglist umbes aastatest 600-900 pKr pärineva linna, mis katab 12 ruutmiili suuruse ala. Seni on leitud 11 väljakut, 10 püramiidikujulist ehitist, 6 ümmargust ehitist, 11 sammast.

  13. List of Participants 1051

    Indian Academy of Sciences (India)

    Carroll Alan, Brookhaven National Laboratory, Upton, NY 11973-5000, USA acarroll@bnl.gov. Chakrabarti Dipankar, Saha Institute of Nuclear Physics, 1/AF, Bidhan Nagar, Kolkata 700 064,. India dipankar@theory.saha.ernet.in. Chakraborty Purnendu, Saha Institute of Nuclear Physics, 1/AF, Bidhan Nagar, Kolkata 700 ...

  14. The Future of Global Organizing

    NARCIS (Netherlands)

    van Tulder, Rob; Verbeke, Alain; Drogendijk, Rian

    2015-01-01

    This research and teaching volume was composed in honour of the late Alan Rugman, a distinguished thought leader, organizer and educator in the field of international business (IB). The volume addresses Rugman’s main research focus in a career that spanned almost 40 years, namely the organizational

  15. 76 FR 5107 - Regulation of Oil-Bearing Hazardous Secondary Materials From the Petroleum Refining Industry...

    Science.gov (United States)

    2011-01-28

    ... CONTACT: Alan Carpien, U.S. Environmental Protection Agency, Office of General Counsel, Mail Code 2366A... and the Louisiana Environmental Action Network (LEAN). Sierra Club and LEAN request that EPA... state whether the Sierra Club and LEAN are requesting whether EPA amend or repeal the Gasification Rule...

  16. Muusikauudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2015-01-01

    Lühisõnumeid maailmast: Grammy võitjad selgunud. Suri metsosoproan Jelena Obraztsova. Dubaisse kerkib läbipaistev ooperimaja. Lahkus pianist Aldo Ciccolini. Alan Gilbert lahkub New Yorgi Filharmoonikute juurest. Šveitsi-Romaani orkestri uueks peadirigendiks saab Jonathan Nott. Taani kammerorkester loodab "Hooandja"-laadsele toetussüsteemile jne.

  17. 32nd European Study Group with Industry, Final Report

    DEFF Research Database (Denmark)

    ESGI (European Study Group with Industry) is Europe's leading workshop for interaction between mathematicians and industry. These workshops have taken place in Great Britain for a number of years, going back to 1968 when Prof. Alan Tayler initiated the so-called Oxford Study Group with Industry...

  18. Software Technology for Adaptable Reliable Systems (STARS) Workshop Held at the Naval Research Laboratory, Washington, DC on April 9-12 1985

    Science.gov (United States)

    1985-01-01

    Barrie Baston , MITRE Mike Glasgow, IBM Geoff Mendal, Lockheed LL :8: i::6:: 856 "_--’... ISSUES 1. Define forms and provide rationale for selection: a...George Mendal, Lockheed Missiles and Space Alan Blair, General Dynamics Steve Huseth, Honeywell Miguel Carrio, Teledyne Brown Engineering Barrie Baston

  19. Folkloor bluusi sünnimaalt

    Index Scriptorium Estoniae

    2008-01-01

    9. veebruaril tutvustavad USA folkloristid Anna Lomax Wood ja Todd Dunham Harvey Eesti Kirjandusmuuseumi saalis Tartus John A. Lomaxi (1867-1948) ja Alan Lomaxi (1915-2002) kogutud afroameerika folkloori, näidatakse dokumentaalfilmi "Land Where the Blues Began" ja esineb Emajõe deltabluesi ansambel Bullfrog Brown

  20. Journal of Child and Adolescent Mental Health - Vol 24, No 1 (2012)

    African Journals Online (AJOL)

    The theory of planned behaviour as a framework for predicting sexual risk behaviour in sub-Saharan African youth: A critical review · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Cleo Protogerou, Alan J Flisher, Leif Edvard Aarø, Catherine Mathews.

  1. Baseball Physics: A New Mechanics Lab

    Science.gov (United States)

    Wagoner, Kasey; Flanagan, Daniel

    2018-01-01

    The game of baseball provides an interesting laboratory for experimenting with mechanical phenomena (there are many good examples in "The Physics Teacher," available on Professor Alan Nathan's website, and discussed in "Physics of Baseball & Softball"). We have developed a lab, for an introductory-level physics course, that…

  2. 77 FR 4056 - Outer Continental Shelf (OCS) Scientific Committee (SC); Announcement of Plenary Session

    Science.gov (United States)

    2012-01-26

    ... Hotel in Reston, Virginia. The meeting will serve as a venue to introduce the newest members of the.... ADDRESSES: Reston Sheraton Hotel, 11810 Sunrise Valley Drive Reston, Virginia, 20191, telephone (703) 620... Budget's Circular A-63, Revised. Dated: January 23, 2012. Alan Thornhill, Chief Environmental Officer...

  3. Webstrates

    DEFF Research Database (Denmark)

    Klokmose, Clemens Nylandsted; Eagan, James R.; Baader, Siemen

    2015-01-01

    We revisit Alan Kay’s early vision of dynamic media that blurs the distinction between documents and applications. We introduce shareable dynamic media that are malleable by users, who may appropriate them in idiosyncratic ways; shareable among users, who collaborate on multiple aspects of the me...

  4. Morphogenesis origins of patterns and shapes

    CERN Document Server

    Bourgine, Paul

    2010-01-01

    This collective book written for the non-specialist addresses the fundamental issue of the emergence of forms and patterns in physical and living systems. Relying on the seminal works of D’Arcy Thompson, Alan Turing and René Thom, it confronts major examples.

  5. Southern African Linguistics and Applied Language Studies - Vol 27 ...

    African Journals Online (AJOL)

    The design and use of 'alternate' assessments of academic literacy as selection mechanisms in higher education · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Alan Cliff, Monique Hanslo. http://dx.doi.org/10.2989/SALALS.2009.27.3.5.939 ...

  6. 78 FR 24707 - Fisheries of the Exclusive Economic Zone off Alaska: Fixed-Gear Commercial Halibut and Sablefish...

    Science.gov (United States)

    2013-04-26

    ... Control Number. List of Subjects in 50 CFR Part 679 Alaska, Fisheries. Dated: April 22, 2013. Alan D... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 679 [Docket No... master regulations of the Individual Fishing Quota Program (IFQ Program) for the fixed-gear commercial...

  7. Interactive Algorithms for Unsupervised Machine Learning

    Science.gov (United States)

    2015-06-01

    in Neural Information Processing Systems, 2013. 14 [3] Louigi Addario-Berry, Nicolas Broutin, Luc Devroye, and Gábor Lugosi. On combinato- rial...Myung Jin Choi, Vincent Y F Tan , Animashree Anandkumar, and Alan S Willsky. Learn- ing Latent Tree Graphical Models. Journal of Machine Learning

  8. Nüüd kunst, nüüd tulevik / Sandra Jõgeva

    Index Scriptorium Estoniae

    Jõgeva, Sandra, 1976-

    2008-01-01

    Vilniuse II rahvusvaheline graafikabiennal "Present Time. Now Art Now Future" Vilniuse Kaasaegse Kunsti Keskuses kuni 11. V. Kuraatorid Ignas Kazakevicius ja Jurate Rekeviciute. Eestist osalevad Peeter Allik, Eve Kask ja Sandra Jõgeva. Kuraator Jurate Rekeviciute biennaali alanäitusest "Valmis ajalooks" Gediminase avenüü kaubanduskeskuse galeriis

  9. The deleuzian abstract machines

    DEFF Research Database (Denmark)

    Werner Petersen, Erik

    2005-01-01

    To most people the concept of abstract machines is connected to the name of Alan Turing and the development of the modern computer. The Turing machine is universal, axiomatic and symbolic (E.g. operating on symbols). Inspired by Foucault, Deleuze and Guattari extended the concept of abstract...

  10. The Class Size Policy Debate. Working Paper No. 121.

    Science.gov (United States)

    Krueger, Alan B.; Hanushek, Eric A.

    These papers examine research on the impact of class size on student achievement. After an "Introduction," (Richard Rothstein), Part 1, "Understanding the Magnitude and Effect of Class Size on Student Achievement" (Alan B. Krueger), presents a reanalysis of Hanushek's 1997 literature review, criticizing Hanushek's vote-counting…

  11. Forum | Accelerating respect @ CERN | 5 May | Council Chamber

    CERN Multimedia

    2015-01-01

    Forum for discussion: Accelerating respect @ CERN - What does this mean in our daily working lives?   Tuesday, 5 May at 2 p.m. Council Chamber Join our forum for discussion on the topic of “Respect in the workplace” where Alan Richter will be leading a discussion on the relationship between respect and trust, including some recent research on trust, and exploring the role of unconscious bias, how respect is differently interpreted across cultures, and the connection between respect, listening, and the appreciative inquiry process. Alan Richter is the president of QED Consulting, a 26-year-old company based in New York. He has consulted to organisations in the areas of leadership, values, culture and change and is a recognised pioneer in global diversity and international ethics. He has worked with CERN, NASA, the UN and many global companies and leading universities around the world. He has a Ph.D. in Philosophy from London University, and a Master’s degree fro...

  12. Sosyal Kurumlarda Din Hizmetleri Ve Sosyal Zekâ İlişkisi

    Directory of Open Access Journals (Sweden)

    Remziye Ege

    2013-06-01

    Full Text Available Bu makale sosyal zekâ çerçevesinde din hizmetleri uygulamalarının yeniden düşünülmesi konusunda bir farkındalık oluşturmayı hedeflemektedir. İlahiyat alanındaki mesleki uygulamalara odaklanarak bu uygulamalar içinde sosyal zekânın yeri tartışılmıştır. Bu bağlamda, makalede önce sosyal zekânın ne olduğu sorusu İyi Yürekli Samaryalı Meseli (Luka 10:25-37 ile ilgili bir araştırma özelinde ele alınmakta, daha sonra ise sosyal zekânın din hizmetleri uygulamaları alanındaki etkisi değerlendirilmektedir. Makalenin son bölümünde sosyal zekâyı geliştirme yolunda bazı öneriler sunulmuştur

  13. KAMU HİZMETİ SUNUMUNDA YENİ YÖNTEMLER

    OpenAIRE

    ÇUKURÇAYIR, M. Akif; EŞKİ, Hülya

    2001-01-01

    Kamu yönetimi alanında önemli bir dönüşüm yaşanmaktadır. Dünyanın her yerinde kamu yönetimi alanında hükümetlerin yapısal ve işlevsel dönüşümünün; yönetişim yaklaşımının ortaya çıkması, yeni yurttaş-hükümet ilişkileri; kamu, özel ve hükümet dışı kuruluşlar arasında politika oluşturmanın yeni süreçleri aracılığıyla gerçekleştirildiği bilinmektedir. Yeniden yapılanma çerçevesinde şu konular gündeme gelmektedir: Devletin küçültülmesi ve etkinleştirilmesi, siyaset - yönetim dengesinin yeniden kur...

  14. SİİRT EFSANE VE HALK İNANIŞLARINDA YILAN MİTİ

    OpenAIRE

    Karakaş, Rezan

    2013-01-01

    Bu makalede, Siirt efsanelerinde yer alan yılan mitinin mitolojiden çağdaş dünyaya uzanan yolculuğunun izi sürülecektir. İki ana bölümden oluşan bu çalışmanın birinci bölümünde dünya mitolojilerinden örneklerle yılan mitinin görünümü irdelenirken, ikinci bölümünde Siirt efsanelerinde yer alan yılan unsurunun yorumlanmasına çalışılacaktır. Yılan, Siirt efsane ve halk inanışlarında çoğunlukla insanoğlunun karşısında yani ona düşmandır. Anlatılarda ölümün, yok oluşun kapısını aralayan soğuk bir ...

  15. Okul Müdürlerinin Yönetimle İlgili Görüş ve Uygulamalarının Yönetim Kuramları Bakımından Değerlendirilmesi

    OpenAIRE

    Yavuz, Mustafa

    2009-01-01

    Alan yazında yer alan örgüt ve yönetim kuramları yöneticilerinin uygulamaları, görüşleri ve araştırmalar tarafından şekillendirilmiş, ortaya çıkan bu görüş ve uygulamalar da yeni yöneticilerin uygulama ve davranışlarında yol gösterici bir rol üstlenmişlerdir. Okul müdürlerinin yönetim uygulama ve görüşlerinin yönetim kuramları bakımından değerlendirilmesinin önemli olduğu düşünülmektedir. Bu nedenle araştırmanın amacı, okul müdürlerinin yönetim uygulamalarının yönetim kuramları bakımından değ...

  16. "Give Us the Words": Protestant Faith Leaders and Sexuality Education in Their Churches

    Science.gov (United States)

    Hach, Alexa; Roberts-Dobie, Susan

    2016-01-01

    A small sample of faith leaders from the USA's three largest Mainline Protestant denominations (American Baptist, Evangelical Lutheran Church of America and Methodist) were interviewed as part of a case study regarding sexuality education in their churches. The interview schedule, based on a previous Alan Guttmacher Institute designed…

  17. Preventing Abuse by Controlling Shareholders

    NARCIS (Netherlands)

    van Damme, E.E.C.

    2012-01-01

    Abstract: This paper is a comment on Ronald Gilson and Alan Schwarz “Constraints on Private Benefits of Control: Ex Ante Control Mechanisms versus Ex Post Transaction Review”. Together with that paper it will appear in the Journal of Institutional and Theoretical Economics 169 (1) in 2013, in a

  18. First -principles calculations of the crystal structure, electronic structure, and thermodynamic stability of Be(BH4)2

    NARCIS (Netherlands)

    van Setten, Michiel J.; de Wijs, Gilles A.; Brocks, G.

    2008-01-01

    Alanates and boranates are intensively studied because of their potential use as hydrogen storage materials. In this paper, we present a first-principles study of the electronic structure and the energetics of beryllium boranate BeBH42. From total energy calculations, we show that—in contrast to the

  19. A first-principles study of the electronic structure and stability of Be(BH4)2

    NARCIS (Netherlands)

    Setten, M.J. van; Wijs, G.A. de; Brocks, G.

    2007-01-01

    Alanates and boranates are studied intensively because of their potential use as hydrogen storage materials. In this paper we present a first-principles study of the electronic structure and the energetics of beryllium boranate, Be(BH4)2. From total energy calculations we show that - in contrast to

  20. Fulltext PDF

    Indian Academy of Sciences (India)

    The Turing Test. Alan Mathison Turing (1912-1954), logician and coding theorist, is also regarded as the founder of artificial intelligence by many computer scientists. In a landmark paper, Computing. Machinery and Intelligence Mind, October. 1950,59: 433-460, Turing turned to the question. Can machines think? Rather ...

  1. Comparing rat and rabbit embryo-fetal developmental toxicity data for 379 pharmaceuticals: on systemic dose and developmental effects

    NARCIS (Netherlands)

    Peter T. Theunissen; Bruce Beyer; Sonia Beken

    2016-01-01

    And co-authors William J. Breslin, Gregg D. Cappon, Connie L. Chen, Gary Chmielewski, Luc de Schaepdrijver, Brian Enright, Jennifer E. Foreman, Wafa Harrouk, Kok-Wah Hew, Alan M. Hoberman, Julia Y. Hui, Thomas B. Knudsen, Susan B. Laffan, Susan L. Makris, Matthew Martin, Mary Ellen McNerney,

  2. Development of a Semi-Autonomous Underwater Vehicle for Intervention Missions (SAUVIM Phase III-B)

    Science.gov (United States)

    2009-03-20

    departure of Mr. James Fein from ONR, Mr. Chris Hillenbrand became the ONR Program Officer for the SAUVIM project. In 2002, Dr. David Drumheller...Dr. Gary McMurtry, Dr. Song K. Choi & Mr. Oliver T. Easterday Past Personnel: Mr. Yann Douyere, Mr. Alan Parsa & Mr. Max D. Cremer Objectives

  3. Hearings Before the Select Committee on Nutrition and Human Needs of the United States Senate, Ninety-Second Congress, First Session on Nutrition and Human Needs. Part 10--Micronutrient Supplements for School Lunch Program. Hearings Held Washington, D.C., December 7, 1971.

    Science.gov (United States)

    Congress of the U.S., Washington, DC. Senate Select Committee on Nutrition and Human Needs.

    Contents of these hearings include the statement and testimony of the following witnesses: (1) Alan Young, Research Administrator, Research and Development Division, A. H. Robins Co.; Chairman, Board of Directors, Vitamin Information Bureau; (2) Dr. Joseph M. White, Nutritional and Medical Consultant, Miles Laboratories; (3) Dr. George Briggs,…

  4. Reference Correction to: Making Air Pollution Visible: A Tool for Promoting Environmental Health Literacy.

    Science.gov (United States)

    Galkina Cleary, Ekaterina; Patton, Allison P; Wu, Hsin-Ching; Xie, Alan; Stubblefield, Joseph; Mass, William; Grinstein, Georges; Koch-Weser, Susan; Brugge, Doug; Wong, Carolyn

    2017-12-20

    [This corrects the article DOI: 10.2196/publichealth.7492.]. ©Ekaterina Galkina Cleary, Allison P Patton, Hsin-Ching Wu, Alan Xie, Joseph Stubblefield, William Mass, Georges Grinstein, Susan Koch-Weser, Doug Brugge, Carolyn Wong. Originally published in JMIR Public Health and Surveillance (http://publichealth.jmir.org), 20.12.2017.

  5. Littoral Encounters : The Shore as Cultural Interface in King Horn

    NARCIS (Netherlands)

    Sobecki, Sebastian

    2006-01-01

    1. III * Later Medieval: Excluding Chaucer -- Brown et al., 10.1093 ... ... between the Saracens and the londisse men allied to the protagonist (' Littoral Encounters: the Shore as Cultural Interface in King Horn', Al-Mas a ... www.ywes.oxfordjournals.org/cgi/content/full/man0092 2.Murray, Alan V.

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 301 - 350 of 683 ... Correlates of detection from the Fynbos biome, South Africa, with applications for population estimation, Abstract. Alan TK ... Vol 82, No 3 (2011), Inferred hybridisation, sympatry and movements of Chorister Robin-Chat Cossypha dichroa and Red-capped Robin-Chat C. natalensis, Abstract. Gregory ...

  7. African Journal of AIDS Research - Vol 1, No 1 (2002)

    African Journals Online (AJOL)

    Evidence of AIDS mortality from an alternative source: A Swaziland case study · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Alan Whiteside, Chris Desmond, John King, Jane Tomlinson, Conway Sithungo, 35-38. http://dx.doi.org/10.2989/16085906.2002.9626542 ...

  8. Review of Sowa’s Conceptual Structures.

    Science.gov (United States)

    1985-08-01

    Forbus University of Leyden Department of the Navy University of Illinois Education Research Center Washington, DC 20350-1000 Department of Computer...Box 345 San Diego, CA 92101 Boulder, CO 80302 Dr. Alan M. lesgold learning P&D Center Dr. Kathleen McKeownDr. David "lahr University of Pittsburgh

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 8. Alan Turing – The Enigma of Intelligence. Priti Shankar. Book Review Volume 2 Issue 8 August 1997 ... Author Affiliations. Priti Shankar1. Department of Computer Science and Automation, Indian Institute of Science, Bangalore 560 012, India.

  10. 75 FR 59143 - Magnuson-Stevens Fishery Conservation and Management Act; Regional Fishery Management Councils...

    Science.gov (United States)

    2010-09-27

    ... collection-of-information requirements contained in this rule may be submitted to Alan Risenhoover, Director... basis for salary of Council executive directors be put on par with that of NMFS Regional Administrators... broadened and clarified to include any income, grant, or other monetary or in-kind remuneration received by...

  11. Mälu pole ainult meil, vaid ka meie haigustel / Tiina Sarv

    Index Scriptorium Estoniae

    Sarv, Tiina, 1949-

    2007-01-01

    Pärnus toimunud Eesti arstide Astra Zeneca ABC-konverentsi märksõna oli mälu. Konverentsil esinesid professorid Endel Tulving, Alan Altraja ja Anto Raukas, dotsendid Tiina Ristimäe ja Ursel Soomets, kirjandusteadlane Rutt Hinrikus, zooloog Aleksei Turovski ning arstid Anu Ambos ja Riina Kütner

  12. Kuidas Procter & Gamble kasvas suureks / Andres Eilart

    Index Scriptorium Estoniae

    Eilart, Andres

    2004-01-01

    Maailma suurima esmatarbekaupade tootja Procter & Gamble arengust, kasvustrateegiast ja uue juhi Alan G. Lafley eesmärkidest ning tegevusest ettevõtte eesotsas. Vt. samas: Peakorter Läti asemel Eestisse?; Coca-Cola ja P&G ühisettevõte; Procter & Gamble tööstusspionaazhi kahtluse küüsis

  13. Negative freedom and the liberal paradoxes

    NARCIS (Netherlands)

    van Hees, M.V.B.P.M

    In their game-theoretic formulations, the liberal paradoxes of Amartya Sm and Alan Gibbard show a tension between freedom on the one hand, and Pareto optimality and stability on the other. This article examines what happens to the liberal paradoxes if a negative conception of freedom is used. Given

  14. The Demise of Quality? Quality Newspapers and the Information Function of Libraries on the Brink of Collapse or Resurrection?

    NARCIS (Netherlands)

    Kircz, Joost; den Boef, August Hans; Nijboer, Jelke

    2008-01-01

    In The Guardian, Alan Rushbridger compared the future of newspapers to climate change. Five years ago, many climatologists were sceptical whether climate change was a real and serious issue. Today, most scientists agree that global warm ing is a fact of life. In the world of newspapers, at present,

  15. 78 FR 68151 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2013-11-13

    ... CLAUDIA FRIEDLANDER ROBERT MAX FRIESEN KATHLEEN ELLEN FUKUNAGA MIWA FULLER NICHOLAS ALAN FULLER NICHOLAS... SHIPLEY ROBERT ANTHONY SIM JEONG SUN SIMON ANTHONY NICHOLAS SIMON JULIE ANN SINN JUSTINE TUNG SITTARO... JAMES TAN YANQIANG TANAKA RYO TANG MARX THERN EDINA RITTER THERN JR ROBERT WILLIAM TIEN LAUREN TSAK YEN...

  16. 75 FR 9028 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2010-02-26

    ... YOKO MORI CO DANIEL GLENN COHEN DANIEL COHEN SHARONNA COLLINS THOMAS MICHAEL COOK RICHARD S CORDANI... CAROLINA UTA ALAN COOPER THOMAS ALLEN CHRISTOPHER DAVID ALY-STAVRINOU KATHERINE LILLIAN ANDERSEN PAUL EINAR... PETER C ERSKINE DOUGLAS GRAHAM EU KELVIN HAN FAGG THOMAS EARL FARRELL DOUGLAS FERGUSON ANNA YIP FERLAINO...

  17. Lift Enhancement Using Close-Coupled Canard/Wing Vortex Interaction

    Science.gov (United States)

    1990-12-01

    8217M - 4U4 Richard M. Howard, Thesis Advisor Louis V. Schmidt, Second Reader E. Roberts Wood, Chairman Department of Aeronautics and Astronautics ii...Pope, Alan, Low-Speed Wind Tunnel Testing, John Wiley and Sons, Inc., 1984. 19. Raymer , Daniel P., Aircraft Design: a Conceptual Approach, AIAA, Inc

  18. Heterogeneous Sensor Webs for Automated Target Recognition and Tracking in Urban Terrain

    Science.gov (United States)

    2012-04-09

    Alan Willsky. A Sticky HDP-HMM with Application to Speaker Diarization , Annals of Applied Statistics, (02 2011): 0. doi: 2012/04/01 18:46:19 156...Willsky, A Sticky HDP-HMM with Application to Speaker Diarization , Annals of Applied Statistics, June 2011. [59] Arvind Ganesh, Andrew Wagner, John

  19. Informe sobre la Tercera Conferencia Internacional "Crimea 96".

    OpenAIRE

    Hopkinson, Alan

    1996-01-01

    El Distribuidor Nacional de Argentina agradece al Sr. Alan Hopkinson la autorización para la traducción al español de su informe, y a la Revista InfoISIS por realizar dicha traducción y permitir su inclusión en nuestra Home Page.

  20. Illusionary Inclusion--What Went Wrong with New Labour's Landmark Educational Policy?

    Science.gov (United States)

    Hodkinson, Alan

    2012-01-01

    This article examines the emergence and evolution of New Labour's landmark educational policy; namely that of inclusion. The author, Alan Hodkinson, associate professor at the Centre for Cultural and Disability Studies at Liverpool Hope University, illuminates his conceptual difficulties in attempting to define what inclusion was and what…

  1. The great industrial boatyard of Venice

    OpenAIRE

    Macfarlane, Alan

    2004-01-01

    The arsenal or boat building centre of Venice in the middle ages was one of the greatest industrial centres in the world. Through a mechanical division of work and high precision it turned out ships very rapidly and inspired Dante’s vision of ‘Inferno’. Explained by Alan Macfarlane.

  2. 2005 Tri-Service Infrastructure Systems Conference and Exhibition. Volume 1, Track 1

    Science.gov (United States)

    2005-08-04

    Alan Tool Sediment Impact Assessment Model (SIAM), by David S. Biedenharn and Meg Jonas Mississippi River Sedimentation Study, by Basil Arthur Sediment...Questionnaire Client Report Reports Criteria/Lesson Learned Project Details PRO JEC TS DAT ABA SE 9 eProjects 1. Business Line CIBL Program ANY MILCON 2

  3. What to Buy? The Role of Director of Defense Research and Engineering (DDR&E) Lessons from the 1970s

    Science.gov (United States)

    2011-01-01

    M. Thorndike , “Antisubmarine Warfare in World War II,” OEG Report No. 51 (Washington, DC: Operations Evaluation Group, 1946). The authors were not...Sternhell, Charles M. and Alan M. Thorndike . “Antisubmarine Warfare in World War II.” OEG Report No. 51. Washington, DC: Operations Evaluation Group

  4. REKLAMLARDA ÜNLÜ KULLANIMINDA CİNSİYETİN MARKA İMAJI ÜZERİNDEKİ ETKİSİ

    Directory of Open Access Journals (Sweden)

    Ceyda DENEÇLİ

    2015-09-01

    Full Text Available Özet.rünlerle ilişkili gerek kültürel gerekse faydacı anlamları tüketicilere aktarmaya yardımcı olan reklamlardatüketicileri ikna etmek amacıyla ünlü kullanımına yer verildiği g.rülmektedir. Tüketicilerin reklamdayer alan ünlü kişileri uzman, güvenilir, inanılır bulması, bu kişileri sevmesi, beğenmesi vb. faktörlertüketicilerin reklama karşı tutumlarını etkileyebilmekte ve bu durum tüketicilerin marka imajına ilişkindeğerlendirmelerinde farklılıklara neden olabilmektedir. Ancak reklamda yer alan ünlünün cinsiyeti dereklam mesajını alan bireylerin reklama karşı tutumlarında farklılıklara yol açabilmektedir. Çalışmadareklamlarda kullanılan ünlülerinin erkek ya da kadın olmasının marka imajı üzerindeki etkisinin belirlenmesiamaçlanmıştır. Araştırmada kadın ve erkek ünlünün yer aldığı iki reklam tüketicilere gösterilmiş vetüketicilerin reklama karşı tutumlarının marka imajına yönelik algılamalarındaki değişiklik üzerindekietkisi belirlenmiştir. Araştırmanın sonuçlarına göre reklamda ünlü kullanımının marka ile ilgili algıyıolumlu yönde etkilediği g.rülmektedir. Ayrıca reklamda yer alan ünlünün cinsiyetinin kadın olmasının,hem kadın hem erkek tüketicilerin marka imajına ilişkin değerlendirmelerini, reklamda kullanılan ünlününerkek olmasına göre daha olumlu etkilediği saptanmıştır.

  5. Preventing abuse by controlling shareholders

    NARCIS (Netherlands)

    van Damme, E.E.C.

    2013-01-01

    This paper is a comment on Ronald Gilson and Alan Schwarz “Constraints on Private Benefits of Control: Ex Ante Control Mechanisms versus Ex Post Transaction Review”. Together with that paper it will appear in the Journal of Institutional and Theoretical Economics 169 (1) in 2013, in a special issue

  6. The new genetics and the public's health

    National Research Council Canada - National Science Library

    Bunton, Robin; Petersen, Alan R., Ph. D

    2002-01-01

    ...; discusses the role of the media in framing debate about genetics, health and medicine. The New Genetics and the Public's Health addresses the emerging social and political consequences of the new genetics and provides a stimulating critique of current research and practice in public health. Alan Petersen is Professor in Sociolo...

  7. Current Uses of Artificial Intelligence in Special Education. Abstract XI: Research & Resources on Special Education.

    Science.gov (United States)

    ERIC Clearinghouse on Handicapped and Gifted Children, Reston, VA.

    Summarized are two reports of a federally funded project on the use of artificial intelligence in special education. The first report, "Artificial Intelligence Applications in Special Education: How Feasible?," by Alan Hofmeister and Joseph Ferrara, provides information on the development and evaluation of a series of prototype systems in special…

  8. Surrender - A Soldier’s Legal, Ethical, and Moral Obligations; with Philippine Case Study.

    Science.gov (United States)

    1989-06-02

    69 - this view. Contemporary philosophers John Rawles , Alan Gerwirth, and Henry Shue, among others, express the conviction that each person can claim a...34 Machiavelli , Management, and Moral Leadership," in Military Ethics, edited by Wakin, Wenker, and Kempf, p.38. 48 Ibid., pp. 41 and 44. 49 Morris Janowitz

  9. Intelligent Testing: Integrating Psychological Theory and Clinical Practice

    Science.gov (United States)

    Kaufman, James C., Ed.

    2009-01-01

    The field of intelligence testing has been revolutionized by Alan S. Kaufman. He developed the Wechsler Intelligence Scale for Children-Revised (WISC-R) with David Wechsler, and his best-selling book, Intelligent Testing with the WISC-R, introduced the phrase "intelligent testing." Kaufman, with his wife, Nadeen, then created his own…

  10. 77 FR 61559 - Endangered and Threatened Wildlife; 90-Day Finding on a Petition To List Nassau Grouper as...

    Science.gov (United States)

    2012-10-10

    ... Petition To List Nassau Grouper as Threatened or Endangered Under the Endangered Species Act AGENCY... endangered under the Endangered Species Act (ESA). We find that the petition presents substantial scientific... the Endangered Species Act of 1973, as amended (16 U.S.C. 1531 et seq.). Dated: October 2, 2012. Alan...

  11. Development of a Semi-Autonomous Underwater Vehicle for Intervention Missions (SAUVIM Phase III-C)

    Science.gov (United States)

    2010-01-28

    James Fein from ONR, Mr. Chris Hillenbrand became the ONR Program Officer for the SAUVIM project. In 2002, Dr. David Drumheller became the new ONR...Gary McMurtry, Dr. Song K. Choi & Mr. Oliver T. Easterday Past Personnel: Mr. Yann Douyere, Mr. Alan Parsa & Mr. Max D. Cremer Objectives The

  12. Reference: 248 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 248 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16045474i Singh Sunil Kumar... the animal exostosins. 3 384-97 16045474 2005 Aug The Plant journal Eland Cathlene|Harholt Jesper|Marchant Alan|Scheller Henrik Vibe|Singh Sunil Kumar

  13. Rational Thinking in School-Based Practice

    Science.gov (United States)

    Clark, Mary Kristen; Flynn, Perry

    2011-01-01

    Purpose: We reflect on Alan Kamhi's (2011) prologue on balancing certainty and uncertainty as it pertains to school-based practice. Method: In schools, rational thinking depends on effective team processes, much like professional learning communities. We consider the conditions that are required for rational thinking and how rational team dialogue…

  14. Did We Have Science before 1988?

    Science.gov (United States)

    Peacock, Alan; Dunne, Mick

    2014-01-01

    In this "Primary Science" interview, science educators Alan Peacock and Mick Dunne reflect on their own experiences of what science was like in England before a National Curriculum was introduced. Among the topics covered are: earliest memories of science in school, teaching science before 1988 (pre-science curriculum for primary…

  15. Retirement, Work, and Lifelong Learning; Hearing Before the Special Committee on Aging, Ninety-Fifth Congress, Second Session. Part 3.

    Science.gov (United States)

    Arizona State Dept. of Economic Planning and Development, Phoenix.

    The transcripts of the testimony given before the Senate Committee by the Chairman of the Civil Service Commission, Alan Campbell, and Stanley Babson, management consultant and former vice president of finance for Technicon Corporation, are presented. Statements address the following issues of concern: age discrimination, management of job skills,…

  16. Advances in Serials Management. Volume 6.

    Science.gov (United States)

    Hepfer, Cindy, Ed.; Gammon, Julia, Ed.; Malinowski, Teresa, Ed.

    In order to further discussion and support constructive change, this volume presents the following eight papers on various dimensions of serials management: (1) "CD-ROMs, Surveys, and Sales: The OSA [Optical Society of America] Experience" (Frank E. Harris and Alan Tourtlotte); (2) "Management and Integration of Electronic Journals into the…

  17. Fulltext PDF

    Indian Academy of Sciences (India)

    computer science. The award is named after Alan Turing, inventor of the. Turing machine, articulator of the limits of computing, and a key player in the. Allied breaking of the German Enigma cipher in World War II. The award ... Cocke in 1971, she provided a systematic categorization of code improvement transformations.

  18. Beyond Robotic Wastelands of Time: Abandoned Pedagogical Agents and "New" Pedalled Pedagogies

    Science.gov (United States)

    Savin-Baden, Maggi; Tombs, Gemma; Bhakta, Roy

    2015-01-01

    Chatbots, known as pedagogical agents in educational settings, have a long history of use, beginning with Alan Turing's work. Since then online chatbots have become embedded into the fabric of technology. Yet understandings of these technologies are inchoate and often untheorised. Integration of chatbots into educational settings over the past…

  19. Juhuslik urbanism / Keiti Kljavin, Kaie Kuldkepp

    Index Scriptorium Estoniae

    Kljavin, Keiti

    2011-01-01

    Eesti Kunstiakadeemia urbanistika ja linnamaastiku õppetooli koostööna 14.-17. aprillini peetud 8. urbanistika ja linnamaastiku päevadest. Rahvusvahelisest konverentsist "Juhuslik urbanism" ("Incidental Urbanism"). Klaske Haviku, Alan Prohmi, Maro Krivý ja Lieven Ameeli ettekannetest. Näitusest projektiruumis März. Ettevõtmistest linnas ja linnast väljas

  20. 77 FR 11157 - Remanufactured Goods: An Overview of the U.S. and Global Industries, Markets, and Trade; Change...

    Science.gov (United States)

    2012-02-24

    ... the U.S. and Global Industries, Markets, and Trade; Change in Start Time of Public Hearing AGENCY... investigation No. 332-525, Remanufactured Goods: An Overview of the U.S. and Global Industries, Markets, and... INFORMATION CONTACT: Project Leader Alan Treat (202-205- 3426 or [email protected] ), Deputy Project Leader...