WorldWideScience

Sample records for aaa subgrupo cavendish

  1. Avaliação de clones de bananeira do subgrupo Cavendish (Musa acuminata, AAA em Cruz das Almas-BA Evaluation of banana Cavendish clones in Cruz das Almas City, Bahia State, Brazil

    Directory of Open Access Journals (Sweden)

    Sebastião de Oliveira e Silva

    2004-12-01

    Full Text Available Foram avaliados em Cruz das Almas-BA, em dois ciclos, 69 clones Cavendish coletados em São Paulo, Minas Gerais, Bahia e Santa Catarina, sendo 49 do tipo Nanicão e 20 do tipo Grande Naine. Os clones foram estabelecidos em área experimental da Embrapa Mandioca e Fruticultura utilizando-se um delineamento em blocos ao acaso com cinco repetições e cinco plantas por parcela. Foram utilizados a irrigação por microaspersão, o espaçamento de 3,0 m x 2,0 m e um sistema de condução com três plantas/touceira. Os requerimentos agronômicos foram aplicados conforme preconizados para o cultivo. Na avaliação dos clones, foram consideradas as seguintes variáveis: altura da planta em centímetros (AP; número de dias do plantio à colheita (ND; peso do cacho em quilogramas (PC; número de frutos por cacho (NF; e comprimento do fruto em centímetros (CF. Pelos resultados obtidos, verificou-se uma variabilidade média em todas as variáveis avaliadas. Por apresentarem caracteres superiores, foram selecionados cinco clones de Grande Naine (G.N. Taperão, G.N.Rossete, G.N. Willians, G.N. Magário, G.N. SC-074 e quatro de Nanicão (N. IAC Abóbada Verde, N. Rossete, N. SC-0008 e N. SC-063.Sixty-nine clones of Cavendish type bananas (49 Nanicão and 20 Grande Naine collected in the States of São Paulo, Minas Gerais, Bahia and Santa Catarina were evaluated. The clones were established in an experimental area at the Cassava and Fruit Crops Research Center - EMBRAPA, using micro-aspersion irrigation, in plants spaced at 3.0 m x 2.0 m, and conducted with three plants/bushes. Random blocks were used with five replications and five plants per plot. All cultural requirements for the crop were carried out. For the clone evaluations, the following variables were considered: plant height in centimeters (PH; number of days from planting to yield (ND; weight of bunch in kilograms (WB; number of fruits per bunch (FB and length of fruit in centimeters (LF. The

  2. Effect of microgravity simulation using 3D clinostat on cavendish banana (Musa acuminata AAA Group) ripening process

    Science.gov (United States)

    Dwivany, Fenny Martha; Esyanti, Rizkita R.; Prapaisie, Adeline; Puspa Kirana, Listya; Latief, Chunaeni; Ginaldi, Ari

    2016-11-01

    The objective of the research was to determine the effect of microgravity simulation by 3D clinostat on Cavendish banana (Musa acuminata AAA group) ripening process. In this study, physical, physiological changes as well as genes expression were analysed. The result showed that in microgravity simulation condition ripening process in banana was delayed and the MaACOl, MaACSl and MaACS5 gene expression were affected.

  3. Activation of salicylic acid metabolism and signal transduction can enhance resistance to Fusarium wilt in banana (Musa acuminata L. AAA group, cv. Cavendish).

    Science.gov (United States)

    Wang, Zhuo; Jia, Caihong; Li, Jingyang; Huang, Suzhen; Xu, Biyu; Jin, Zhiqiang

    2015-01-01

    Fusarium wilt caused by the fungus Fusarium oxysporum f. sp. cubens (Foc) is the most serious disease that attacks banana plants. Salicylic acid (SA) can play a key role in plant-microbe interactions. Our study is the first to examine the role of SA in conferring resistance to Foc TR4 in banana (Musa acuminata L. AAA group, cv. Cavendish), which is the greatest commercial importance cultivar in Musa. We used quantitative real-time reverse polymerase chain reaction (qRT-PCR) to analyze the expression profiles of 45 genes related to SA biosynthesis and downstream signaling pathways in a susceptible banana cultivar (cv. Cavendish) and a resistant banana cultivar (cv. Nongke No. 1) inoculated with Foc TR4. The expression of genes involved in SA biosynthesis and downstream signaling pathways was suppressed in a susceptible cultivar and activated in a resistant cultivar. The SA levels in each treatment arm were measured using high-performance liquid chromatography. SA levels were decreased in the susceptible cultivar and increased in the resistant cultivar. Finally, we examined the contribution of exogenous SA to Foc TR4 resistance in susceptible banana plants. The expression of genes involved in SA biosynthesis and signal transduction pathways as well as SA levels were significantly increased. The results suggest that one reason for banana susceptibility to Foc TR4 is that expression of genes involved in SA biosynthesis and SA levels are suppressed and that the induced resistance observed in banana against Foc TR4 might be a case of salicylic acid-dependent systemic acquired resistance.

  4. Comparative biochemical analysis after steam pretreatment of lignocellulosic agricultural waste biomass from Williams Cavendish banana plant (Triploid Musa AAA group).

    Science.gov (United States)

    Kamdem, Irénée; Jacquet, Nicolas; Tiappi, Florian Mathias; Hiligsmann, Serge; Vanderghem, Caroline; Richel, Aurore; Jacques, Philippe; Thonart, Philippe

    2015-11-01

    The accessibility of fermentable substrates to enzymes is a limiting factor for the efficient bioconversion of agricultural wastes in the context of sustainable development. This paper presents the results of a biochemical analysis performed on six combined morphological parts of Williams Cavendish Lignocellulosic Biomass (WCLB) after steam cracking (SC) and steam explosion (SE) pretreatments. Solid (S) and liquid (L) fractions (Fs) obtained from SC pretreatment performed at 180°C (SLFSC180) and 210°C (SLFSC210) generated, after diluted acid hydrolysis, the highest proportions of neutral sugar (NS) contents, specifically 52.82 ± 3.51 and 49.78 ± 1.39%w/w WCLB dry matter (DM), respectively. The highest proportions of glucose were found in SFSC210 (53.56 ± 1.33%w/w DM) and SFSC180 (44.47 ± 0.00%w/w DM), while the lowest was found in unpretreated WCLB (22.70 ± 0.71%w/w DM). Total NS content assessed in each LF immediately after SC and SE pretreatments was less than 2%w/w of the LF DM, thus revealing minor acid autohydrolysis consequently leading to minor NS production during the steam pretreatment. WCLB subjected to SC at 210 °C (SC210) generated up to 2.7-fold bioaccessible glucan and xylan. SC and SE pretreatments showed potential for the deconstruction of WCLB (delignification, depolymerization, decrystallization and deacetylation), enhancing its enzymatic hydrolysis. The concentrations of enzymatic inhibitors, such as 2-furfuraldehyde and 5-(hydroxymethyl)furfural from LFSC210, were the highest (41 and 21 µg ml(-1), respectively). This study shows that steam pretreatments in general and SC210 in particular are required for efficient bioconversion of WCLB. Yet, biotransformation through biochemical processes (e.g., anaerobic digestion) must be performed to assess the efficiency of these pretreatments. © The Author(s) 2015.

  5. Molecular cloning and expression of five glutathione S-transferase (GST) genes from Banana (Musa acuminata L. AAA group, cv. Cavendish).

    Science.gov (United States)

    Wang, Zhuo; Huang, Suzhen; Jia, Caihong; Liu, Juhua; Zhang, Jianbin; Xu, Biyu; Jin, Zhiqiang

    2013-09-01

    Three tau class MaGSTs responded to abiotic stress, MaGSTF1 and MaGSTL1 responded to signaling molecules, they may play an important role in the growth of banana plantlet. Glutathione S-transferases (GST) are multifunctional detoxification enzymes that participate in a variety of cellular processes, including stress responses. In this study, we report the molecular characteristics of five GST genes (MaGSTU1, MaGSTU2, MaGSTU3, MaGSTF1 and MaGSTL1) cloned from banana (Musa acuminate L. AAA group, cv. Cavendish) using a RACE-PCR-based strategy. The predicted molecular masses of these GSTs range from 23.4 to 27.7 kDa and their pIs are acidic. At the amino acid level, they share high sequence similarity with GSTs in the banana DH-Pahang (AA group) genome. Phylogenetic analysis showed that the deduced amino acid sequences of MaGSTs also have high similarity to GSTs of other plant species. Expression analysis by semi-quantitative RT-PCR revealed that these genes are differentially expressed in various tissues. In addition, their expression is regulated by various stress conditions, including exposure to signaling molecules, cold, salinity, drought and Fusarium oxysporum f specialis(f. Sp) cubense Tropical Race 4 (Foc TR4) infection. The expression of the tau class MaGSTs (MaGSTU1, MaGSTU2 and MaGSTU3) mainly responded to cold, salinity and drought while MaGSTF1 and MaGSTL1 expressions were upregulated by signaling molecules. Our findings suggest that MaGSTs play a key role in both development and abiotic stress responses.

  6. Comparative biochemical analysis during the anaerobic digestion of lignocellulosic biomass from six morphological parts of Williams Cavendish banana (Triploid Musa AAA group) plants.

    Science.gov (United States)

    Kamdem, Irénée; Hiligsmann, Serge; Vanderghem, Caroline; Bilik, Igor; Paquot, Michel; Thonart, Philippe

    2013-12-01

    We studied banana lignocellulosic biomass (BALICEBIOM) that is abandoned after fruit harvesting, and assessed its biochemical methane potential, because of its potential as an energy source. We monitored biogas production from six morphological parts (MPs) of the "Williams Cavendish" banana cultivar using a modified operating procedure (KOP) using KOH. Volatile fatty acid (VFA) production was measured using high performance liquid chromatography. The bulbs, leaf sheaths, petioles-midribs, leaf blades, rachis stems, and floral stalks gave total biogas production of 256, 205, 198, 126, 253, and 221 ml g⁻¹ dry matter, respectively, and total biomethane production of 150, 141, 127, 98, 162, and 144 ml g⁻¹, respectively. The biogas production rates and yields depended on the biochemical composition of the BALICEBIOM and the ability of anaerobic microbes to access fermentable substrates. There were no significant differences between the biogas analysis results produced using KOP and gas chromatography. Acetate was the major VFA in all the MP sample culture media. The bioconversion yields for each MP were below 50 %, showing that these substrates were not fully biodegraded after 188 days. The estimated electricity that could be produced from biogas combustion after fermenting all of the BALICEBIOM produced annually by the Cameroon Development Corporation-Del Monte plantations for 188 days is approximately 10.5 × 10⁶ kW h (which would be worth 0.80-1.58 million euros in the current market). This bioenergy could serve the requirements of about 42,000 people in the region, although CH₄ productivity could be improved.

  7. Effect of physiological harvest stages on the composition of bioactive compounds in Cavendish bananas*

    Science.gov (United States)

    Bruno Bonnet, Christelle; Hubert, Olivier; Mbeguie-A-Mbeguie, Didier; Pallet, Dominique; Hiol, Abel; Reynes, Max; Poucheret, Patrick

    2013-01-01

    The combined influence of maturation, ripening, and climate on the profile of bioactive compounds was studied in banana (Musa acuminata, AAA, Cavendish, cv. Grande Naine). Their bioactive compounds were determined by the Folin-Ciocalteu assay and high-performance thin layer chromatographic (HPTLC) method. The polyphenol content of bananas harvested after 400 degree days remained unchanged during ripening, while bananas harvested after 600 and 900 degree days exhibited a significant polyphenol increase. Although dopamine was the polyphenol with the highest concentration in banana peels during the green developmental stage and ripening, its kinetics differed from the total polyphenol profile. Our results showed that this matrix of choice (maturation, ripening, and climate) may allow selection of the banana (M. acuminata, AAA, Cavendish, cv. Grande Naine) status that will produce optimal concentrations of identified compounds with human health relevance. PMID:23549844

  8. Manejo alternativo de sigatoka negra, utilizando biofertilizantes, en plantaciones comerciales de banano cavendish, variedad williams, canton taura

    OpenAIRE

    Maura, Luis; Maria Isabel, Jimenez

    2009-01-01

    El proyecto se oriento al estudio del efecto de los biofertilizantes líquidos en un predio bananero comercial con un sistema de producción orgánico, situado en la provincia de El Guayas. El material vegetal fue banano, Grupo Cavendish, variedad Williams (AAA). Los biofertilizantes en estudio fueron productos orgánicos del tipo foliar y radicular en comparación con sus mezclas y un control absoluto (no aplicación). La hacienda elabora sus productos a base de estiércol fresco de ganado vacuno,...

  9. AAAS: Politics. . . and Science

    Science.gov (United States)

    Science News, 1978

    1978-01-01

    Reviews topics discussed during the American Association for the Advancement of Science (AAAS) meeting held in Washington, D.C. Topics included: the equal rights amendment, laetrile, nuclear radiation hazards, sociobiology, and various science topics. (SL)

  10. Chemical and microbiological interactions between soils and roots in commercial banana plantations (Musa AAA, cv. Cavendish)

    NARCIS (Netherlands)

    Segura Mena, R.; Serrano, E.; Pocasangre, L.; Acuna, O.; Bertsch, F.; Stoorvogel, J.J.; Sandoval, J.A.

    2015-01-01

    A study was performed to determine the relationships between soil chemical and microbiological con-ditions and how they impact soil production. The study was carried out on six Costa Rican commercialbanana farms with high, medium and low productivity. In each of the farms sector with relatively

  11. Improved tolerance toward fungal diseases in transgenic Cavendish banana (Musa spp. AAA group) cv. Grand Nain.

    Science.gov (United States)

    Vishnevetsky, Jane; White, Thomas L; Palmateer, Aaron J; Flaishman, Moshe; Cohen, Yuval; Elad, Yigal; Velcheva, Margarita; Hanania, Uri; Sahar, Nachman; Dgani, Oded; Perl, Avihai

    2011-02-01

    The most devastating disease currently threatening to destroy the banana industry worldwide is undoubtedly Sigatoka Leaf spot disease caused by Mycosphaerella fijiensis. In this study, we developed a transformation system for banana and expressed the endochitinase gene ThEn-42 from Trichoderma harzianum together with the grape stilbene synthase (StSy) gene in transgenic banana plants under the control of the 35S promoter and the inducible PR-10 promoter, respectively. The superoxide dismutase gene Cu,Zn-SOD from tomato, under control of the ubiquitin promoter, was added to this cassette to improve scavenging of free radicals generated during fungal attack. A 4-year field trial demonstrated several transgenic banana lines with improved tolerance to Sigatoka. As the genes conferring Sigatoka tolerance may have a wide range of anti-fungal activities we also inoculated the regenerated banana plants with Botrytis cinerea. The best transgenic lines exhibiting Sigatoka tolerance were also found to have tolerance to B. cinerea in laboratory assays.

  12. Study of banana (Musa aaa Cavendish cv Nanica trigger ripening for small scale process

    Directory of Open Access Journals (Sweden)

    Fábio Donato Soares Larotonda

    2008-10-01

    Full Text Available The present work focuse on the impact of O2, CO2 and ethylene concentrations on ripening rate control of bananas as a contribution for the development of domestic equipments that could allow the user to drive the fruit shelf live. It represented the adjustment of metabolic activity rates in order to manage the maturity process. Ripening variables such as ethylene and CO2 concentrations and temperature were adjusted to accelerate or slow down the process, while the maturity degree was monitored through the physical and chemical parameters and sensorial analysis. Therefore, the objective of this work was to evaluate the influence of these parameters to manage the banana ripening. The optimum temperature was at 25 ºC of storage. The presence of oxygen, CO2 withdraws and ethylene injection were relevant for the ripening process. The "ready-to-eat" quality was achieved in 6 days in confined system. The use of ethylene as trigger was adequate to accelerate the ripening process with advantages in fruit color.O presente trabalho foca no impacto da concentração de O2, CO2 e etileno no controle da taxa de amadurecimento de bananas, como contribuição para o desenvolvimento de equipamentos domésticos que permitam o controle pelo próprio usuário da vida de prateleira de frutas. Isto representa o ajuste das atividades metabólicas para garantir o controle do amadurecimento. Variáveis como concentração de etileno e CO2 e temperatura foram ajustadas para acelerar ou reduzir o processo, enquanto que o grau de maturação foi monitorado através de parâmetros físico-químicos e sensoriais. Desta forma, o objetivo deste trabalho foi avaliar a influência destes parâmetros para controlar o amadurecimento de banana. A temperatura ótima de amadurecimento foi 25ºC. A presença de O2, a retirada de CO2 e a injeção de etileno foram relevantes no processo. A qualidade "pronto-para-consumo" foi obtida em 6 dias em sistema confinado. O uso de etileno como gatilho é adequado para acelerar o amadurecimento, com vantagens para a cor do produto.

  13. Digital bedrock geologic map of the Cavendish quadrangle, Vermont

    Data.gov (United States)

    Vermont Center for Geographic Information — Digital Data from VG95-203A Ratcliffe, NM, 1995,�Digital bedrock geologic map of the Cavendish quadrangle, Vermont: USGS Open-File Report 95-203, 2 plates, scale...

  14. Transgenic Cavendish bananas with resistance to Fusarium wilt tropical race 4

    OpenAIRE

    Dale, James; James, Anthony; Paul, Jean-Yves; Khanna, Harjeet; Smith, Mark; Peraza-Echeverria, Santy; Garcia-Bastidas, Fernando; Kema, Gert; Waterhouse, Peter; Mengersen, Kerrie; Harding, Robert

    2017-01-01

    Banana (Musa spp.) is a staple food for more than 400 million people. Over 40% of world production and virtually all the export trade is based on Cavendish banana. However, Cavendish banana is under threat from a virulent fungus, Fusarium oxysporum f. sp. cubense tropical race 4 (TR4) for which no acceptable resistant replacement has been identified. Here we report the identification of transgenic Cavendish with resistance to TR4. In our 3-year field trial, two lines of transgenic Cavendish, ...

  15. AAA Foundation for Traffic Safety

    Science.gov (United States)

    ... Safety Culture Every 15 minutes, someone dies on America’s roadways. Fatalities include drivers, passengers, pedestrians, cyclists, and every other kind of road user. ... AAA: Road debris causes avoidable crashes, deaths Save the driver or save ...

  16. NASA Airborne Astronomy Ambassadors (AAA)

    Science.gov (United States)

    Backman, D. E.; Harman, P. K.; Clark, C.

    2016-12-01

    NASA's Airborne Astronomy Ambassadors (AAA) is a three-part professional development (PD) program for high school physics and astronomy teachers. The AAA experience consists of: (1) blended-learning professional development composed of webinars, asynchronous content learning, and a series of hands-on workshops (2) a STEM immersion experience at NASA Armstrong Flight Research Center's B703 science research aircraft facility in Palmdale, California, and (3) ongoing participation in the AAA community of practice (CoP) connecting participants with astrophysics and planetary science Subject Matter Experts (SMEs). The SETI Institute (SI) is partnering with school districts in Santa Clara and Los Angeles Counties during the AAA program's "incubation" period, calendar years 2016 through 2018. AAAs will be selected by the school districts based on criteria developed during spring 2016 focus group meetings led by the program's external evaluator, WestEd.. Teachers with 3+ years teaching experience who are assigned to teach at least 2 sections in any combination of the high school courses Physics (non-AP), Physics of the Universe (California integrated model), Astronomy, or Earth & Space Sciences are eligible. Partner districts will select at least 48 eligible applicants with SI oversight. WestEd will randomly assign selected AAAs to group A or group B. Group A will complete PD in January - June of 2017 and then participate in SOFIA science flights during fall 2017 (SOFIA Cycle 5). Group B will act as a control during the 2017-18 school year. Group B will then complete PD in January - June of 2018 and participate in SOFIA science flights in fall 2018 (Cycle 6). Under the current plan, opportunities for additional districts to seek AAA partnerships with SI will be offered in 2018 or 2019. A nominal two-week AAA curriculum component will be developed by SI for classroom delivery that will be aligned with selected California Draft Science Framework Disciplinary Core Ideas

  17. Frecuencia de subgrupos del antígeno A en donantes voluntarios de sangre.

    Science.gov (United States)

    Parra-Jaramillo, Katherine; Chiriboga-Ponce, Rosa F

    2018-01-01

    La presencia de variantes débiles del grupo sanguíneo A representa un desafío en la práctica de la inmunohematología por las discrepancias en el momento de la tipificación. Es común en bancos de sangre realizar una tipificación directa e inversa con el objetivo de confirmar el grupo sanguíneo; sin embargo, no todas las personas que presentan un subgrupo sanguíneo A2 han desarrollado anticuerpos anti-A1, lo que dificulta la identificación de subgrupos de A. El presente estudio es descriptivo, observacional y transversal, y tiene el objetivo de establecer la proporción de los subgrupos del antígeno A en donantes de sangre mediante la técnica manual en tubo con reactivos hemoclasificadores monoclonales: anti A, anti-A1 (extracto de las lectinas Dolichus biflorus) y anti-H. Se analizaron un total de 818 muestras provenientes de donantes de sangre (muestreo aleatorio estratificado), de los cuales 737 fueron tipificados inicialmente como A y 81 como AB, con un grado de confianza del 95% (error alfa del 5% y precisión del 3%). Se identificó la existencia de los subgrupos A1, A2, A1B, A2B, A intermedio y A intB en donantes de sangre ecuatorianos. Se recomienda la implementación de la identificación de los subgrupos de A en laboratorios clínicos y bancos de sangre.

  18. Maxwell's enduring legacy a scientific history of the Cavendish laboratory

    CERN Document Server

    Longair, Malcolm

    2016-01-01

    The Cavendish Laboratory is arguably the most famous physics laboratory in the world. Founded in 1874, it rapidly gained a leading international reputation through the researches of the Cavendish professors beginning with Maxwell, Rayleigh, J. J. Thomson, Rutherford and Bragg. Its name will always be associated with the discoveries of the electron, the neutron, the structure of the DNA molecule and pulsars, but these are simply the tip of the iceberg of outstanding science. The physics carried out in the laboratory is the central theme of the book and this is explained in reasonably non-technical terms. The research activities are set in their international context. Generously illustrated, with many pictures of the apparatus used and diagrams from the original papers, the story is brought right up to date with descriptions of the science carried out under the leadership of the very different personalities of Mott, Pippard and Edwards.

  19. Avaliação de clones de banana Cavendish Evaluation of cavendish banana clones

    Directory of Open Access Journals (Sweden)

    Sebastião de Oliveira e Silva

    2006-10-01

    Full Text Available Na bananeira ocorrem variações somaclonais em taxa muito superior ao que se observa na maioria das outras culturas, provavelmente em função da instabilidade mitótica. Objetivou-se com o presente trabalho avaliar clones de bananeira Cavendish coletados em diferentes locais. Os clones Grande Naine (G.N. Taperão, G.N. Rossete, G.N. Williams, G.N. Magário, G.N. SC-074 e Nanicão (N. IAC Abóbora Verde, N. Rossete, N. SC-0008 e N. SC-063 coletados em São Paulo, Santa Catarina e Bahia foram avaliados no Lote 54-P da Thelo Produção Agropecuária (Grupo Plena, no Projeto Jaíba, Etapa 1, no município de Matias Cardoso-MG. Avaliaram-se os caracteres altura da planta, circunferência do pseudocaule, número de folhas vivas no florescimento e na colheita, número de brotos, peso do cacho e das pencas, número de frutos e de pencas por cacho, comprimento e circunferência do fruto e número de dias do plantio ao florescimento e à colheita. Observou-se grande similaridade nas características dos clones. No entanto, os resultados obtidos permitem a recomendação dos clones N. IAC Abóbora Verde e G.N. Williams.Somaclonal variations occur in bananas at greater rates compared to other crops, probably due to mitotic instability. The objective of the present research was to evaluate Cavendish banana clones collected from different sites. The 'Grand Naine' clones (G.N. Taperão, G.N. Rossete, G.N. Williams, G.N. Magário, G.N. SC-074 and 'Nanicão' (N. IAC Abóbora Verde, N. Rossete, N. SC-0008 and N. SC-063 collected from the states of São Paulo, Santa Catarina and Bahia, were evaluated at the Station 54-P of the Thelo Agricultural Production (Plena Group, in the Jaíba Project, Stage 1, in the city of Matias Cardoso-MG. The characteristics of the plant as height and pseudostem circumference, number of live leaves at flowering and harvesting, number of shoots, weight of bunch and hand, number of fruits and hands per bunch, fruit length and

  20. Transgenic Cavendish bananas with resistance to Fusarium wilt tropical race 4

    NARCIS (Netherlands)

    Dale, James; James, Anthony; Paul, Jean Yves; Khanna, Harjeet; Smith, Mark; Peraza-Echeverria, Santy; Garcia-Bastidas, Fernando; Kema, Gert; Waterhouse, Peter; Mengersen, Kerrie; Harding, Robert

    2017-01-01

    Banana (Musa spp.) is a staple food for more than 400 million people. Over 40% of world production and virtually all the export trade is based on Cavendish banana. However, Cavendish banana is under threat from a virulent fungus, Fusarium oxysporum f. sp. cubense tropical race 4 (TR4) for which no

  1. Transgenic Cavendish bananas with resistance to Fusarium wilt tropical race 4.

    Science.gov (United States)

    Dale, James; James, Anthony; Paul, Jean-Yves; Khanna, Harjeet; Smith, Mark; Peraza-Echeverria, Santy; Garcia-Bastidas, Fernando; Kema, Gert; Waterhouse, Peter; Mengersen, Kerrie; Harding, Robert

    2017-11-14

    Banana (Musa spp.) is a staple food for more than 400 million people. Over 40% of world production and virtually all the export trade is based on Cavendish banana. However, Cavendish banana is under threat from a virulent fungus, Fusarium oxysporum f. sp. cubense tropical race 4 (TR4) for which no acceptable resistant replacement has been identified. Here we report the identification of transgenic Cavendish with resistance to TR4. In our 3-year field trial, two lines of transgenic Cavendish, one transformed with RGA2, a gene isolated from a TR4-resistant diploid banana, and the other with a nematode-derived gene, Ced9, remain disease free. Transgene expression in the RGA2 lines is strongly correlated with resistance. Endogenous RGA2 homologs are also present in Cavendish but are expressed tenfold lower than that in our most resistant transgenic line. The expression of these homologs can potentially be elevated through gene editing, to provide non-transgenic resistance.

  2. The LHC at the AAAS

    CERN Multimedia

    CERN Bulletin

    2011-01-01

    The American Association for the Advancement of Science held its annual meeting in the Walter E. Washington Convention Center in Washington D.C. last week.   Veteran science writer Tim Radford introduces LHC scientists during a media briefing at the AAAS annual meeting. Left to right: Felicitas Pauss, Tom LeCompte, Yves Schutz and Nick Hadley. As the world’s largest popular science meeting, the AAAS meeting is a major event in the calendar of science journalists.  At this year’s LHC session, CERN’s coordinator for international relations, Felicitas Pauss, opened the discussion, paving the way for Tom LeCompte of ATLAS, Joe Incandela of CMS, Yves Schutz of ALICE and Monica Pepe-Altarelli of LHCb to report on the status of the first year’s analysis from their experiments.    

  3. A Greenhouse Bioassay for the Fusarium oxysporum f. sp. cubense x ‘Grand Naine’ (Musa, AAA, Cavendish Subgroup) Interaction

    NARCIS (Netherlands)

    Dita Rodriguez, M.A.; Waalwijk, C.; Paiva, L.V.; Souza, M.T.; Kema, G.H.J.

    2011-01-01

    Several disease resistance screening protocols for Fusarium wilt of banana (causal agent Fusarium oxysporum f. sp. cubense - Foc) under greenhouse conditions have been reported. Here, we report a standardised rapid and reliable greenhouse bioassay for this pathosystem. This is indispensable for

  4. AAA

    Indian Academy of Sciences (India)

    It is simpler to study the mapping: numerically, this is through simple iteration, while the study of the differential equations. Poincare Section. It is fairly easy to imagine the phase space trajectory of a one-dimensional damped simple harmonic oscillator (or a simple pendulum with friction I, for which the phase space is two-.

  5. CARACTERIZACIÓN DE PROPIEDADES MECÁNICAS DEL BANANO (Cavendish Valery CHARACTERIZATION OF MECHANICAL PROPERTIES OF BANANA (Cavendish Valery

    Directory of Open Access Journals (Sweden)

    Héctor José Ciro Velásquez

    2005-12-01

    Full Text Available Bananos (Cavendish Valery fueron sometidos a cargas de compresión unidireccional usando un analizador de textura TA-XT2i. Los resultados de las pruebas de fuerza de fractura a flexión y compresión mostraron que tanto el producto en su estado natural y su pulpa tienen una resistencia mayor a flexión que a compresión. Los modelos estadísticos indicaron que las propiedades mecánicas del producto definidas en firmeza, fractura y módulos elásticos son altamente dependientes del tiempo poscosecha. Situación similar ocurrió en la caracterización físico-química.Bananas (Cavendish Valery were subjected to unidirectional compression loads using a TA-XT21 texture analyzer. The results of the force to fracture and compression tests indicated that the mechanical properties of the product in its natural state and its pulp have a higher resistance to flexion than to compression. The statistical models indicated that the mechanical properties of the products defined by firmness, fracture and elastic modulus are highly dependent upon post-harvest time. A similar situation occurred in the physical-chemical characterization.

  6. The personality of Henry Cavendish a great scientist with extraordinary peculiarities

    CERN Document Server

    McCormmach, Russell

    2014-01-01

    This book explores the 18th century natural philosopher Henry Cavendish, best known for his work in chemistry and physics. It traces aspects of his personality, views and interpretations of him, and explores notions of eccentricity and autism.

  7. Leadership and creativity a history of the Cavendish Laboratory, 1871–1919

    CERN Document Server

    Kim, Dong-Won

    2002-01-01

    Historical accounts of successful laboratories often consist primarily of reminiscences by their directors and the eminent people who studied or worked in these laboratories. Such recollections customarily are delivered at the celebration of a milestone in the history of the laboratory, such as the institution's fiftieth or one­ hundredth anniversary. Three such accounts of the Cavendish Laboratory at the University of Cambridge have been recorded. The first of these, A History of the Cavendish Laboratory, 1871-1910, was published in 1910 in honor of the twenty­ fifth anniversary of Joseph John Thomson's professorship there. The second, The Cavendish Laboratory, 1874-1974, was published in 1974 to commemorate the one­ hundredth anniversary of the Cavendish. The third, A Hundred Years and More of Cambridge Physics, is a short pamphlet, also published at the centennial of the 1 Cavendish. These accounts are filled with the names of great physicists (such as James Clerk Maxwell, Lord Rayleigh, J. J. Thomson, ...

  8. Principles for Checking the Statistical Results Processing Correctness of the Cavendish Classic Experiment

    Directory of Open Access Journals (Sweden)

    V. N. Tutubalin

    2016-01-01

    Full Text Available In teaching mathematical statistics it is desirable that students of engineering and natural sciences could study the methods of statistical processing based on data of real experiments. Conditions for these experiments are of critical importance to justify the application of statistical methods.The article considers a classic Henry Cavendish’s experiment to determine a mean density of the Earth from this point of view. The article gives a detailed description of the experimental Cavendish’s setup, ideas, his experiments are based on, and a method to determine the values used for assessment of the mean density of the Earth. It also concretizes the equation of a pendulum model with friction on which Cavendish implicitly (and neglecting a friction relied.It is shown that the formal use of methods of mathematical statistics is not always justified. Detailed records of all experiments, published by Cavendish, enable us to study these data in terms of mathematical statistics, convince us of their statistical inhomogeneity and impossibility to construct a confidence interval to estimate accuracy.The article proposes an alternative way for processing Cavendish's data implicitly using the pendulum model equation with friction to reduce an effect of systematic errors and improve matching the Cavendish results with modern data.

  9. "[N]ot subject to our sense” : Margaret Cavendish's fusion of Renaissance science, magic and fairy lore.

    Science.gov (United States)

    Walters, Lisa

    2010-01-01

    This article explores Margaret Cavendish's depictions of alchemy, witchcraft and fairy lore in her scientific treatise Philosophical Letters and in fictional texts from Natures Pictures and Poems and Fancies. Though Cavendish was a dedicated materialist, she appropriates theories of magic from early modern science and folklore into her materialist epistemology. As Cavendish draws upon a fusion of early modern conceptions of magic, she creates a radical theory of matter which not only challenges patriarchy and binary oppositions, but also explores the plurality and mystery that can exist within an infinitely complex material world.

  10. AAA-DDD triple hydrogen bond complexes.

    Science.gov (United States)

    Blight, Barry A; Camara-Campos, Amaya; Djurdjevic, Smilja; Kaller, Martin; Leigh, David A; McMillan, Fiona M; McNab, Hamish; Slawin, Alexandra M Z

    2009-10-07

    Experiment and theory both suggest that the AAA-DDD pattern of hydrogen bond acceptors (A) and donors (D) is the arrangement of three contiguous hydrogen bonding centers that results in the strongest association between two species. Murray and Zimmerman prepared the first example of such a system (complex 3*2) and determined the lower limit of its association constant (K(a)) in CDCl(3) to be 10(5) M(-1) by (1)H NMR spectroscopy (Murray, T. J. and Zimmerman, S. C. J. Am. Chem. Soc. 1992, 114, 4010-4011). The first cationic AAA-DDD pair (3*4(+)) was described by Bell and Anslyn (Bell, D. A. and Anslyn, E. A. Tetrahedron 1995, 51, 7161-7172), with a K(a) > 5 x 10(5) M(-1) in CH(2)Cl(2) as determined by UV-vis spectroscopy. We were recently able to quantify the strength of a neutral AAA-DDD arrangement using a more chemically stable AAA-DDD system, 6*2, which has an association constant of 2 x 10(7) M(-1) in CH(2)Cl(2) (Djurdjevic, S., Leigh, D. A., McNab, H., Parsons, S., Teobaldi, G. and Zerbetto, F. J. Am. Chem. Soc. 2007, 129, 476-477). Here we report on further AA(A) and DDD partners, together with the first precise measurement of the association constant of a cationic AAA-DDD species. Complex 6*10(+)[B(3,5-(CF(3))(2)C(6)H(3))(4)(-)] has a K(a) = 3 x 10(10) M(-1) at RT in CH(2)Cl(2), by far the most strongly bound triple hydrogen bonded system measured to date. The X-ray crystal structure of 6*10(+) with a BPh(4)(-) counteranion shows a planar array of three short (NH...N distances 1.95-2.15 A), parallel (but staggered rather than strictly linear; N-H...N angles 165.4-168.8 degrees), primary hydrogen bonds. These are apparently reinforced, as theory predicts, by close electrostatic interactions (NH-*-N distances 2.78-3.29 A) between each proton and the acceptor atoms of the adjacent primary hydrogen bonds.

  11. Transmisión experimental del virus de la encefalitis equina venezolana, subgrupo ID, por psorophora confinnis a ratones

    Directory of Open Access Journals (Sweden)

    Alberto Morales

    1983-06-01

    Full Text Available Se realizó un experimento con el objeto de investigar la capacidad del mosquito Psorophora confinnis para transmitir por picadura a ratones blanco-suizos de 21 días una cepa de virus de encefalitis equina venezolana, subgrupo ID. Cuando los mosquitos se alimentaron sobre hamster con altas viremias (7.5, 6.5 y 6.3 dex en 0.1 ml. de suero, los porcentajes de infección de los mosquitos y los de transmisión fueron altos. Sin embargo, cuando los mosquitos se alimentaron sobre Proechimys hendei con viremias bajas (1,4 y 2.6 dex en 0.1 ml. de suero el porcentaje de infección de los mosquitos fue muy bajo y no hubo transmisión. Cuando la viremia en el Proechimys fue de 4.4 dex en 0.1 ml. de suero, el porcentaje de infección de los mosquitos aumentó y hubo transmisión baja (9%. Los resultados sugieren que Psorophora confinnis es un mosquito que tiene un alto umbral de infección para EEV subgrupo ID.

  12. Gender and Cross-dressing in the Seventeenth Century: Margaret Cavendish Reads Shakespeare

    OpenAIRE

    Cottegnies, Line

    2013-01-01

    Is there a woman in Shakespeare? This might sound facetious, but it is not so outlandish in the context of boy actors. Elizabethan drama was after all designed and stagemanaged by men mostly for men. In this context, is there an “essential” woman on the stage? In this essay, I examine issues of gender and sexual identity in Shakespeare’s drama by looking at how one particular woman reader of the seventeenth century, Margaret Cavendish, Duchess of Newcastle, perceived femininity...

  13. Vascular disease patient information page: Abdominal aortic aneurysm (AAA).

    Science.gov (United States)

    Moennich, Laurie Ann; Mastracci, Tara M

    2014-10-01

    Abdominal aortic aneurysm is a silent but often fatal disease. AAA is most common in older people, with both modifiable (such as smoking) and hereditary (family history of AAA) risk factors influencing disease development. Screening for AAA can aid in the early diagnosis and treatment of the disease, reducing complications and death amongst those affected. Advancements in screening techniques, surgical innovations, and graft development strive to further improve patient outcomes and disease management.

  14. No actual measurement ... was required: Maxwell and Cavendish's null method for the inverse square law of electrostatics

    CERN Document Server

    Falconer, Isobel

    2016-01-01

    In 1877 James Clerk Maxwell and his student Donald McAlister refined Henry Cavendish's 1773 null experiment demonstrating the absence of electric charge inside a charged conductor. Such absence of charge was a mathematical prediction of the inverse square law, and both Cavendish and Maxwell took the experiment as verifying the law. However, Maxwell had previously expressed absolute conviction in the law, based on results of Faraday's. So what was the value to Maxwell of replicating Cavendish's experiment? This paper examines the mathematical and instrumental contexts of Maxwell's experiment. It situates the experiment in an assessment of the status of the inverse square law in the 1870s based on textbooks, Maxwell's drive to develop both an electrical programme and a "doctrine of method", and an investigation of the understanding of null methods in the 1870s. It demonstrates that he had previously shifted the evidential context of Faraday's work to suit his aims. It concludes that the experiment served both a...

  15. AAAS joins the Translational Medicine family

    Directory of Open Access Journals (Sweden)

    Marincola Francesco M

    2009-05-01

    Full Text Available Abstract The AAAS has announced the launch of Science Translational Medicine. This is further and critical recognition of this discipline and we are deeply gratified that translational medicine has risen to the level of recognition by one of the world's most prestigious scientific organizations. We believe that Science Translational Medicine will provide another valuable venue for the rapid and broad dissemination of important articles in the field and contribute to enhancing the effectiveness of translational medicine overall. It has been almost six years since we launched the Journal of Translational Medicine as an open-access journal with Biomed Central 1. At the beginning, we faced the inevitable skepticism and received several inquires among others also from Science reporters questioning both the significance of translational medicine in today's biomedical world and the need for a new journal dedicated to it.

  16. Advanced, Analytic, Automated (AAA) Measurement of Engagement during Learning

    Science.gov (United States)

    D'Mello, Sidney; Dieterle, Ed; Duckworth, Angela

    2017-01-01

    It is generally acknowledged that engagement plays a critical role in learning. Unfortunately, the study of engagement has been stymied by a lack of valid and efficient measures. We introduce the advanced, analytic, and automated (AAA) approach to measure engagement at fine-grained temporal resolutions. The AAA measurement approach is grounded in…

  17. AAAS Communicating Science Program: Reflections on Evaluation

    Science.gov (United States)

    Braha, J.

    2015-12-01

    The AAAS Center for Public Engagement (Center) with science builds capacity for scientists to engage public audiences by fostering collaboration among natural or physical scientists, communication researchers, and public engagement practitioners. The recently launched Leshner Leadership Institute empowers cohorts of mid-career scientists to lead public engagement by supporting their networks of scientists, researchers, and practitioners. The Center works closely with social scientists whose research addresses science communication and public engagement with science to ensure that the Communicating Science training program builds on empirical evidence to inform best practices. Researchers ( Besley, Dudo, & Storkdieck 2015) have helped Center staff and an external evaluator develop pan instrument that measures progress towards goals that are suggested by the researcher, including internal efficacy (increasing scientists' communication skills and confidence in their ability to engage with the public) and external efficacy (scientists' confidence in engagement methods). Evaluation results from one year of the Communicating Science program suggest that the model of training yields positive results that support scientists in the area that should lead to greater engagement. This talk will explore the model for training, which provides a context for strategic communication, as well as the practical factors, such as time, access to public engagement practitioners, and technical skill, that seems to contribute to increased willingness to engage with public audiences. The evaluation program results suggest willingness by training participants to engage directly or to take preliminary steps towards engagement. In the evaluation results, 38% of trained scientists reported time as a barrier to engagement; 35% reported concern that engagement would distract from their work as a barrier. AAAS works to improve practitioner-researcher-scientist networks to overcome such barriers.

  18. No actual measurement … was required: Maxwell and Cavendish's null method for the inverse square law of electrostatics.

    Science.gov (United States)

    Falconer, Isobel

    In 1877 James Clerk Maxwell and his student Donald MacAlister refined Henry Cavendish's 1773 null experiment demonstrating the absence of electricity inside a charged conductor. This null result was a mathematical prediction of the inverse square law of electrostatics, and both Cavendish and Maxwell took the experiment as verifying the law. However, Maxwell had already expressed absolute conviction in the law, based on results of Michael Faraday's. So, what was the value to him of repeating Cavendish's experiment? After assessing whether the law was as secure as he claimed, this paper explores its central importance to the electrical programme that Maxwell was pursuing. It traces the historical and conceptual re-orderings through which Maxwell established the law by constructing a tradition of null tests and asserting the superior accuracy of the method. Maxwell drew on his developing 'doctrine of method' to identify Cavendish's experiment as a member of a wider class of null methods. By doing so, he appealed to the null practices of telegraph engineers, diverted attention from the flawed logic of the method, and sought to localise issues around the mapping of numbers onto instrumental indications, on the grounds that 'no actual measurement … was required'. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. (Musa AAA) root nematode control and crop yield

    African Journals Online (AJOL)

    SARAH

    2016-05-31

    May 31, 2016 ... aplicaciones de nematicida al año y la productividad enfincas comerciales de banano. (Musa AAA) de Costa Rica. CORBANA,. 29(56):91-96. Araya M, 2002. Metodología utilizada en el laboratorio de nematología de CORBANA S.A. para la extracción de nematodos de las raíces de banano (Musa AAA) y ...

  20. Epigenesis and the rationality of nature in William Harvey and Margaret Cavendish.

    Science.gov (United States)

    Goldberg, Benjamin

    2017-06-01

    The generation of animals was a difficult phenomenon to explain in the seventeenth century, having long been a problem in natural philosophy, theology, and medicine. In this paper, I explore how generation, understood as epigenesis, was directly related to an idea of rational nature. I examine epigenesis-the idea that the embryo was constructed part-by-part, over time-in the work of two seemingly dissimilar English philosophers: William Harvey, an eclectic Aristotelian, and Margaret Cavendish, a radical materialist. I chart the ways that they understood and explained epigenesis, given their differences in philosophy and ontology. I argue for the importance of ideas of harmony and order in structuring their accounts of generation as a rational process. I link their experiences during the English Civil war to how they see nature as a possible source for the rationality and concord sorely missing in human affairs.

  1. Structural Elements Regulating AAA+ Protein Quality Control Machines

    Directory of Open Access Journals (Sweden)

    Chiung-Wen Chang

    2017-05-01

    Full Text Available Members of the ATPases Associated with various cellular Activities (AAA+ superfamily participate in essential and diverse cellular pathways in all kingdoms of life by harnessing the energy of ATP binding and hydrolysis to drive their biological functions. Although most AAA+ proteins share a ring-shaped architecture, AAA+ proteins have evolved distinct structural elements that are fine-tuned to their specific functions. A central question in the field is how ATP binding and hydrolysis are coupled to substrate translocation through the central channel of ring-forming AAA+ proteins. In this mini-review, we will discuss structural elements present in AAA+ proteins involved in protein quality control, drawing similarities to their known role in substrate interaction by AAA+ proteins involved in DNA translocation. Elements to be discussed include the pore loop-1, the Inter-Subunit Signaling (ISS motif, and the Pre-Sensor I insert (PS-I motif. Lastly, we will summarize our current understanding on the inter-relationship of those structural elements and propose a model how ATP binding and hydrolysis might be coupled to polypeptide translocation in protein quality control machines.

  2. A methodology for developing anisotropic AAA phantoms via additive manufacturing.

    Science.gov (United States)

    Ruiz de Galarreta, Sergio; Antón, Raúl; Cazón, Aitor; Finol, Ender A

    2017-05-24

    An Abdominal Aortic Aneurysm (AAA) is a permanent focal dilatation of the abdominal aorta at least 1.5 times its normal diameter. The criterion of maximum diameter is still used in clinical practice, although numerical studies have demonstrated the importance of biomechanical factors for rupture risk assessment. AAA phantoms could be used for experimental validation of the numerical studies and for pre-intervention testing of endovascular grafts. We have applied multi-material 3D printing technology to manufacture idealized AAA phantoms with anisotropic mechanical behavior. Different composites were fabricated and the phantom specimens were characterized by biaxial tensile tests while using a constitutive model to fit the experimental data. One composite was chosen to manufacture the phantom based on having the same mechanical properties as those reported in the literature for human AAA tissue; the strain energy and anisotropic index were compared to make this choice. The materials for the matrix and fibers of the selected composite are, respectively, the digital materials FLX9940 and FLX9960 developed by Stratasys. The fiber proportion for the composite is equal to 0.15. The differences between the composite behavior and the AAA tissue are small, with a small difference in the strain energy (0.4%) and a maximum difference of 12.4% in the peak Green strain ratio. This work represents a step forward in the application of 3D printing technology for the manufacturing of AAA phantoms with anisotropic mechanical behavior. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. The Use Combined Adsorbant to Extend the Storing Period of Cavendish Banana

    Directory of Open Access Journals (Sweden)

    Suryatmi Retno Dumadi

    2001-04-01

    Full Text Available Post harvest damage of horticulture commodity in Indonesia has reached 30 to 40%. This research is aimed at extending the storing period of cavendish banana in order to extend the market range, while still enabling to maintain the quality of fresh preserved banana as required by consumers. One of the ways to do so is by using combines adsorbant as to control the air of the fruit surrounding.The type of adsorbant used is as follows : 1,2 and 3% of KMn04 ; 0,5, 1 and 1,5% of iron powder, and 3% of active carbon. The experiment was conducted in completed randomized design, by 10 factors of combined and concentrate adsorbant, and by 6 factors of storing time. The parameters being analyzed includes texture intensity, starch rate, total acid rate, total glucose rate, water rate and reduced glucose rate.The statistics test results of 10 treatments of combines adsorbant KMn04, iron powder, active carbon which were(1%, 0,5%, 3%, (1%, 1%, 3%, (1%, 1,5%,3%, (2%, 0,5%, 3%, (2%, 1%, 3%, (2%, 1.5%, 3% (3%, 0,5%, 3%, (3%, 1%, 3% ( 3%, 1,5%, 3%, suggested that the combined adsorbant (2%, 1,5%, 3% at 15°C storing temperature is the best. This treatment is the best because it has the highest substances rate up to 72.36% db; relatively small texture change, total acid rate, total glucose rate, water rate and the lowest reduced glucose rate of 3.531% db which is more likely to extend the storing period of cavendish banana for approximately six weeks.

  4. Functional Diversity of AAA+ Protease Complexes in Bacillus subtilis

    Science.gov (United States)

    Elsholz, Alexander K. W.; Birk, Marlene S.; Charpentier, Emmanuelle; Turgay, Kürşad

    2017-01-01

    Here, we review the diverse roles and functions of AAA+ protease complexes in protein homeostasis, control of stress response and cellular development pathways by regulatory and general proteolysis in the Gram-positive model organism Bacillus subtilis. We discuss in detail the intricate involvement of AAA+ protein complexes in controlling sporulation, the heat shock response and the role of adaptor proteins in these processes. The investigation of these protein complexes and their adaptor proteins has revealed their relevance for Gram-positive pathogens and their potential as targets for new antibiotics. PMID:28748186

  5. Soil water requirements of tissue-cultured Dwarf Cavendish banana ( Musa spp. L)

    Science.gov (United States)

    Shongwe, V. D.; Tumber, R.; Masarirambi, M. T.; Mutukumira, A. N.

    The banana is one of the most important fruit crops in the world. In terms of consumption, the banana fruit is ranked high yet there has not been much research particularly in relation to water requirements for propagules produced by tissue culture. In recent years, tissue culture banana planting material has become increasingly important due to its vigorous growth and high yields. The objective of this study was to investigate optimum soil water requirements of tissue-cultured banana. Dwarf Cavendish tissue-cultured plantlets grown in pots in a greenhouse were subjected to four irrigation regimes at 100% ETm, 85% ETm, 65% ETm, and 40% ETm. Plant parameters measured were leaf number, plant height, pseudo-stem girth, leaf length, leaf width, leaf area, leaf area index, leaf index, leaf colour, and plant vigour. Soil water potential measurements were also made over a three-month period. Differences between irrigating at 100% ETm and 85% ETm were not significantly ( P plant height, and plant height, compared to 65% and 40% ETm treatments. Pseudo-stem girth was highest from the 100% ETm compared to the other treatments. Economic yields of banana may be obtained with irrigation regimes ranging between 100% ETm and 85% ETm.

  6. Descripción morfoagronómica de materiales de plátano (Musa AAB, ABB y banano (Musa AAA cultivados en San Andrés Isla

    Directory of Open Access Journals (Sweden)

    Oscar Javier Parra Pachón

    2009-10-01

    Full Text Available Durante el primer semestre de 2005 se estudiaron los cultivares de plátano y banano en fincas y parcelas de 15 agricultores típicos participantes en programas conjuntos de la Secretaría de Agricultura y Pesca de San Andrés Isla y de la Universidad Nacional de Colombia sede Caribe. A partir de descriptores de INIBAP, IPGRI y CIRAD y revisiones bibliográficas.se describen morfológicamente los materiales de Musa cultivados en la Isla, así como las prácticas de los productores isleños, Se identificaron cuatro clones del subgrupo plátano (Musa AAB: un Hartón (‘Horse’ y tres Dominico-Hartón (‘Tallo Negro’, ‘Tallo Blanco’ y ‘Cincuenta’ del subgrupo ABB se hallaron un material de Bluggoe (‘Boscó’ y un Felipita. El subgrupo banano AAA presentó dos materiales Gros Michel (denominados Común y Chino y uno de banano (Rojo. El plátano tiene gran importancia para los agricultores de la Isla, siendo el Boscó el clon más aceptado entre consumidores por su adaptación a las condiciones edafológicas y climáticas. El banano es menos cultivado; ya que los suelos, el clima y las enfermedades como sigatoka negra, condicionaron el desarrollo de clones. El trabajo sugiere prácticas de fácil implementación que podrían aumentar la producción en los sistemas de huerto mixto tropical que predominan en la Isla.

  7. Descripción morfoagronómica de materiales de plátano (Musa AAB, ABB y banano (Musa AAA cultivados en San Andrés Isla

    Directory of Open Access Journals (Sweden)

    Parra Pachón Oscar Javier

    2009-12-01

    Full Text Available Durante el primer semestre de 2005 se estudiaron los cultivares de plátano y banano en fincas y parcelas de 15 agricultores típicos participantes en programas conjuntos de la Secretaría de Agricultura y Pesca de San Andrés Isla y de la Universidad Nacional de Colombia sede Caribe. A partir de descriptores de INIBAP, IPGRI y CIRAD y revisiones bibliográficas.se describen morfológicamente los materiales de Musa cultivados en la Isla, así como las prácticas de los productores isleños, Se identificaron cuatro clones del subgrupo plátano (Musa AAB: un Hartón (‘Horse’ y tres Dominico-Hartón (‘Tallo Negro’, ‘Tallo Blanco’ y ‘Cincuenta’ del subgrupo ABB se hallaron un material de Bluggoe (‘Boscó’ y un Felipita. El subgrupo banano AAA presentó dos materiales Gros Michel (denominados Común y Chino y uno de banano (Rojo. El plátano tiene gran importancia para los agricultores de la Isla, siendo el Boscó el clon más aceptado entre consumidores por su adaptación a las condiciones edafológicas y climáticas. El banano es menos cultivado; ya que los suelos, el clima y las enfermedades como sigatoka negra, condicionaron el desarrollo de clones. El trabajo sugiere prácticas de fácil implementación que podrían aumentar la producción en los sistemas de huerto mixto tropical que predominan en la Isla.

  8. The Adult Asperger Assessment (AAA): A Diagnostic Method

    Science.gov (United States)

    Baron-Cohen, Simon; Wheelwright, Sally; Robinson, Janine; Woodbury-Smith, Marc

    2005-01-01

    At the present time there are a large number of adults who have "suspected" Asperger syndrome (AS). In this paper we describe a new instrument, the Adult Asperger Assessment (AAA), developed in our clinic for adults with AS. The need for a new instrument relevant to the diagnosis of AS in adulthood arises because existing instruments are designed…

  9. Increased levels of thioredoxin in patients with abdominal aortic aneurysms (AAAs). A potential link of oxidative stress with AAA evolution

    DEFF Research Database (Denmark)

    Martinez-Pinna, R; Lindholt, Jes S.; Blanco-Colio, L M

    2010-01-01

    Oxidative stress is a main mechanism involved in vascular pathologies. Increased thioredoxin (TRX) levels have been observed in several oxidative stress-associated cardiovascular diseases. We aim to test the potential role of TRX as a biomarker of oxidative stress in abdominal aortic aneurysm (AAA)....

  10. Molecularly Defined Nanostructures Based on a Novel AAA-DDD Triple Hydrogen-Bonding Motif.

    Science.gov (United States)

    Papmeyer, Marcus; Vuilleumier, Clément A; Pavan, Giovanni M; Zhurov, Konstantin O; Severin, Kay

    2016-01-26

    A facile and flexible method for the synthesis of a new AAA-DDD triple hydrogen-bonding motif is described. Polytopic supramolecular building blocks with precisely oriented AAA and DDD groups are thus accessible in few steps. These building blocks were used for the assembly of large macrocycles featuring four AAA-DDD interactions and a macrobicyclic complex with a total of six AAA-DDD interactions. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Transcriptome profiling of resistant and susceptible Cavendish banana roots following inoculation with Fusarium oxysporum f. sp. cubense tropical race 4

    Directory of Open Access Journals (Sweden)

    Li Chun-yu

    2012-08-01

    Full Text Available Abstract Background Fusarium wilt, caused by the fungal pathogen Fusarium oxysporum f. sp. cubense tropical race 4 (Foc TR4, is considered the most lethal disease of Cavendish bananas in the world. The disease can be managed in the field by planting resistant Cavendish plants generated by somaclonal variation. However, little information is available on the genetic basis of plant resistance to Foc TR4. To a better understand the defense response of resistant banana plants to the Fusarium wilt pathogen, the transcriptome profiles in roots of resistant and susceptible Cavendish banana challenged with Foc TR4 were compared. Results RNA-seq analysis generated more than 103 million 90-bp clean pair end (PE reads, which were assembled into 88,161 unigenes (mean size = 554 bp. Based on sequence similarity searches, 61,706 (69.99% genes were identified, among which 21,273 and 50,410 unigenes were assigned to gene ontology (GO categories and clusters of orthologous groups (COG, respectively. Searches in the Kyoto Encyclopedia of Genes and Genomes Pathway database (KEGG mapped 33,243 (37.71% unigenes to 119 KEGG pathways. A total of 5,008 genes were assigned to plant-pathogen interactions, including disease defense and signal transduction. Digital gene expression (DGE analysis revealed large differences in the transcriptome profiles of the Foc TR4-resistant somaclonal variant and its susceptible wild-type. Expression patterns of genes involved in pathogen-associated molecular pattern (PAMP recognition, activation of effector-triggered immunity (ETI, ion influx, and biosynthesis of hormones as well as pathogenesis-related (PR genes, transcription factors, signaling/regulatory genes, cell wall modification genes and genes with other functions were analyzed and compared. The results indicated that basal defense mechanisms are involved in the recognition of PAMPs, and that high levels of defense-related transcripts may contribute to Foc TR4 resistance in

  12. “Come, what, a siege?” : Metarepresentation in Lady Jane Cavendish and Lady Elizabeth Brackley’s The Concealed Fancies

    OpenAIRE

    Hopkins, Lisa; Macmahon, Barbara

    2013-01-01

    The Concealed Fancies is a play written by Lady Jane Cavendish and Lady Elizabeth Brackley, the two eldest daughters of William Cavendish, marquis (and later duke) of Newcastle, during the English Civil War. We can feel reasonably certain that the sisters wrote it in the hope that it could be performed; however, that would have required the presence of their father, whose return is the climax of the story, from the Continental exile to which he had fled after his comprehensive defeat at the B...

  13. Descripción de cuatro especies nuevas del subgrupo Drosophila fasciola, gruporepleta (Diptera, Drosophilidae en dos bosques nublados del Ecuador

    Directory of Open Access Journals (Sweden)

    María Beatriz Cabezas

    2015-12-01

    Full Text Available RESUMEN En el presente trabajo se describen cuatro miembros nuevos del grupoDrosophila repleta capturados en dos bosques nublados del Ecuador. Las nuevas especies fueron agrupadas dentro del subgrupo D. fasciola basados en el patrón de pigmentación del tórax y la morfología de la genitalia masculina. Drosophila inti sp. nov.,D. nigua sp. nov. y D. yambe sp. nov. fueron capturadas con trampas de banano, mientras que D. carvalhoi sp. nov. fue recolectada en inflorescencias deAnthurium sp. La pigmentación del abdomen y la forma del edeago de D. nigua sp. nov., D. yambe sp. nov. y D. carvalhoi sp. nov. indicarían que están relacionadas entre ellas, mientras que D. inti sp. nov. sería más cercana aD. linearepleta Patterson & Wheeler, 1942.

  14. First report of fusarium oxysporum f. sp. cubense tropical race 4 causing panama disease in cavendish bananas in Pakistan and Lebanon

    NARCIS (Netherlands)

    Ordoñez, N.; García-Bastidas, F.; Laghari, H.B.; Akkary, M.Y.; Harfouche, E.N.; Awar, al B.N.; Kema, G.H.J.

    2016-01-01

    Panama disease of banana, caused byFusarium oxysporumf. sp.cubense(Foc), poses a great risk to global banana production. Tropical race 4 (TR4) of Foc, which affects Cavendish bananas as well as many other banana cultivars (Ploetz 2006), was confirmed for the first time outside Southeast Asia in

  15. Bears in Eden, or, this is not the garden you're looking for: Margaret Cavendish, Robert Hooke and the limits of natural philosophy.

    Science.gov (United States)

    Lawson, Ian

    2015-12-01

    This paper investigates Margaret Cavendish's characterization of experimental philosophers as hybrids of bears and men in her 1666 story The Description of a New World, Called the Blazing World. By associating experimental philosophers, in particular Robert Hooke and his microscope, with animals familiar to her readers from the sport of bear-baiting, Cavendish constructed an identity for the fellows of the Royal Society of London quite unlike that which they imagined for themselves. Recent scholarship has illustrated well how Cavendish's opposition to experimental philosophy is linked to her different natural-philosophical, political and anthropological ideas. My contribution to this literature is to examine the meanings both of bears in early modern England and of microscopes in experimental rhetoric, in order to illustrate the connection that Cavendish implies between the two. She parodied Hooke's idea that his microscope extended his limited human senses, and mocked his aim that by so doing he could produce useful knowledge. The bear-men reflect inhuman ambition and provide a caution against ignoring both the order of English society and the place of humans in nature.

  16. Utilización del método de superficie de respuesta para formular una base de banano (Musa AAA para batidos

    Directory of Open Access Journals (Sweden)

    Marta Gamboa White

    2010-06-01

    Full Text Available El Método de Superficie de Respuesta se utiliza para optimizar o reformular productos. Se usa principalmente para economizar dinero y reducir el tiempo de pruebas, al disminuir el número de ensayos. Se presenta la aplicación del Método de Superficie de Respuesta para desarrollar una base a partir de bananos (Musa AAA var. Cavendish cv. Gran Enano de rechazo de exportación a manera de caso para estudiar su uso. Por medio de una encuesta se identificó que el dulzor, espumosidad y sabor fueron los atributos que los consumidores consideraron más importantes en un batido. Con base en estos atributos y con los ingredientes: pulpa de banano, goma guar y azúcar, se elaboraron y seleccionaron varias mezclas base, que fueron degustadas, en forma de batidos en leche, por un grupo de 90 consumidores. Por medio del diseño de superficie de respuesta se determinó que el batido con la mayor aceptación estuvo constituido por un 77,0 % de leche y un 23,0 % de mezcla base, compuesta esta última por 0,12 % de goma guar, 80,50 % de pulpa de banano y un 19,50 % de azúcar. Un Análisis de Componentes Principales permitió determinar que el contenido de sacarosa, que define el grado de dulzor, fue el atributo más importante para la aceptación del batido y se demostró que la combinación del Método de Superficie de Respuesta con el Análisis de Componentes Principales constituyó una herramienta útil en la formulación y optimización de productos, sobre todo para entender la interrelación de las variables.

  17. Inhibition of early AAA formation by aortic intraluminal pentagalloyl glucose (PGG) infusion in a novel porcine AAA model

    DEFF Research Database (Denmark)

    Kloster, Brian O; Lund, Lars; Lindholt, Jes S

    2016-01-01

    and histology. CONCLUSION: In our model, intraluminal delivered PGG is able to penetrate the aortic wall from the inside and impair the early AAA development by stabilizing the elastic lamellae and preserving their integrity. The principle holds a high clinical potential if it can be translated to human...... to physiological values as seen in the control group. In the elastase group, histology revealed more or less complete resolution of the elastic lamellae in the media while they were more abundant, coherent and structurally organized in the PGG group. The control group displayed normal physiological growth...

  18. Aortocaval fistula (ACF) in patients operated for ruptured aortic aneurysm (rAAA)

    DEFF Research Database (Denmark)

    Warning, Karina; Houlind, Kim Christian; Ravn, Hans

    Aortocaval fistula (ACF) in patients operated for Ruptured Acute Aorta Aneurysm (rAAA): A surgical challenge. Introduction Aortocaval fistula is a rare complication of abdominal aortic aneurysm (AAA). It been reported to be present in less than 1% of all AAAs. ACF arise in patients with large...... aneurysms and is typically discovered peroperatively in patients with rAAA. Open surgical treatment is associated with high mortality and morbidity. ACF is a result of spontaneously rupture of large atherosclerotic aneurysms into the inferior vena cava in 80%, 15% arise after trauma and 5% are iatrogenic...

  19. Technical features of the INCRAFT™ AAA Stent Graft System.

    Science.gov (United States)

    Bertoglio, L; Logaldo, D; Marone, E M; Rinaldi, E; Chiesa, R

    2014-10-01

    The INCRAFT® AAA Stent Graft System is the advanced endovascular aneurysm repair (EVAR) technology for the treatment of infrarenal abdominal aneurysms. This new system is designed to address the unmet needs of current endografts by combining unique features and adding new refinements compared to existing endografts delivered through a flexible 14-Fr ultra-low system. The INCRAFT® AAA Stent Graft System introduces innovative features without deviating from proven stent-graft design principles. It is a three-piece modular system, made of low porosity polyester and segmented nitinol stents. However, the introduction of cap-free delivery and partial proximal repositioning enhances the ability of the device to better match individual aortoiliac anatomy with a high deliverability and placement accuracy in a easy to use system. Moreover, the INCRAFT® System allows a "customization" of the implant during the procedure with bilateral in-situ length adjustment features. The present data from the ongoing clinical trials confirm excellent results with this system, but postmarket studies will be necessary to verify the effectiveness of this system in the real-world setting.

  20. Descripción morfoagronómica de materiales de plátano (Musa AAB, ABB y banano (Musa AAA cultivados en San Andrés Isla Morpho-agronomic Description of Plantain (Musa AAB, ABB and Banana (Musa AAA Materials Grown in San Andres Island

    Directory of Open Access Journals (Sweden)

    Oscar Javier Parra Pachón

    2009-10-01

    Full Text Available Durante el primer semestre de 2005 se estudiaron los cultivares de plátano y banano en fincas y parcelas de 15 agricultores típicos participantes en programas conjuntos de la Secretaría de Agricultura y Pesca de San Andrés Isla y de la Universidad Nacional de Colombia sede Caribe. A partir de descriptores de INIBAP, IPGRI y CIRAD y revisiones bibliográficas.se describen morfológicamente los materiales de Musa cultivados en la Isla, así como las prácticas de los productores isleños, Se identificaron cuatro clones del subgrupo plátano (Musa AAB: un Hartón (‘Horse’ y tres Dominico-Hartón (‘Tallo Negro’, ‘Tallo Blanco’ y ‘Cincuenta’ del subgrupo ABB se hallaron un material de Bluggoe (‘Boscó’ y un Felipita. El subgrupo banano AAA presentó dos materiales Gros Michel (denominados Común y Chino y uno de banano (Rojo. El plátano tiene gran importancia para los agricultores de la Isla, siendo el Boscó el clon más aceptado entre consumidores por su adaptación a las condiciones edafológicas y climáticas. El banano es menos cultivado; ya que los suelos, el clima y las enfermedades como sigatoka negra, condicionaron el desarrollo de clones. El trabajo sugiere prácticas de fácil implementación que podrían aumentar la producción en los sistemas de huerto mixto tropical que predominan en la Isla.During the first semester, 2005 we studied the plantain and banana cultivars in small farms of 15 volunteer regular producers, who were participating in joint programs of the Agriculture and Fisheries Secretariat of San Andres Island and the Colombian National University Caribbean Headquarters. We described morphologically the Musa cultivars identified in the island, as well as agricultural practices of the island producers, using the INIBAP, IPGRI and CIRAD (1996 descriptors and bibliographical reviews. We identified four clones within the plantain sub-group Musa AAB: a Horn type and three French-Horn; and within the ABB

  1. Open Repair of AAA in a High Volume Center.

    Science.gov (United States)

    Davidovic, Lazar B; Maksic, Milanko; Koncar, Igor; Ilic, Nikola; Dragas, Marko; Fatic, Nikola; Markovic, Miroslav; Banzic, Igor; Mutavdzic, Perica

    2017-03-01

    To assess results of open repair (OR) of AAA in a single high volume center. We analyzed prospectively collected data of 450 patients who underwent elective OR of AAA at the Clinic for Vascular and Endovascular Surgery of the Serbian Clinical Centre in the period between January 2013 and September 2014. Postoperative death occurred in seven patients (1. 55%) during the first 30 postoperative days. The mortality was caused by: uncontrolled bleeding-1, acute myocardial infarction-1, ischemic colitis-2, MOFS-2, sepsis due to infection and dehiscence of laparotomy wound-1. Coronary artery disease (OR 3.89; CI 0.85-17.7; p = 0.0058), postoperative acute myocardial infarction (OR 29.9; CI 2.56-334.95; p = 0.0053), chronic renal failure (OR 7.5; CI 1.35-8.5; p = 0.0073), colonic necrosis (OR 88.2; CI 4.77-1629.69; p = 0.0026), occlusion of the both hypogastric arteries and the inability to preserve at least one hypogastric artery (OR 17.4; CI 1.99-178.33; p = 0.0230), aortobifemoral reconstruction (OR 9.06; CI 1.76-46.49; p = 0.016), significant perioperative bleeding (>2 L) (OR 7.32; CI 1.31-10.79; p = 0.0001), hostile abdomen (OR 5.25; CI 1.3-21.1; p = 0.0055), inflammatory aneurysm (OR 13.99; CI 2.88-65.09; p = 0.0002), supraceliac aortic cross-clamping (OR 18.7; CI 3.8-90.6; p = 0.0003), prolonged aortic cross-clamping (>60 min) (OR 14.25; CI 2.75-64.5; p = 0.0003), the intraoperative hypotension (OR 6.61; CI 0.71-61.07; p = 0.0545), the prolonged operation (>240 min) (OR 8.66; CI 0.91-81.56; p = 0.0585) and complete dehiscence of the laparotomy (OR 44.1; CI 3.39-572.78; p = 0.0396) increased the 30-day mortality in our study. Early mortality after open repair of AAA in high volume center might be very low due to experienced multidisciplinary team. Centralized open aortic surgery might be solution for effective treatment of patients with unsuitable anatomy or for young patients with long life expectancy.

  2. Triple A syndrome: two novel mutations in the AAAS gene.

    Science.gov (United States)

    Thümmler, Susanne; Huebner, Angela; Baechler-Sadoul, Elisabeth

    2009-01-01

    Triple A syndrome is a rare disease of autosomal recessive inheritance. It was first described in 1978. The typical triad includes adrenocorticotrophic-hormone-resistant glucocorticoid insufficiency, reduced or absent tearing (alacrima) and achalasia. But clinical symptoms can be extremely heterogeneous and of variable clinically expression. This report describes a 7-year-old boy with a 1 year history of fatigue and muscle weakness. Physical examination showed skin and mucosal hyperpigmentation, and hormonal analysis revealed isolated glucocorticoid function. Medical history was marked by megaoesophagus and achalasia. The absence of tears when crying had been noted since birth. In the presence of the classical triad, triple A syndrome was diagnosed. Clinical diagnosis was confirmed by molecular analysis of the AAAS gene on chromosome 12q13. The novel compound heterozygous mutation c.1304delA and c.1292-1294delTTCinsA was found.

  3. Monte Carlo Simulation of an AAA System Using the Observer Model.

    Science.gov (United States)

    1979-08-01

    procedures. For reference, a brief description of the AAA gun system and model configuration follows. The basic task of the AAA gunner is to minimize...randomness such as modeling error, observa- tion error, neuromotor noise, etc. are lumped into one element called remnant. Computer simulation results of the

  4. The m-AAA Protease Associated with Neurodegeneration Limits MCU Activity in Mitochondria

    NARCIS (Netherlands)

    Konig, T.; Troder, S.E.; Bakka, K.; Korwitz, A.; Richter-Dennerlein, R.; Lampe, P.A.; Patron, M.; Muhlmeister, M.; Guerrero-Castillo, S.; Brandt, U.; Decker, T.; Lauria, I.; Paggio, A.; Rizzuto, R.; Rugarli, E.I.; Stefani, D. De; Langer, T.

    2016-01-01

    Mutations in subunits of mitochondrial m-AAA proteases in the inner membrane cause neurodegeneration in spinocerebellar ataxia (SCA28) and hereditary spastic paraplegia (HSP7). m-AAA proteases preserve mitochondrial proteostasis, mitochondrial morphology, and efficient OXPHOS activity, but the cause

  5. EFECTO DE LA MICORRIZACIÓN Y LA FERTILIZACIÓN EN LA ACUMULACIÓN DE BIOMASA EN PLANTAS DE BANANO (Musa AAA cv. Gran Enano (Musaceae MICORRHIZATION AND FERTILIZATION EFFECT ON BIOMASS ACCUMULATION IN BANANA PLANTS (Musa AAA cv. Gran Enano (Musaceae

    Directory of Open Access Journals (Sweden)

    Carmen Elena Usuga Osorio

    2008-06-01

    Full Text Available Bajo condiciones de invernadero (ubicado en el municipio de Bello - Antioquia (Colombia se evaluó el efecto independiente y combinado de los factores: tipo de inóculo de Hongos Micorriza Arbuscular (HMA, fertilización y aplicación de materia orgánica sobre el porcentaje de asociación de HMA en plantas de banano (Musa AAA cv. Gran Enano, así como en la acumulación de materia seca foliar y radical. Dentro del factor tipo de inóculo, se evaluaron inóculos nativos, de agroecosistemas bananeros y ecosistemas naturales del Urabá (Antioquia-Colombia, uno comercial y la especie Acaulospora morrowiae; con respecto a la fertilización se probó la mitad, completa y dos veces la dosis de la fertilización recomendada de acuerdo al análisis de suelo y a los requerimientos de la planta, y cada uno de estos factores con y sin la aplicación de materia orgánica; como testigos se usaron, la no aplicación del respectivo factor. Se usó como material vegetal plantas de banano micropropagadas del grupo Cavendish cv. Gran Enano (AAA. El sustrato utilizado para el crecimiento de las plantas de banano se compuso de suelo y arena en relación 70/30 v/v. El suelo se obtuvo de la granja experimental de Augura, ubicado en el municipio de Carepa en la región de Urabá. Los resultados encontrados, muestran que los factores que más incidieron en la asociación así como en la acumulación de biomasa en toda la planta son la micorrización y la adición de materia orgánica. Los resultados, también muestran un comportamiento positivo respecto al uso de inóculos nativos de agroecosistemas bananeros, con bajas aplicaciones de fertilizantes.The effects of independent an combined factors such as inoculum type, fertilization and organic matter application on the percentage of association of ‘H.M.A’ in banana plants (Musa AAA cv. ‘Gran Enano’, and on the accumulation of leaves and rrots material, were evaluated under greenhouse conditions. Natives samples

  6. Crescimento de mudas micropropagadas da bananeira cv. Nanicão, em diferentes substratos e fontes de fertilizante = Growth of micropropagated cavendish banana seedlings in different substrates and fertilizer sources

    Directory of Open Access Journals (Sweden)

    Edson Shigueaki Nomura

    2008-07-01

    Full Text Available Com objetivo de avaliar o efeito de diferentes substratos combinados a fontes de fertilizantes no crescimento de mudas de bananeira micropropagadas cv. Nanicão (Musa spp. AAA, foi instalado um experimento em blocos casualizados, no esquema fatorial 5 x 3,com quatro repetições. Os substratos utilizados foram: S1 - Terra de subsolo + casca de arroz carbonizada + Rendmax Floreira®; S2 - Terra de subsolo + casca de arroz carbonizada + Organifol®; S3 - Terra de subsolo + casca de arroz carbonizada + Organifol® 9% SiO; S4 - Technes Vivatto®; S5 - Areia grossa + casca de arroz carbonizada+ Rendmax Floreira®. As fontes de fertilizantes foram: SA - sem adubo; LL - adubo de liberação lenta - Osmocote® 3M 14-14-14 (5,0 kg m-3 misturado ao substrato; e LN - adubo de liberação normal, 14-14-14 (7,5 g muda-1 aplicado em cobertura. Foram determinados a altura, o diâmetro do colo, o número de folhas, a área foliar e a matéria seca das plantas. Com base nas diferenças de crescimento, recomenda-se a utilização dos substratos S1, S2, S3 e S4, com adição de fertilizante 14-14-14, com liberação lenta (5,0 kg m-3 ou normal (7,5 g muda-1 de nutrientes.With the objective of evaluating the effect of different substrates combined with fertilizers in the growth of micropropagated seedlings of Cavendish banana (Musa spp. AAA, an experiment was conducted in a randomized block design, in a 5 x 3 factorial scheme, with four repetitions. The substrates used were: S1 – subsoil land + carbonized rice hull + Rendmax Floreira®; S2 - subsoil land + carbonizedrice hull + Organifol®; S3 - subsoil land + carbonized rice hull + Organifol® 9% SiO; S4 - Technes Vivatto®; S5 - thick sand + carbonized rice hull + Rendmax Floreira®. The fertilizer sources were: SA – without fertilizer; LL – slow-release fertilizer - Osmocote® 3M 14-14-14 (5.0 kg m-3 mixed in the substrate; and LN – normal-release fertilizer, 14-14-14 (7.5 g seedling-1 applied in

  7. Parallel Agent-as-a-Service (P-AaaS Based Geospatial Service in the Cloud

    Directory of Open Access Journals (Sweden)

    Xicheng Tan

    2017-04-01

    Full Text Available To optimize the efficiency of the geospatial service in the flood response decision making system, a Parallel Agent-as-a-Service (P-AaaS method is proposed and implemented in the cloud. The prototype system and comparisons demonstrate the advantages of our approach over existing methods. The P-AaaS method includes both parallel architecture and a mechanism for adjusting the computational resources—the parallel geocomputing mechanism of the P-AaaS method used to execute a geospatial service and the execution algorithm of the P-AaaS based geospatial service chain, respectively. The P-AaaS based method has the following merits: (1 it inherits the advantages of the AaaS-based method (i.e., avoiding transfer of large volumes of remote sensing data or raster terrain data, agent migration, and intelligent conversion into services to improve domain expert collaboration; (2 it optimizes the low performance and the concurrent geoprocessing capability of the AaaS-based method, which is critical for special applications (e.g., highly concurrent applications and emergency response applications; and (3 it adjusts the computing resources dynamically according to the number and the performance requirements of concurrent requests, which allows the geospatial service chain to support a large number of concurrent requests by scaling up the cloud-based clusters in use and optimizes computing resources and costs by reducing the number of virtual machines (VMs when the number of requests decreases.

  8. Identification of functional sequences in the pregenomic RNA promoter of the Banana streak virus Cavendish strain (BSV-Cav).

    Science.gov (United States)

    Remans, Tony; Grof, Christopher P L; Ebert, Paul R; Schenk, Peer M

    2005-03-01

    The promoter regions of plant pararetroviruses direct transcription of the full-length viral genome into a pregenomic RNA that is an intermediate in the replication of the virus. It serves as template for reverse transcription and as polycistronic mRNA for translation to viral proteins. We have identified functional promoter elements in the intergenic region of the Cavendish isolate of Banana streak virus (BSV-Cav), a member of the genus Badnavirus. Potential binding sites for plant transcription factors were found both upstream and downstream of the transcription start site by homology search in the PLACE database of plant cis-acting elements. The functionality of these putative cis-acting elements was tested by constructing loss-of-function and "regain"-of-function mutant promoters whose activity was quantified in embryogenic sugarcane suspension cells. Four regions that are important for activity of the BSV-Cav promoter were identified: the region containing an as-1-like element, the region around -141 and down to -77, containing several putative transcription factor binding sites, the region including the CAAT-box, and the leader region. The results could help explain the high BSV-Cav promoter activity that was observed previously in transgenic sugarcane plants and give more insight into the plant cell-mediated replication of the viral genome in banana streak disease.

  9. Idealized Abdominal Aortic Aneurysm (AAA) Geometry as Predictor of Hemodynamics Stresses

    OpenAIRE

    Soudah, E.; Vilalta, G.; Vilalta, J. A.; Bordone, M.; Nieto, F.; Pérez, M. A.; Vaquero Puerta, Carlos

    2013-01-01

    Producción Científica Introduction: Abdominal aortic aneurysm (AAA) is defined as a localized, progressive and permanent dilation of the aortic wall. Usually are thought to be the end results of irreversible pathological remodelling of the arterial connective tissue, which causes changes, over time, in AAA geometry, in the constitutive formulation an in the failure criterion. Simple geometric parameters, those obtained directly from the computed tomography CT, can define the AA...

  10. Electron cryomicroscopy structure of a membrane-anchored mitochondrial AAA protease.

    Science.gov (United States)

    Lee, Sukyeong; Augustin, Steffen; Tatsuta, Takashi; Gerdes, Florian; Langer, Thomas; Tsai, Francis T F

    2011-02-11

    FtsH-related AAA proteases are conserved membrane-anchored, ATP-dependent molecular machines, which mediate the processing and turnover of soluble and membrane-embedded proteins in eubacteria, mitochondria, and chloroplasts. Homo- and hetero-oligomeric proteolytic complexes exist, which are composed of homologous subunits harboring an ATPase domain of the AAA family and an H41 metallopeptidase domain. Mutations in subunits of mitochondrial m-AAA proteases have been associated with different neurodegenerative disorders in human, raising questions on the functional differences between homo- and hetero-oligomeric AAA proteases. Here, we have analyzed the hetero-oligomeric yeast m-AAA protease composed of homologous Yta10 and Yta12 subunits. We combined genetic and structural approaches to define the molecular determinants for oligomer assembly and to assess functional similarities between Yta10 and Yta12. We demonstrate that replacement of only two amino acid residues within the metallopeptidase domain of Yta12 allows its assembly into homo-oligomeric complexes. To provide a molecular explanation, we determined the 12 Å resolution structure of the intact yeast m-AAA protease with its transmembrane domains by electron cryomicroscopy (cryo-EM) and atomic structure fitting. The full-length m-AAA protease has a bipartite structure and is a hexamer in solution. We found that residues in Yta12, which facilitate homo-oligomerization when mutated, are located at the interface between neighboring protomers in the hexamer ring. Notably, the transmembrane and intermembrane space domains are separated from the main body, creating a passage on the matrix side, which is wide enough to accommodate unfolded but not folded polypeptides. These results suggest a mechanism regarding how proteins are recognized and degraded by m-AAA proteases.

  11. Dosimetric comparison of peripheral NSCLC SBRT using Acuros XB and AAA calculation algorithms.

    Science.gov (United States)

    Ong, Chloe C H; Ang, Khong Wei; Soh, Roger C X; Tin, Kah Ming; Yap, Jerome H H; Lee, James C L; Bragg, Christopher M

    2017-01-01

    There is a concern for dose calculation in highly heterogenous environments such as the thorax region. This study compares the quality of treatment plans of peripheral non-small cell lung cancer (NSCLC) stereotactic body radiation therapy (SBRT) using 2 calculation algorithms, namely, Eclipse Anisotropic Analytical Algorithm (AAA) and Acuros External Beam (AXB), for 3-dimensional conformal radiation therapy (3DCRT) and volumetric-modulated arc therapy (VMAT). Four-dimensional computed tomography (4DCT) data from 20 anonymized patients were studied using Varian Eclipse planning system, AXB, and AAA version 10.0.28. A 3DCRT plan and a VMAT plan were generated using AAA and AXB with constant plan parameters for each patient. The prescription and dose constraints were benchmarked against Radiation Therapy Oncology Group (RTOG) 0915 protocol. Planning parameters of the plan were compared statistically using Mann-Whitney U tests. Results showed that 3DCRT and VMAT plans have a lower target coverage up to 8% when calculated using AXB as compared with AAA. The conformity index (CI) for AXB plans was 4.7% lower than AAA plans, but was closer to unity, which indicated better target conformity. AXB produced plans with global maximum doses which were, on average, 2% hotter than AAA plans. Both 3DCRT and VMAT plans were able to achieve D95%. VMAT plans were shown to be more conformal (CI = 1.01) and were at least 3.2% and 1.5% lower in terms of PTV maximum and mean dose, respectively. There was no statistically significant difference for doses received by organs at risk (OARs) regardless of calculation algorithms and treatment techniques. In general, the difference in tissue modeling for AXB and AAA algorithm is responsible for the dose distribution between the AXB and the AAA algorithms. The AXB VMAT plans could be used to benefit patients receiving peripheral NSCLC SBRT. Copyright © 2017 American Association of Medical Dosimetrists. Published by Elsevier Inc. All rights

  12. The Diverse AAA+ Machines that Repair Inhibited Rubisco Active Sites

    Directory of Open Access Journals (Sweden)

    Oliver Mueller-Cajar

    2017-05-01

    Full Text Available Gaseous carbon dioxide enters the biosphere almost exclusively via the active site of the enzyme ribulose 1,5-bisphosphate carboxylase/oxygenase (Rubisco. This highly conserved catalyst has an almost universal propensity to non-productively interact with its substrate ribulose 1,5-bisphosphate, leading to the formation of dead-end inhibited complexes. In diverse autotrophic organisms this tendency has been counteracted by the recruitment of dedicated AAA+ (ATPases associated with various cellular activities proteins that all use the energy of ATP hydrolysis to remodel inhibited Rubisco active sites leading to release of the inhibitor. Three evolutionarily distinct classes of these Rubisco activases (Rcas have been discovered so far. Green and red-type Rca are mostly found in photosynthetic eukaryotes of the green and red plastid lineage respectively, whereas CbbQO is associated with chemoautotrophic bacteria. Ongoing mechanistic studies are elucidating how the various motors are utilizing both similar and contrasting strategies to ultimately perform their common function of cracking the inhibited Rubisco active site. The best studied mechanism utilized by red-type Rca appears to involve transient threading of the Rubisco large subunit C-terminal peptide, reminiscent of the action performed by Clp proteases. As well as providing a fascinating example of convergent molecular evolution, Rca proteins can be considered promising crop-improvement targets. Approaches aiming to replace Rubisco in plants with improved enzymes will need to ensure the presence of a compatible Rca protein. The thermolability of the Rca protein found in crop plants provides an opportunity to fortify photosynthesis against high temperature stress. Photosynthesis also appears to be limited by Rca when light conditions are fluctuating. Synthetic biology strategies aiming to enhance the autotrophic CO2 fixation machinery will need to take into consideration the requirement for

  13. An AAA-DDD triply hydrogen-bonded complex easily accessible for supramolecular polymers.

    Science.gov (United States)

    Han, Yi-Fei; Chen, Wen-Qiang; Wang, Hong-Bo; Yuan, Ying-Xue; Wu, Na-Na; Song, Xiang-Zhi; Yang, Lan

    2014-12-15

    For a complementary hydrogen-bonded complex, when every hydrogen-bond acceptor is on one side and every hydrogen-bond donor is on the other, all secondary interactions are attractive and the complex is highly stable. AAA-DDD (A=acceptor, D=donor) is considered to be the most stable among triply hydrogen-bonded sequences. The easily synthesized and further derivatized AAA-DDD system is very desirable for hydrogen-bonded functional materials. In this case, AAA and DDD, starting from 4-methoxybenzaldehyde, were synthesized with the Hantzsch pyridine synthesis and Friedländer annulation reaction. The association constant determined by fluorescence titration in chloroform at room temperature is 2.09×10(7)  M(-1) . The AAA and DDD components are not coplanar, but form a V shape in the solid state. Supramolecular polymers based on AAA-DDD triply hydrogen bonded have also been developed. This work may make AAA-DDD triply hydrogen-bonded sequences easily accessible for stimuli-responsive materials. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. The Mitochondrial m-AAA Protease Prevents Demyelination and Hair Greying.

    Directory of Open Access Journals (Sweden)

    Shuaiyu Wang

    2016-12-01

    Full Text Available The m-AAA protease preserves proteostasis of the inner mitochondrial membrane. It ensures a functional respiratory chain, by controlling the turnover of respiratory complex subunits and allowing mitochondrial translation, but other functions in mitochondria are conceivable. Mutations in genes encoding subunits of the m-AAA protease have been linked to various neurodegenerative diseases in humans, such as hereditary spastic paraplegia and spinocerebellar ataxia. While essential functions of the m-AAA protease for neuronal survival have been established, its role in adult glial cells remains enigmatic. Here, we show that deletion of the highly expressed subunit AFG3L2 in mature mouse oligodendrocytes provokes early-on mitochondrial fragmentation and swelling, as previously shown in neurons, but causes only late-onset motor defects and myelin abnormalities. In contrast, total ablation of the m-AAA protease, by deleting both Afg3l2 and its paralogue Afg3l1, triggers progressive motor dysfunction and demyelination, owing to rapid oligodendrocyte cell death. Surprisingly, the mice showed premature hair greying, caused by progressive loss of melanoblasts that share a common developmental origin with Schwann cells and are targeted in our experiments. Thus, while both neurons and glial cells are dependant on the m-AAA protease for survival in vivo, complete ablation of the complex is necessary to trigger death of oligodendrocytes, hinting to cell-autonomous thresholds of vulnerability to m-AAA protease deficiency.

  15. Biosynthesis of silver nanoparticles from Cavendish banana peel extract and its antibacterial and free radical scavenging assay: a novel biological approach

    Science.gov (United States)

    Kokila, T.; Ramesh, P. S.; Geetha, D.

    2015-11-01

    Biosynthesis of metallic silver nanoparticles has now become an alternative to physical and chemical approaches. In the present study, silver nanoparticles (AgNPs) were synthesized from Cavendish banana peel extract (CBPE) and characterized by UV-visible spectroscopy, X-ray diffraction (XRD), Fourier transform infrared (FT-IR) spectroscopy, Atomic force microscopy (AFM), Field emission scanning electronic microscope (FESEM), Dynamic light scattering (DLS) and zeta potential (ZP). The AgNPs formation was confirmed by UV-visible spectroscopy through color conversion due to surface plasma resonance band at 430 nm. The effect of pH on nanoparticle synthesis was determined by adjusting the various pH of the reaction mixtures. The crystalline nature of nanoparticles was confirmed from the XRD pattern, and the grain size was found to be around 34 nm. To identify the compounds responsible for the bioreduction of Ag+ ion and the stabilization of AgNPs produced, the functional group present in Cavendish banana peel extract was investigated using FTIR. AFM has proved to be very helpful in determining morphological features and the diameter of AgNPs in the range of 23-30 nm was confirmed by FESEM. DLS studies revealed that the average size of AgNPs was found to be around 297 nm. Zeta potential value for AgNPs obtained was -11 mV indicating the moderate stability of synthesized nanoparticles. The antibacterial activity of the nanoparticles was studied against Gram-positive and Gram-negative bacteria. Biosynthesized AgNPs showed a strong DPPH radical and ABTS scavengers compared to the aqueous peel extract of Cavendish banana.

  16. AAA application in diagnosis exams in a large public hospital, RS, Brazil; Aplicacao do AAA na realizacao de exames diagnosticos em um hospital publico de grande porte

    Energy Technology Data Exchange (ETDEWEB)

    Bacelar, A.; Ferret, A.A.; Vanni, S.; Galhardi, M.P.; Lykawka, R., E-mail: abacelar@hepa.ufrgs.br, E-mail: allferret@gmail.com, E-mail: svanni@hepa.ufrgs.br, E-mail: mpgalhardi@gmail.com, E-mail: rlykawka@hepa.ufrgs.br [Hospital de Clinicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil)

    2013-10-01

    Objective: the initiative AAA - Awareness , Appropriateness and Audit , promotes consciousness ( Awareness) , fitness ( Appropriateness ) and Audit ( Audit) . This paper analyzes the application of the concept in the AAA requests and justifications examinations using ionizing radiation within a large public hospital. Materials and methods: we collected and analyzed data between the years 2011 and 2012, concerning the number of exams performed with the use of radiation and their justifications. After, we sought to raise awareness of the clinical team through training on the risks and benefits of the various modalities of the radiology department and the need to justify the use of ionizing radiation on health. After the data were collected again of test requests for verification of the effectiveness of training. Results: the mean requests that need to be appropriate to the AAA in the last quarter of 2011 was 75 % lower than the average demands of the first quarter, matched against the last two months of 2012 increased by up to four times the number requests that require improvements in relation to the excellent results obtained in July 2012. Conclusion: it is shown in this paper the need of implementing this initiative AAA continuously added to the clinical staff awareness about the risk of the use of ionizing radiation, the appropriateness of the requests of these tests , as well as the control of this process in order to optimize use of ionizing radiation on health.

  17. EFECTO DEL SULPOMAG Y COMPLEJOS ORGÁNICOS COMO SUSTITUTOS PARCIALES DEL MEDIO DE CULTIVO DE MICROPROPAGACIÓN DE Musa sp. CV. CAVENDISH

    OpenAIRE

    Montenegro-Juárez, Frank E.; Consuelo Rojas-Idrogo; David Quevedo-Calle; Delgado-Paredes, Guillermo E.

    2014-01-01

    El fertilizante de origen natural Sulpomag, o sulfato de potasio y magnesio, constituido por K 2 O 22%, MgO 22%, S 18% y Cl (cloruro) 2,5% y los complejos orgánicos agua de coco 10 y 20% y caseína hidrolizada 250 y 500 mg.l -1 , como sustitutos parciales de las sales minerales de Murashige y Skoog (MS), fueron utilizados en la propagación in vitro de banano, Musa sp., cv. Cavendish. El objetivo de esta investigación fue inducir el crecimiento y desarrollo de plantas in vitro en condiciones mí...

  18. Dosimetric comparison of Acuros XB, AAA, and XVMC in stereotactic body radiotherapy for lung cancer.

    Science.gov (United States)

    Tsuruta, Yusuke; Nakata, Manabu; Nakamura, Mitsuhiro; Matsuo, Yukinori; Higashimura, Kyoji; Monzen, Hajime; Mizowaki, Takashi; Hiraoka, Masahiro

    2014-08-01

    To compare the dosimetric performance of Acuros XB (AXB), anisotropic analytical algorithm (AAA), and x-ray voxel Monte Carlo (XVMC) in heterogeneous phantoms and lung stereotactic body radiotherapy (SBRT) plans. Water- and lung-equivalent phantoms were combined to evaluate the percentage depth dose and dose profile. The radiation treatment machine Novalis (BrainLab AG, Feldkirchen, Germany) with an x-ray beam energy of 6 MV was used to calculate the doses in the composite phantom at a source-to-surface distance of 100 cm with a gantry angle of 0°. Subsequently, the clinical lung SBRT plans for the 26 consecutive patients were transferred from the iPlan (ver. 4.1; BrainLab AG) to the Eclipse treatment planning systems (ver. 11.0.3; Varian Medical Systems, Palo Alto, CA). The doses were then recalculated with AXB and AAA while maintaining the XVMC-calculated monitor units and beam arrangement. Then the dose-volumetric data obtained using the three different radiation dose calculation algorithms were compared. The results from AXB and XVMC agreed with measurements within ± 3.0% for the lung-equivalent phantom with a 6 × 6 cm(2) field size, whereas AAA values were higher than measurements in the heterogeneous zone and near the boundary, with the greatest difference being 4.1%. AXB and XVMC agreed well with measurements in terms of the profile shape at the boundary of the heterogeneous zone. For the lung SBRT plans, AXB yielded lower values than XVMC in terms of the maximum doses of ITV and PTV; however, the differences were within ± 3.0%. In addition to the dose-volumetric data, the dose distribution analysis showed that AXB yielded dose distribution calculations that were closer to those with XVMC than did AAA. Means ± standard deviation of the computation time was 221.6 ± 53.1 s (range, 124-358 s), 66.1 ± 16.0 s (range, 42-94 s), and 6.7 ± 1.1 s (range, 5-9 s) for XVMC, AXB, and AAA, respectively. In the phantom evaluations, AXB and XVMC agreed better with

  19. Isolation of Penicillium chrysogenum PEX1 and PEX6 encoding AAA proteins involved in peroxisome biogenesis

    OpenAIRE

    Kiel, JAKW; Hilbrands, RE; Bovenberg, RAL; Veenhuis, M.

    2000-01-01

    In Penicillium chrysogenum, key enzymes involved in the production of penicillin reside in peroxisomes. As a first step to understand the role of these organelles in penicillin biosynthesis, we set out to isolate the genes involved in peroxisome biogenesis. Here we report the cloning and characterization of P. chrysogenum PEX1 and PEX6, which encode proteins of the AAA family of ATPases. The second AAA module, which is essential for the function of Pex1p and Pex6p in peroxisome biogenesis, is...

  20. Norms for multivariate diagnosis of nutrient imbalance in the East African highland bananas (musa spp.aaa)

    NARCIS (Netherlands)

    Wairegi, L.; Asten, van P.

    2011-01-01

    Despite low yields and soil fertility problems, fertilizer use in the East African Highland banana (AAA-EA) production is absent. High fertilizer costs increase the need for site-specific fertilizer recommendations that address deficiencies. This study aimed to derive and compare norms for AAA-EA

  1. Fluid Characteristics in Abdominal Aortic Aneurysms (AAAs) and Its Correlation to Thrombus Formation

    Science.gov (United States)

    Tang, Rubing; Bar-Yoseph, Pinhas Z.; Lasheras, Juan

    2008-11-01

    It has been observed that most large Abdominal Aortic Aneurysms (AAAs) develop an intraluminal thrombus as they progressively enlarge. Previous studies have suggested that the build up of the thrombus may be associated with the altered hemodynamic patterns that arise inside the AAA. We have performed a parametrical computational study of the flow patterns inside enlarging AAA to investigate the possible mechanism controlling the thrombus formation. Pulsatile blood flows were simulated in idealized models of fusiform aneurysms with different dilatation ratios and the effects of shear-activated platelet accumulation and platelet/wall interaction were evaluated based on the calculated flow fields. The platelet activation level (PAL) was determined by computing the integral over time of flow shear stresses exerted over the platelets as they are transported throughout the aneurysm. Our results have shown that the values of PAL in AAAs are in fact smaller than the maximum value obtained in a healthy abdominal aorta. However, we show that the transportation of blood cells towards the wall and the formation of stagnation points on the aneurysm's wall play more significant roles in thrombus formation than PAL.

  2. Sexual Dysfunction After Conventional and Endovascular AAA Repair: Results of the DREAM Trial.

    NARCIS (Netherlands)

    Prinssen, M.; Buskens, E.; Nolthenius, R.P.T.; Sterkenburg, S. van; Teijink, J.A.; Blankensteijn, J.D.

    2004-01-01

    Purpose: To assess sexual function in the first postoperative year after elective endovascular aneurysm repair (EVAR) and open repair (OR) of abdominal aortic aneurysm (AAA).Methods: In the Dutch Randomized Endovascular Aneurysm Management (DREAM) trial, 153 patients (141 men; mean age 71 years,

  3. The drug diazaborine blocks ribosome biogenesis by inhibiting the AAA-ATPase Drg1

    NARCIS (Netherlands)

    Loibl, M.; Klein, I; Prattes, M.; Schmidt, C.; Kappel, L.; Zisser, G.; Gungl, A.; Krieger, E.; Pertschy, B.; Bergler, H.

    2014-01-01

    The drug diazaborine is the only known inhibitor of ribosome biogenesis and specifically blocks large subunit formation in eukaryotic cells. However, the target of this drug and the mechanism of inhibition were unknown. Here we identify the AAA-ATPase Drg1 as a target of diazaborine. Inhibitor

  4. SOFIA Technology: The NASA Airborne Astronomy Ambassador (AAA) Experience and Online Resources

    Science.gov (United States)

    Clark, C.; Harman, P. K.; Backman, D. E.

    2016-12-01

    SOFIA, an 80/20 partnership of NASA and the German Aerospace Center (DLR), consists of a modified Boeing 747SP carrying a reflecting telescope with an effective diameter of 2.5 meters. SOFIA is the largest airborne observatory in the world, capable of observations impossible for even the largest and highest ground-based telescopes. The SOFIA Program Office is at NASA ARC, Moffett Field, CA; the aircraft is based in Palmdale, CA. During its planned 20-year lifetime, SOFIA will foster development of new scientific instrumentation and inspire the education of young scientists and engineers. Astrophysicists are awarded time on SOFIA to study many kinds of astronomical objects and phenomena. Among the most interesting are: Star birth, evolution, and death Formation of new planetary systems Chemistry of complex molecules in space Planet and exoplanet atmospheres Galactic gas & dust "ecosystems" Environments around supermassive black holes SOFIA currently has eight instruments, five US-made and three German. The instruments — cameras, spectrometers, and a photometer,— operate at near-, mid- and far-infrared wavelengths, each spectral range being best suited to studying particular celestial phenomena. NASA's Airborne Astronomy Ambassadors' (AAAs) experience includes a STEM immersion component. AAAs are onboard during two overnight SOFIA flights that provide insight into the acquisition of scientific data as well as the interfaces between the telescope, instrument, & aircraft. AAAs monitor system performance and view observation targets from their dedicated workstation during flights. Future opportunities for school district partnerships leading to selection of future AAA cohorts will be offered in 2018-19. AAAs may access public archive data via the SOFIA Data Cycle System (DCS) https://dcs.sofia.usra.edu/. Additional SOFIA science and other resources are available at: www.sofia.usra.edu, including lessons that use photovoltaic circuits, and other technology for the

  5. Triple A or Allgrove syndrome. A case report with ophthalmic abnormalities and a novel mutation in the AAAS gene.

    Science.gov (United States)

    Villanueva-Mendoza, Cristina; artínez-Guzmán, Oswaldo; Rivera-Parra, David; Zenteno, Juan Carlos

    2009-03-01

    Triple A syndrome is a rare autosomal recessive disease characterized by achalasia, alacrima, adrenocorticotrophic hormone resistant adrenal failure and some neurologic abnormalities. We report a nine year old patient with alacrima, optic atrophy and achalasia with mutation in the AAAS gene. PCR amplification of the complete coding sequence as well as the exon-intron junctions of AAAS gene was performed in DNA from the patient and his parents. AAAS gene analysis demonstrated a homozygous A to G mutation at nucleotide position 122 in exon 1 in DNA from the patient. The novel mutation described confirms the diagnosis.

  6. Prevalência do grupo sangüíneo DEA 1 (subgrupos 1.1 e 1.2 em cães (Canis familiaris, Linnaeus, 1758 criados no Brasil

    Directory of Open Access Journals (Sweden)

    Adriana Alonso Novais

    1999-01-01

    Full Text Available Os cães possuem cinco grupos sangüíneos bem estabelecidos, compostos por sete determinantes antigênicos eritrocitários, os quais são denominados de "dog erythrocyte antigen" (DEA. O grupo DEA 1 (subgrupos 1.1, 1.2 e 1.3 tem sido considerado o mais importante no que se refere às transfusões de sangue. Isto ocorre porque esse grupo possui um alto potencial para estimulação antigênica e, dessa forma, pode estimular a produção de anticorpos se um receptor DEA 1 negativo receber uma transfusão de sangue DEA 1 positivo, levando a uma reação transfusional hemolítica em uma segunda transfusão com hemácias do tipo DEA 1. A freqüência de aparecimento do grupo DEA 1 é bem conhecida em outros países, porém, até então, não havia informações disponíveis sobre o referido grupo no Brasil. No presente estudo, objetivou-se avaliar a prevalência do grupo sangüíneo DEA 1 (subgrupos 1.1 e 1.2 em cães criados no Brasil. Para tanto, 150 cães de raças, sexos e idades diferentes, triados junto ao Hospital Veterinário da FCAV/UNESP, Campus de Jaboticabal, foram submetidos a tipagem sangüínea para o grupo DEA 1 (subgrupos 1.1 e 1.2 canino, utilizando-se reagentes adquiridos comercialmente junto ao Laboratório de Imunoematologia e Sorologia da Universidade de Michigan (EUA. Os resultados obtidos neste ensaio revelaram que a prevalência geral para o grupo DEA 1 é de 91,3%, consideradas as condições e características da população estudada, compreendendo 51,3% de cães do tipo DEA 1.1, 40% de cães do tipo DEA 1.2, e os 8,7% restantes sendo negativos para o referido grupo. A partir das prevalências encontradas, calculou-se que a probabilidade de um cão DEA 1 negativo receber sangue DEA 1.1, em uma primeira transfusão feita ao acaso, é de aproximadamente 4,5%. Sendo assim, este índice reflete um risco potencial para a sensibilização de um receptor DEA 1 negativo, o que deflagraria a produção de anticorpos. Posteriormente

  7. Substituent effects in double-helical hydrogen-bonded AAA-DDD complexes.

    Science.gov (United States)

    Wang, Hong-Bo; Mudraboyina, Bhanu P; Wisner, James A

    2012-01-27

    Two series of DDD and AAA hydrogen-bond arrays were synthesized that form triply-hydrogen-bonded double-helical complexes when combined in CDCl(3) solution. Derivatization of the DDD arrays with electron-withdrawing groups increases the complex association constants by up to a factor of 30 in those arrays examined. Derivatization of the AAA arrays with electron donating substituents reveals a similar magnitude effect on the complex stabilities. The effect of substitution on both types of arrays are modeled quite satisfactorily (R(2) > 0.96 in all cases) as free energy relationships with respect to the sums of their Hammett substituent constants. In all, the complex stabilities can be manipulated over more than three orders of magnitude (>20 kJ mol(-1)) using this type of modification. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. The two faces of hydrogen-bond strength on triple AAA-DDD arrays.

    Science.gov (United States)

    Lopez, Alfredo Henrique Duarte; Caramori, Giovanni Finoto; Coimbra, Daniel Fernando; Parreira, Renato Luis Tame; da Silva, Éder Henrique

    2013-12-02

    Systems that are connected through multiple hydrogen bonds are the cornerstone of molecular recognition processes in biology, and they are increasingly being employed in supramolecular chemistry, specifically in molecular self-assembly processes. For this reason, the effects of different substituents (NO2, CN, F, Cl, Br, OCH3 and NH2) on the electronic structure, and consequently on the magnitude of hydrogen bonds in triple AAA-DDD arrays (A=acceptor, D=donor) were evaluated in the light of topological [electron localization function (ELF) and quantum theory of atoms in molecules (QTAIM)], energetic [Su-Li energy-decomposition analysis (EDA) and natural bond orbital analysis (NBO)], and geometrical analysis. The results based on local H-bond descriptors (geometries, QTAIM, ELF, and NBO) indicate that substitutions with electron-withdrawing groups on the AAA module tend to strengthen, whereas electron-donating substituents tend to weaken the covalent character of the AAA-DDD intermolecular H-bonds, and also indicate that the magnitude of the effect is dependent on the position of substitution. In contrast, Su-Li EDA results show an opposite behavior when compared to local H-bond descriptors, indicating that electron-donating substituents tend to increase the magnitude of H-bonds in AAA-DDD arrays, and thus suggesting that the use of local H-bond descriptors describes the nature of H bonds only partially, not providing enough insight about the strength of such H bonds. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Effect of fertilizer insertion in the harvested mother banana plant pseudostem (Musa AAA Simmonds)

    OpenAIRE

    Felipe Galvis R; Andrés Uribe V; Gerardo Cayón S; Stanislav Magnitskiy; Juan Sebastián Henao

    2013-01-01

    The need for more efficient nutrient use in adverse conditions, such as droughts, facilitated the development of new alternatives for fertilizer application, such as direct insertion into the vascular system of the pseudostem of harvested banana plants (Musa AAA Simmonds), considering the plant interconnection between the mother plant and the sucker in succession. The objective of this study was to evaluate the effect of fertilizer insertion into the pseudostem of banana plants compared to th...

  10. Intraoperative platelet and plasma improves survival in patients operated for a rAAA: a follow-up evaluation

    DEFF Research Database (Denmark)

    Johansson, Per Ingemar; Swiatek, F.; Jorgensen, L.

    2008-01-01

    OBJECTIVES: Continued haemorrhage remains a significant contributor to mortality in massively transfused patients. We found that early administration of platelets and plasma reduced mortality from 54% to 36% in rAAA patients. The aim of the present evaluation was to evaluate whether reduced...... mortality in rAAA patients related to a pro-active transfusion therapy is maintained. DESIGN: Single-centre observational study. METHODS: Mortality of patients operated for rAAA 2006-07 was compared to that of patients operated 2004-05 (intervention group; n=50) and 2002-04 (control group, n=82). RESULTS......: 64 consecutive patients with rAAA received, similar to the intervention group, more platelets (5 and 4 vs. 0 units, P

  11. _ AAA~ AA _ _

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 12. The Man Who Knew Infinity Untutored Genius. Rajat Tandon. Book Review Volume 1 Issue 12 December 1996 pp 76-78. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/001/12/0076-0078 ...

  12. _, AA~ AAA _ _

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 4. Project Lifescape – Freshwater Fishes: Catfishes. R J Ranjit Daniels. Classroom Volume 5 Issue 4 April 2000 pp 97-107. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/005/04/0097-0107 ...

  13. SU-F-T-609: Impact of Dosimetric Variation for Prescription Dose Using Analytical Anisotropic Algorithm (AAA) in Lung SBRT

    Energy Technology Data Exchange (ETDEWEB)

    Kawai, D [Kanagawa Cancer Center, Yokohama, Kanagawa (Japan); Takahashi, R [Cancer Institute Hospital of Japanese Foundation for Cancer Research, Koto, Tokyo (Japan); Kamima, T [Cancer Institute Hospital Japanese Foundation for Cancer Research, Koto, Tokyo (Japan); Baba, H [The National Cancer Center Hospital East, Kshiwa, Chiba (Japan); Yamamoto, T; Kubo, Y [Otemae Hospital, Chuo-ku, Osaka (Japan); Ishibashi, S; Higuchi, Y [Sasebo City General Hospital, Sasebo, Nagasaki (Japan); Tani, K [St Luke’s International Hospital, Tokyo, Tokyo (Japan); Tachibana, H [National Cancer Center, Kashiwa, Chiba (Japan)

    2016-06-15

    Purpose: Actual irradiated prescription dose to patients cannot be verified. Thus, independent dose verification and second treatment planning system are used as the secondary check. AAA dose calculation engine has contributed to lung SBRT. We conducted a multi-institutional study to assess variation of prescription dose for lung SBRT when using AAA in reference to using Acuros XB and Clarkson algorithm. Methods: Six institutes in Japan participated in this study. All SBRT treatments were planed using AAA in Eclipse and Adaptive Convolve (AC) in Pinnacle3. All of the institutes used a same independent dose verification software program (Simple MU Analysis: SMU, Triangle Product, Ishikawa, Japan), which implemented a Clarkson-based dose calculation algorithm using CT image dataset. A retrospective analysis for lung SBRT plans (73 patients) was performed to compute the confidence limit (CL, Average±2SD) in dose between the AAA and the SMU. In one of the institutes, a additional analysis was conducted to evaluate the variations between the AAA and the Acuros XB (AXB). Results: The CL for SMU shows larger systematic and random errors of 8.7±9.9 % for AAA than the errors of 5.7±4.2 % for AC. The variations of AAA correlated with the mean CT values in the voxels of PTV (a correlation coefficient : −0.7) . The comparison of AXB vs. AAA shows smaller systematic and random errors of −0.7±1.7%. The correlation between dose variations for AXB and the mean CT values in PTV was weak (0.4). However, there were several plans with more than 2% deviation of AAPM TG114 (Maximum: −3.3 %). Conclusion: In comparison for AC, prescription dose calculated by AAA may be more variable in lung SBRT patient. Even AXB comparison shows unexpected variation. Care should be taken for the use of AAA in lung SBRT. This research is partially supported by Japan Agency for Medical Research and Development (AMED)

  14. Characterization of the binding specificity of Anguilla anguilla agglutinin (AAA) in comparison to Ulex europaeus agglutinin I (UEA-I).

    Science.gov (United States)

    Baldus, S E; Thiele, J; Park, Y O; Hanisch, F G; Bara, J; Fischer, R

    1996-08-01

    Using immunochemical and immunohistochemical methods, the binding site of Anguilla anguilla agglutinin (AAA) was characterized and compared with the related fucose-specific lectin from Ulex europaeus (UEA-I). In solid-phase enzyme-linked immunoassays, the two lectins recognized Fuc alpha 1-2Gal beta-HSA. AAA additionally cross-reacted with neoglycolipids bearing lacto-N-fucopentaose (LNFP) I [H type 1] and II [Le(a)] and lactodifucotetraose (LDFT) as glycan moieties. UEA-I, on the other hand, bound to a LDFT-derived neoglycolipid but not to the other neoglycolipids tested. Binding of AAA to gastric mucin was competitively neutralized by Le(a)-specific monoclonal antibodies. UEA-I binding, on the other hand, was reduced after co-incubation with H type 2- and Le(y)-specific monoclonal antibodies. According to our results, AAA reacts with fucosylated type 1 chain antigens, whereas UEA-I binds only to the alpha 1-2-fucosylated LDFT-derived neoglycolipid. In immunohistochemical studies, the reactivity of AAA and UEA-I in normal pyloric mucosa from individuals with known Lewis and secretor status was analysed. AAA showed a broad reaction in the superficial pyloric mucosa from secretors and non-secretors, but AAA reactivity was more pronounced in Le(a+b-) individuals. On the other hand, UEA-I stained the superficial pyloric mucosa only from secretor individuals. A staining of deep mucous glands by the lectins was found in all specimens. Both reacted with most human carcinomas of different origin. Slight differences in their binding pattern were observed and may be explained by the different fine-specificities of the lectins.

  15. Morphological State as a Predictor for Reintervention and Mortality After EVAR for AAA

    Energy Technology Data Exchange (ETDEWEB)

    Ohrlander, Tomas [Eksjoe County Hospital (Sweden); Dencker, Magnus [Malmoe University Hospital, Department of Clinical Physiology and Nuclear Medicine (Sweden); Acosta, Stefan, E-mail: stefan.acosta@telia.com [Malmoe University Hospital, Vascular Center Malmoe-Lund (Sweden)

    2012-10-15

    Purpose: This study was designed to assess aorto-iliac morphological characteristics in relation to reintervention and all-cause long-term mortality in patients undergoing standard EVAR for infrarenal AAA. Methods: Patients treated with EVAR (Zenith{sup Registered-Sign} Stentgrafts, Cook) between May 1998 and February 2006 were prospectively enrolled in a computerized database where comorbidities and preoperative aneurysm morphology were entered. Reinterventions and mortality were checked until December 1, 2010. Median follow-up time was 68 months. Results: A total of 304 patients were included, of which 86% were men. Median age was 74 years. The reintervention rate was 23.4% (71/304). A greater diameter of the common iliac artery (p = 0.037; hazard ratio (HR) 1.037 [1.002-1.073]) was an independent factor for an increased number of reinterventions. The 30-day mortality rate was 3.0% (9/304). Aneurysm-related deaths due to AAA occurred in 4.9% (15/304). Five patients died due to a concomitant ruptured thoracic aortic aneurysm. The mortality until end of follow-up was 54.3% (165/304). The proportion of deaths caused by vascular diseases was 61.6%. The severity of angulation of the iliac arteries (p = 0.014; HR 1.018 [95% confidence interval (CI) 1.004-1.033]) and anemia (p = 0.044; HR 2.79 [95% CI 1.029-7.556]) remained as independent factors associated with all-cause long-term mortality. The crude reintervention-free survival rate at 1, 3, and 5 years was 84.5%, 64.8%, and 51.6%, respectively. Conclusions: The initial aorto-iliac morphological state in patients scheduled for standard EVAR for AAA seems to be strongly related to the need for reinterventions and long-term mortality.

  16. Monitoring and Staging Abdominal Aortic Aneurysm (AAA) Disease with Pulse Wave Imaging (PWI)

    Science.gov (United States)

    Nandlall, Sacha D.; GoldKlang, Monica P.; Kalashian, Aubrey; Dangra, Nida A.; D’Armiento, Jeanine M.; Konofagou, Elisa E.

    2014-01-01

    The Abdominal Aortic Aneurysm (AAA) is a silent and often deadly vascular disease caused by the localized weakening of the arterial wall. Previous work has shown that local changes in wall stiffness can be detected with Pulse Wave Imaging (PWI), which is a noninvasive technique for tracking the propagation of pulse waves along the aorta at high spatial and temporal resolutions. This study aims at assessing the capability of PWI to monitor and stage AAA progression in a murine model of the disease. ApoE/TIMP-1 knockout mice (N = 18) were given angiotensin II for 30 days via subcutaneously implanted osmotic pumps. The suprarenal sections of the abdominal aortas were imaged every 2-3 days after implantation using a 30 MHz Visualsonics Vevo 770 with 115 μm lateral resolution. Pulse wave propagation was monitored at an effective frame rate of 8 kHz by using retrospective electrocardiogram (ECG) gating and by performing 1-D cross-correlation on the radio-frequency (RF) signals to obtain the displacements induced by the waves. In normal aortas, the pulse waves propagated at constant velocities (2.8±0. 9 m/s, r2 = 0.89±0.11), indicating that the composition of these vessels was relatively homogeneous. In the mice that developed AAAs (N = 10), the wave speeds in the aneurysm sac were 45% lower (1.6±0.6 m/s) and were more variable (r2 = 0.66±0.23). Moreover, the wave-induced wall displacements were at least 80% lower within the sacs compared to the surrounding vessel. Finally, in mice that developed fissures (N = 5) or ruptures (N = 3) at the sites of their AAA, higher displacements directed out of the lumen and with no discernible wave pattern (r2 PWI can be used to distinguish normal murine aortas from aneurysmal, fissured, and ruptured ones. Hence, PWI could potentially be used to monitor and stage human aneurysms by providing information complementary to standard B-modes. PMID:25130446

  17. Dissection of Axial-Pore Loop Function during Unfolding and Translocation by a AAA+ Proteolytic Machine

    Directory of Open Access Journals (Sweden)

    Ohad Iosefson

    2015-08-01

    Full Text Available In the axial channels of ClpX and related hexameric AAA+ protein-remodeling rings, the pore-1 loops are thought to play important roles in engaging, mechanically unfolding, and translocating protein substrates. How these loops perform these functions and whether they also prevent substrate dissociation to ensure processive degradation by AAA+ proteases are open questions. Using ClpX pore-1-loop variants, single-molecule force spectroscopy, and ensemble assays, we find that the six pore-1 loops function synchronously to grip and unfold protein substrates during a power stroke but are not important in preventing substrate slipping between power strokes. The importance of grip strength is task dependent. ClpX variants with multiple mutant pore-1 loops translocate substrates as well as the wild-type enzyme against a resisting force but show unfolding defects and a higher frequency of substrate release. These problems are magnified for more mechanically stable target proteins, supporting a threshold model of substrate gripping.

  18. The Gore Excluder AAA endoprosthesis with C3 delivery system: results in high-volume centers.

    Science.gov (United States)

    Krajcer, Z

    2014-02-01

    The use of endovascular aortic aneurysm repair (EVAR) has increased dramatically, chiefly because of its low perioperative morbidity compared with open surgery. Challenges to the success of EVAR remain, however, with the most important being features of the patient's infrarenal aortic neck anatomy that make optimal placement of the endoprosthesis difficult. These features include a short, wide, severely angulated, or reverse-tapered neck and the presence of calcifications or thrombus. Suboptimal endograft positioning may necessitate use of aortic cuffs, thereby increasing the time and cost of an EVAR procedure, or increase the likelihood of graft migration, which can lead to endoleaks and additional interventions. Efforts to improve outcomes of EVAR and expand its application in patients with challenging aortic neck anatomy have focused on the development of endografts and delivery systems with innovative designs. The low-permeability Gore Excluder AAA endoprosthesis with C3 delivery system, which became available in Europe and the United States in 2010, represents one such design. The C3 system allows the proximal end of the endoprosthesis to be reconstrained after insertion so that the device can, if necessary, be rotated or moved cranially or caudally. Repositioning may facilitate contralateral gate cannulation and placement of the endograft closer to the lowest renal artery (without covering its orifice), thereby possibly decreasing the risk of inadequate sealing and consequent graft migration and endoleaks. Early clinical studies of the Gore Excluder AAA endoprosthesis with C3 delivery system have yielded promising results.

  19. Effects of the Transient Blood Flow-Wall Interaction on the Wall Stress Distribution in Abdominal Aortic Aneurysm (AAA)

    Science.gov (United States)

    Tang, Rubing; Geindreau, Christian; Lasheras, Juan

    2006-11-01

    Our static finite element analysis (FEA) of both idealized and real clinical models has shown that the maximum diameter and asymmetry have substantial influence on the AAA wall stress distribution. The thrombus inside the AAA was also found to reduce the magnitude of the wall stresses. To achieve a better understanding of the wall stress distribution in real AAAs, a dynamic FEA was also performed. We considered models, both symmetric and non-symmetric, in which the aorta is assumed isotropic with nonlinear material properties. For the limiting case of rigid walls, the evolution of the flow pattern and the wall shear stresses due to fluid flow at different stages of cardiac cycle predicted by our simulations are compared with experimental results obtained in in-vitro models. A good agreement is found between both results. Finally, we have extended the analysis to the physiologically correct case of deformable walls and characterized the transient effects on the wall stresses.

  20. Moyamoya disease-associated protein mysterin/RNF213 is a novel AAA+ ATPase, which dynamically changes its oligomeric state

    Science.gov (United States)

    Morito, Daisuke; Nishikawa, Kouki; Hoseki, Jun; Kitamura, Akira; Kotani, Yuri; Kiso, Kazumi; Kinjo, Masataka; Fujiyoshi, Yoshinori; Nagata, Kazuhiro

    2014-03-01

    Moyamoya disease is an idiopathic human cerebrovascular disorder that is characterized by progressive stenosis and abnormal collateral vessels. We recently identified mysterin/RNF213 as its first susceptibility gene, which encodes a 591-kDa protein containing enzymatically active P-loop ATPase and ubiquitin ligase domains and is involved in proper vascular development in zebrafish. Here we demonstrate that mysterin further contains two tandem AAA+ ATPase modules and forms huge ring-shaped oligomeric complex. AAA+ ATPases are known to generally mediate various biophysical and mechanical processes with the characteristic ring-shaped structure. Fluorescence correlation spectroscopy and biochemical evaluation suggested that mysterin dynamically changes its oligomeric forms through ATP/ADP binding and hydrolysis cycles. Thus, the moyamoya disease-associated gene product is a unique protein that functions as ubiquitin ligase and AAA+ ATPase, which possibly contributes to vascular development through mechanical processes in the cell.

  1. Structure determination of disease associated peak AAA from l-Tryptophan implicated in the eosinophilia-myalgia syndrome.

    Science.gov (United States)

    Klarskov, Klaus; Gagnon, Hugo; Boudreault, Pierre-Luc; Normandin, Chad; Plancq, Baptiste; Marsault, Eric; Gleich, Gerald J; Naylor, Stephen

    2018-01-05

    The eosinophilia-myalgia syndrome (EMS) outbreak of 1989 that occurred in the USA and elsewhere was caused by the ingestion of l-Tryptophan (L-Trp) solely manufactured by the Japanese company Showa Denko K.K. (SD). Six compounds present in the SD L-Trp were reported to be case-associated contaminants. However, "one" of these compounds, Peak AAA has remained structurally uncharacterized, despite the fact that it was described as "the only statistically significant (p=0.0014) contaminant". Here, we employ on-line microcapillary-high performance liquid chromatography-electrospray ionization mass spectrometry (LC-MS), and tandem mass spectrometry (MS/MS) to determine that Peak AAA is in fact two structurally related isomers. Peak AAA1 and Peak AAA2 differed in LC retention times, and were determined by accurate mass-LC-MS to both have a protonated molecular ion (MH+) of mass 343.239Da (Da), corresponding to a molecular formula of C21H30N2O2, and possessing eight degrees of unsaturation (DoU) for the non-protonated molecule. By comparing the LC-MS and LC-MS-MS retention times and spectra with authentic synthetic standards, Peak AAA1 was identified as the intermolecular condensation product of L-Trp with anteiso 7-methylnonanoic acid, to afford (S)-2-amino-3-(2-((S,E)-7-methylnon-1-en-1-yl)-1H-indol-3-yl)propanoic acid. Peak AAA2 was determined to be a condensation product of L-Trp with decanoic acid, which produced (S)-2-amino-3-(2-((E)-dec-1-en-1-yl)-1H-indol-3-yl)propanoic acid. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Characterization of South African isolates of Fusarium oxysporum f.sp cubense from Cavendish banana

    Directory of Open Access Journals (Sweden)

    Tom Gordon

    2010-04-01

    Full Text Available Fusarium wilt, caused by the soil-borne fungus Fusarium oxysporum f.sp. cubense (Foc, is a serious vascular disease of bananas in most subtropical and tropical regions of the world. Twenty-four vegetative compatibility groups (VCGs and three pathogenic races have been identified in Foc, reflecting a relatively high genetic diversity for an asexual fungus. To characterise a South African population of Foc, a collection of 128 isolates from diverse geographic origins were isolated from diseased Cavendish bananas and subjected to VCG analysis and sequencing of the translation elongation factor 1-α (TEF gene region. The presence of mating type genes was also determined using MAT-1 and MAT-2 specific primers. VCG 0120 was established as the only VCG of Foc present in the South African population studied. Only the MAT-2 idiomorph was present in all the local isolates of Foc. A phylogenetic analysis of DNA sequences of the TEF gene region revealed that the South African isolates grouped closely with VCG 0120 isolates from Australia and Asia. These results suggest that the South African population of Foc was most likely introduced in a limited number of events and that it had spread with infected planting material within the country. The presence of only one mating type and the limited diversity in this pathogen render it unlikely to rapidly overcome disease management strategies involving host resistance.

  3. Analysis of positional candidate genes in the AAA1 susceptibility locus for abdominal aortic aneurysms on chromosome 19

    Directory of Open Access Journals (Sweden)

    Ferrell Robert E

    2011-01-01

    Full Text Available Abstract Background Abdominal aortic aneurysm (AAA is a complex disorder with multiple genetic risk factors. Using affected relative pair linkage analysis, we previously identified an AAA susceptibility locus on chromosome 19q13. This locus has been designated as the AAA1 susceptibility locus in the Online Mendelian Inheritance in Man (OMIM database. Methods Nine candidate genes were selected from the AAA1 locus based on their function, as well as mRNA expression levels in the aorta. A sample of 394 cases and 419 controls was genotyped for 41 SNPs located in or around the selected nine candidate genes using the Illumina GoldenGate platform. Single marker and haplotype analyses were performed. Three genes (CEBPG, PEPD and CD22 were selected for DNA sequencing based on the association study results, and exonic regions were analyzed. Immunohistochemical staining of aortic tissue sections from AAA and control individuals was carried out for the CD22 and PEPD proteins with specific antibodies. Results Several SNPs were nominally associated with AAA (p CEBPG, peptidase D (PEPD, and CD22. Haplotype analysis found a nominally associated 5-SNP haplotype in the CEBPG/PEPD locus, as well as a nominally associated 2-SNP haplotype in the CD22 locus. DNA sequencing of the coding regions revealed no variation in CEBPG. Seven sequence variants were identified in PEPD, including three not present in the NCBI SNP (dbSNP database. Sequencing of all 14 exons of CD22 identified 20 sequence variants, five of which were in the coding region and six were in the 3'-untranslated region. Five variants were not present in dbSNP. Immunohistochemical staining for CD22 revealed protein expression in lymphocytes present in the aneurysmal aortic wall only and no detectable expression in control aorta. PEPD protein was expressed in fibroblasts and myofibroblasts in the media-adventitia border in both aneurysmal and non-aneurysmal tissue samples. Conclusions Association testing

  4. Inter-ring rotations of AAA ATPase p97 revealed by electron cryomicroscopy.

    Science.gov (United States)

    Yeung, Heidi O; Förster, Andreas; Bebeacua, Cecilia; Niwa, Hajime; Ewens, Caroline; McKeown, Ciarán; Zhang, Xiaodong; Freemont, Paul S

    2014-03-05

    The type II AAA+ protein p97 is involved in numerous cellular activities, including endoplasmic reticulum-associated degradation, transcription activation, membrane fusion and cell-cycle control. These activities are at least in part regulated by the ubiquitin system, in which p97 is thought to target ubiquitylated protein substrates within macromolecular complexes and assist in their extraction or disassembly. Although ATPase activity is essential for p97 function, little is known about how ATP binding or hydrolysis is coupled with p97 conformational changes and substrate remodelling. Here, we have used single-particle electron cryomicroscopy (cryo-EM) to study the effect of nucleotides on p97 conformation. We have identified conformational heterogeneity within the cryo-EM datasets from which we have resolved two major p97 conformations. A comparison of conformations reveals inter-ring rotations upon nucleotide binding and hydrolysis that may be linked to the remodelling of target protein complexes.

  5. Toxicidad de boro en plantaciones de banano(Musa AAA en Costa Rica

    Directory of Open Access Journals (Sweden)

    Alfonso Vargas

    2007-01-01

    Full Text Available En las hojas de plantas de banano (Musa AAA, cvs. Grande Naine y Valery, se observó una necrosis marginal irregular y continua, la cual se desarrolló a partir de un área clorótica igualmente irregular, que avanzó del margen hacia el interior de la hoja. La parte central de la lámina foliar retuvo siempre su coloración verde original. Los análisis de suelo y tejido foliar mostraron que los síntomas fueron causados por altas concentraciones de boro, debido ya fuese a aplicaciones excesivas del nutrimento al suelo y al follaje, o por el efecto de aplicaciones muy frecuentes de boro vía fertirriego, combinado con una disminución de la concentración de calcio en la hoja

  6. The AAA-ATPase NVL2 is a telomerase component essential for holoenzyme assembly

    Energy Technology Data Exchange (ETDEWEB)

    Her, Joonyoung [Departments of Biology and Integrated Omics for Biomedical Science, Yonsei University, Seoul 120-749 (Korea, Republic of); Chung, In Kwon, E-mail: topoviro@yonsei.ac.kr [Departments of Biology and Integrated Omics for Biomedical Science, Yonsei University, Seoul 120-749 (Korea, Republic of)

    2012-01-20

    Highlights: Black-Right-Pointing-Pointer Identification of the AAA-ATPase NVL2 as a novel hTERT-interacting protein. Black-Right-Pointing-Pointer NVL2 associates with catalytically active telomerase via an interaction with hTERT. Black-Right-Pointing-Pointer NVL2 is a telomerase component essential for holoenzyme assembly. Black-Right-Pointing-Pointer ATP-binding activity of NVL2 is required for hTERT binding and telomerase assembly. -- Abstract: Continued cell proliferation requires telomerase to maintain functional telomeres that are essential for chromosome integrity. Although the core enzyme includes a telomerase reverse transcriptase (TERT) and a telomerase RNA component (TERC), a number of auxiliary proteins have been identified to regulate telomerase assembly, localization, and enzymatic activity. Here we describe the characterization of the AAA-ATPase NVL2 as a novel hTERT-interacting protein. NVL2 interacts and co-localizes with hTERT in the nucleolus. NLV2 is also found in association with catalytically competent telomerase in cell lysates through an interaction with hTERT. Depletion of endogenous NVL2 by small interfering RNA led to a decrease in hTERT without affecting the steady-state levels of hTERT mRNA, thereby reducing telomerase activity, suggesting that NVL2 is an essential component of the telomerase holoenzyme. We also found that ATP-binding activity of NVL2 is required for hTERT binding as well as telomerase assembly. Our findings suggest that NVL2, in addition to its role in ribosome biosynthesis, is essential for telomerase biogenesis and provides an alternative approach for inhibiting telomerase activity in cancer.

  7. Mineral fertilizers improve the sensory quality of East African Highland bananas (Musa AAA-EA, cv. Kisansa)

    NARCIS (Netherlands)

    Taulya, G.; Asten, van P.J.A.; Nowakunda, K.; Kaddu-Mukasa, P.

    2010-01-01

    Some farmers in Uganda believe that fertilizers negatively affect the sensory attributes of cooking type bananas. This belief may hamper the adoption of fertilizers. To verify the validity of this belief, bunches (Musa AAA-EA, cv. ‘Kisansa’) from fertilized (i.e. N-P-K-Mg-Zn-S-B-Mo) and

  8. Foot-and-Mouth Disease Virus 2C Is a Hexameric AAA+ Protein with a Coordinated ATP Hydrolysis Mechanism

    DEFF Research Database (Denmark)

    Sweeney, Trevor; Cisnetto, Valentina; Bose, Daniel

    2010-01-01

    Foot-and-mouth disease virus (FMDV), a positive sense, single-stranded RNA virus, causes a highly contagious disease in cloven-hoofed livestock. Like other picornaviruses, FMDV has a conserved 2C protein assigned to the superfamily 3 helicases a group of AAA+ ATPases that has a predicted N...

  9. A conserved inter-domain communication mechanism regulates the ATPase activity of the AAA-protein Drg1

    NARCIS (Netherlands)

    Prattes, M.; Loibl, M.; Zisser, G.; Luschnig, D.; Kappel, L.; Rossler, I.; Grassegger, M.; Hromic, A.; Krieger, E.; Gruber, K.; Pertschy, B.; Bergler, H.

    2017-01-01

    AAA-ATPases fulfil essential roles in different cellular pathways and often act in form of hexameric complexes. Interaction with pathway-specific substrate and adaptor proteins recruits them to their targets and modulates their catalytic activity. This substrate dependent regulation of ATP

  10. Mineral fertilizer response and nutrient use efficiencies of East African highland banana (Musa spp., AAA-EAHB, cv. Kisansa)

    NARCIS (Netherlands)

    Nyombi, K.; Asten, van P.J.A.; Corbeels, M.; Taulya, G.; Leffelaar, P.A.; Giller, K.E.

    2010-01-01

    Poor yields of East African highland bananas (Musa spp., AAA-EAHB) on smallholder farms have often been attributed to problems of poor soil fertility. We measured the effects of mineral fertilizers on crop performance at two sites over two to three crop cycles; Kawanda in central Uganda and Ntungamo

  11. Pareto front analysis of 6 and 15 MV dynamic IMRT for lung cancer using pencil beam, AAA and Monte Carlo

    Science.gov (United States)

    Ottosson, R. O.; Karlsson, A.; Behrens, C. F.

    2010-08-01

    The pencil beam dose calculation method is frequently used in modern radiation therapy treatment planning regardless of the fact that it is documented inaccurately for cases involving large density variations. The inaccuracies are larger for higher beam energies. As a result, low energy beams are conventionally used for lung treatments. The aim of this study was to analyze the advantages and disadvantages of dynamic IMRT treatment planning for high and low photon energy in order to assess if deviating from the conventional low energy approach could be favorable in some cases. Furthermore, the influence of motion on the dose distribution was investigated. Four non-small cell lung cancer cases were selected for this study. Inverse planning was conducted using Varian Eclipse. A total number of 31 dynamic IMRT plans, distributed amongst the four cases, were created ranging from PTV conformity weighted to normal tissue sparing weighted. All optimized treatment plans were calculated using three different calculation algorithms (PBC, AAA and MC). In order to study the influence of motion, two virtual lung phantoms were created. The idea was to mimic two different situations: one where the GTV is located centrally in the PTV and another where the GTV was close to the edge of the PTV. PBC is in poor agreement with MC and AAA for all cases and treatment plans. AAA overestimates the dose, compared to MC. This effect is more pronounced for 15 than 6 MV. AAA and MC both predict similar perturbations in dose distributions when moving the GTV to the edge of the PTV. PBC, however, predicts results contradicting those of AAA and MC. This study shows that PB-based dose calculation algorithms are clinically insufficient for patient geometries involving large density inhomogeneities. AAA is in much better agreement with MC, but even a small overestimation of the dose level by the algorithm might lead to a large part of the PTV being underdosed. It is advisable to use low energy as a

  12. Adsorption Study on Moringa Oleifera Seeds and Musa Cavendish as Natural Water Purification Agents for Removal of Lead, Nickel and Cadmium from Drinking Water

    Science.gov (United States)

    Aziz, N. A. A.; Jayasuriya, N.; Fan, L.

    2016-07-01

    The effectiveness of plant based materials Moringa oleifera (Moringa) seeds and Musa cavendish (banana peel) for removing heavy metals namely lead (Pb), nickel (Ni) and cadmium (Cd) from contaminated groundwater was studied. Tests were carried out with individual and combined biomass at neutral pH condition on synthetic groundwater samples. The optimum biomass doses were determined as 200 mg/L for single biomass and 400 mg/L (in the ratio of 200 mg/L: 200 mg/L) for combined biomasses and used for adsorption isotherm studies with contact time of 30 minutes. Results showed that combined biomasses was able to met the Pb, Ni and Cd WHO standards from higher Pb, Ni and Cd initial concentrations which were up to 40 µg/L, 50 µg/L 9 µg/L, respectively compared to individual biomass of Moringa seed and banana peel. Moringa seeds exhibited the highest removal of Pb (81%) while the combined biomasses was most effective in removing Ni (74%) and Cd (97%) over wider their initial concentration ranges. The experimental data were linearized with Langmuir and Freundlich adsorption isotherm models. Freundlich model described the Pb adsorption better than the Langmuir model for all the tested biomasses. However, the Langmuir model fit better with the experimental data of Ni adsorption by Moringa seeds. Both models showed negligible differences in the coefficient of determination (R2) when applied for Ni and Cd adsorption on banana peel and combined biomasses, suggesting that there were multiple layers on the biomass interacting with the metals. Chemisorption is suggested to be involved in Pb adsorption for all tested biomasses as the value of nF calculated was lower than one. This type of adsorption could explain the phenomenon of different behavior of Pb removal and the higher Pb adsorption capacity (represented by KF values) compared to Ni and Cd. The study demonstrates that Moringa seeds, banana peel and their combination have the potential to be used as a natural alternative

  13. Target dose study of effects of changes in the AAA calculation resolution on lung SABR plan

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dae Il; Son, Sang Jun; Ahn, Bum Seok; Jung, Chi Hoon; Yoo, Suk Hyun [Dept. of Radiation Oncology, Seoul National University Hospital, Seoul (Korea, Republic of)

    2014-12-15

    Changing the calculation grid of AAA in Lung SABR plan and to analyze the changes in target dose, and investigated the effects associated with it, and considered a suitable method of application. 4D CT image that was used to plan all been taken with Brilliance Big Bore CT (Philips, Netherlands) and in Lung SABR plan(Eclipse{sup TM} ver10.0.42, Varian, the USA), use anisotropic analytic algorithm(AAA, ver.10, Varian Medical Systems, Palo Alto, CA, USA) and, was calculated by the calculation grid 1.0, 3.0, 5.0 mm in each Lung SABR plan. Lung SABR plan of 10 cases are using each of 1.0 mm, 3.0 mm, 5.0 mm calculation grid, and in case of use a 1.0 mm calculation grid V98 of the prescribed dose is about 99.5%±1.5%, Dmin of the prescribed dose is about 92.5±1.5% and Homogeneity Index(HI) is 1.0489±0.0025. In the case of use a 3.0 mm calculation grid V98 dose of the prescribed dose is about 90±4.5% , Dmin of the prescribed dose is about 87.5±3% and HI is about 1.07±1. In the case of use a 5.0 mm calculation grid V98 dose of the prescribed dose is about 63±15%, Dmin of the prescribed dose is about 83±4% and HI is about 1.13±0.2, respectively. The calculation grid of 1.0 mm is better improves the accuracy of dose calculation than using 3.0 mm and 5.mm, although calculation times increase in the case of smaller PTV relatively. As lung, spread relatively large and low density and small PTV, it is considered and good to use a calculation grid of 1.0 mm.

  14. AAAS Mass Media Science and Engineering Fellowship Program: Building Communication Skills in Young Scientists

    Science.gov (United States)

    Pasco, S.

    2006-12-01

    The AAAS Mass Media Science &Engineering Fellowship program has succeeded in training scientists to become more effective communicators for more than 30 years. The program places advanced science, engineering and mathematics students at media sites to work as science reporters for ten weeks each summer. AAAS places between 15 to 20 students a year at newspapers, magazines and radio stations. Our goal is to create better science communicators who understand their role in fostering the public's understanding of science. Fellows leave the program with a greater awareness of how to communicate complex issues by making the connection as to why people should be interested in certain developments, and more specifically, how they will impact their communities. 2004 AGU Fellow Rei Ueyama put her lessons learned to good use during her Fellowship at the Sacramento Bee. "In a regional paper like The Bee, a (story) also had to have a local touch. I needed to show why people in Sacramento (or California) should bother to read the story. One example is the story I wrote about seeding the ocean with iron particles to fight global warming. Since ocean fertilization is a global issue, I had to clearly specify the reason why The Bee and not The New York Times was running the story. The local angle I chose was to point out that the core group of scientists involved in this study was from Monterey Bay, Calif." Many alumni tell us the program has been an integral force in shaping the course of their career. Similarly, sites often report that having a scientist on staff is an invaluable resource that allows them to cover additional science stories as well as report some technical stories in more depth. The American Geophysical Union has sponsored a Mass Media Fellow since 1997. Sponsorship allows affiliate program partners to establish connections with young professionals in their field. They are then also able to take advantage of the communication skills resident in their alumni base

  15. Effect of fertilizer insertion in the harvested mother banana plant pseudostem (Musa AAA Simmonds

    Directory of Open Access Journals (Sweden)

    Felipe Galvis R

    2013-04-01

    Full Text Available The need for more efficient nutrient use in adverse conditions, such as droughts, facilitated the development of new alternatives for fertilizer application, such as direct insertion into the vascular system of the pseudostem of harvested banana plants (Musa AAA Simmonds, considering the plant interconnection between the mother plant and the sucker in succession. The objective of this study was to evaluate the effect of fertilizer insertion into the pseudostem of banana plants compared to the conventional soil fertilization system. The study was conducted at two locations (north and center of Urabá region, setting different rates of fertilizer treatments (75, 100 and 125% of the commercial rate inserted at different heights (0.6 m and 0.9 m with a soil application of fertilizers as a control treatment. Biometric (height, pseudostem diameter, number of leaves, physiological (specific leaf area and specific leaf weight, and production variables were evaluated in the plants. According to the results, it was evident that the 0.9 m insertion height of the fertilizer was better than 0.6 m and the soil application. Although no significant differences were found between doses of fertilizer, we observed a trend of better performance for plants in treatments of 75% and 100% fertilizer dose inserted at 0.9 m

  16. AAA-ATPase FIDGETIN-LIKE 1 and Helicase FANCM Antagonize Meiotic Crossovers by Distinct Mechanisms.

    Directory of Open Access Journals (Sweden)

    Chloe Girard

    2015-07-01

    Full Text Available Meiotic crossovers (COs generate genetic diversity and are critical for the correct completion of meiosis in most species. Their occurrence is tightly constrained but the mechanisms underlying this limitation remain poorly understood. Here we identified the conserved AAA-ATPase FIDGETIN-LIKE-1 (FIGL1 as a negative regulator of meiotic CO formation. We show that Arabidopsis FIGL1 limits CO formation genome-wide, that FIGL1 controls dynamics of the two conserved recombinases DMC1 and RAD51 and that FIGL1 hinders the interaction between homologous chromosomes, suggesting that FIGL1 counteracts DMC1/RAD51-mediated inter-homologue strand invasion to limit CO formation. Further, depleting both FIGL1 and the previously identified anti-CO helicase FANCM synergistically increases crossover frequency. Additionally, we showed that the effect of mutating FANCM on recombination is much lower in F1 hybrids contrasting from the phenotype of inbred lines, while figl1 mutation equally increases crossovers in both contexts. This shows that the modes of action of FIGL1 and FANCM are differently affected by genomic contexts. We propose that FIGL1 and FANCM represent two successive barriers to CO formation, one limiting strand invasion, the other disassembling D-loops to promote SDSA, which when both lifted, leads to a large increase of crossovers, without impairing meiotic progression.

  17. In vitro mutagenesis in embryogenic cell suspensions of banana cv. Grande naine (Musa AAA

    Directory of Open Access Journals (Sweden)

    Idalmis Bermúdez-Caraballoso

    2016-04-01

    Full Text Available Somatic embryogenesis is a useful process for clonal propagation and genetic improvement by induction of mutations. This work was carried out with the objective of determining the effect of 60Co source Gamma radiations on embryogenic cell suspensions of banana cv. 'Grande naine' (Musa AAA until conversion to plants. Different doses of radiation (0, 30, 40, 50, 60, 70 and 80 Gy were applied to embryogenic cell suspensions in the multiplication phase and the embryos were later formed, matured and germinated. To determine the ex vitro response of the population of plants obtained these were transferred to greenhouse. The results showed that with somatic embryos formed fresh mass no differences were observed between the effect of the different doses of radiation applied and the control. However, the radiation dose affected the percentage of somatic embryo formation and germination. Plants with phenotypic variations were regenerated with 40 Gy. The results at the greenhouse showed that as radiation doses increased up to 50 Gy, the frequency of variations increased. With higher doses of radiation the survival of the plants was affected.   Keywords: Gamma radiation, in vitro mutagenesis, radiation dose, radiosensibility, somatic embryo

  18. Zinc and ATP Binding of the Hexameric AAA-ATPase PilF from Thermus thermophilus

    Science.gov (United States)

    Salzer, Ralf; Herzberg, Martin; Nies, Dietrich H.; Joos, Friederike; Rathmann, Barbara; Thielmann, Yvonne; Averhoff, Beate

    2014-01-01

    The traffic AAA-ATPase PilF is essential for pilus biogenesis and natural transformation of Thermus thermophilus HB27. Recently, we showed that PilF forms hexameric complexes containing six zinc atoms coordinated by conserved tetracysteine motifs. Here we report that zinc binding is essential for complex stability. However, zinc binding is neither required for pilus biogenesis nor natural transformation. A number of the mutants did not exhibit any pili during growth at 64 °C but still were transformable. This leads to the conclusion that type 4 pili and the DNA translocator are distinct systems. At lower growth temperatures (55 °C) the zinc-depleted multiple cysteine mutants were hyperpiliated but defective in pilus-mediated twitching motility. This provides evidence that zinc binding is essential for the role of PilF in pilus dynamics. Moreover, we found that zinc binding is essential for complex stability but dispensable for ATPase activity. In contrast to many polymerization ATPases from mesophilic bacteria, ATP binding is not required for PilF complex formation; however, it significantly increases complex stability. These data suggest that zinc and ATP binding increase complex stability that is important for functionality of PilF under extreme environmental conditions. PMID:25202014

  19. Effect of the cytokinins combination on adventitious buds formation in banana cv. 'Gros Michel' (Musa AAA

    Directory of Open Access Journals (Sweden)

    Idalmis Bermúdez-Caraballoso

    2017-03-01

    Full Text Available Cytokinins are used for adventitious buds formation but high concentrations may have negative effects on plant regeneration. The aim of the present investigation was to determine the effect of different combinations of cytokinins on the induction of adventitious buds of cultivar ‘Gros Michel’ (Musa AAA. Different concentrations of 6-Benzylaminopurine (2.0, 4.0 and 6.0 mg l-1 and Thidiazuron (0.6, 0.8, 1.0 mg l-1 were studied to achieve the formation of these structures. As controls, 22.5 mg l-1 6-BAP and 2.0 mg l-1 TDZ, widely used for these purposes in this culture, were used. The treatment with 2.0 mg l-1 6-BAP + 1.0 mg l-1 TDZ was the one that achieved the highest percentage of adventitious buds formation, with 80% of the explants, with results much higher than those achieved by the controls and other combinations studied. With this treatment, an average of 2.72 adventitious buds per explant was obtained with the least number of shoots per explant (1.24 at 60 days of culture. For this reason, this combination of cytokinins was selected for the formation of adventitious buds in banana cv. 'Gros Michel', as it was possible to decrease the levels of 6-BAP and TDZ that have negative effects on the subsequent plants regeneration.   Keywords: bananas, 6- Benzylaminopurine, Thidiazuron

  20. Agrobacterium tumefaciens-mediated genetic transformation of embryogenesis cell suspensions of banana cultivar Grande naine (AAA

    Directory of Open Access Journals (Sweden)

    Idalmis Bermúdez-Caraballoso

    2004-01-01

    Full Text Available The black Sigatoka (Mycosphaerella fijiensis Morelet has become in the last years, the most destructive disease that affects the production of banana and plantains world-wide. The present work was made with the objective to obtain transgenic plants of banana cultivar Grand naine (AAA resistant to this disease with the use of genetic transformation. Embryogenenic cell suspensions obtained from somatic embryos formed from immature male flowers, were used for the transformation by Agrobacterium tumefaciens. The bacterial strain EHA-105 was used with the binary plasmids pHCA-58, pHCG-59 and pHGA-91, which contain different combinations of genes that encode for the antifungal chitinase, glucanase enzymes and the AP-24 osmotin. The commercial herbicide BASTA® was used as selective agent. One hundred ten putative transformed lines of the three constructions were obtained, after three selection months in the culture medium. The transgenic events were verified by means of Polymerase Chain Reaction analysis. Key words: AP-24, chitinase, glucanase, Musa, Mycosphaerella fijiensis

  1. The AAA+ ATPase TRIP13 remodels HORMA domains through N-terminal engagement and unfolding

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Qiaozhen; Kim, Dong Hyun; Dereli, Ihsan; Rosenberg, Scott C.; Hagemann, Goetz; Herzog, Franz; Tóth, Attila; Cleveland, Don W.; Corbett, Kevin D.

    2017-06-28

    Proteins of the conserved HORMA domain family, including the spindle assembly checkpoint protein MAD2 and the meiotic HORMADs, assemble into signaling complexes by binding short peptides termed “closure motifs”. The AAA+ ATPase TRIP13 regulates both MAD2 and meiotic HORMADs by disassembling these HORMA domain–closure motif complexes, but its mechanisms of substrate recognition and remodeling are unknown. Here, we combine X-ray crystallography and crosslinking mass spectrometry to outline how TRIP13 recognizes MAD2 with the help of the adapter protein p31comet. We show that p31comet binding to the TRIP13 N-terminal domain positions the disordered MAD2 N-terminus for engagement by the TRIP13 “pore loops”, which then unfold MAD2 in the presence of ATP. N-terminal truncation of MAD2 renders it refractory to TRIP13 action in vitro, and in cells causes spindle assembly checkpoint defects consistent with loss of TRIP13 function. Similar truncation of HORMAD1 in mouse spermatocytes compromises its TRIP13-mediated removal from meiotic chromosomes, highlighting a conserved mechanism for recognition and disassembly of HORMA domain–closure motif complexes by TRIP13.

  2. AAA-ATPase FIDGETIN-LIKE 1 and Helicase FANCM Antagonize Meiotic Crossovers by Distinct Mechanisms.

    Science.gov (United States)

    Girard, Chloe; Chelysheva, Liudmila; Choinard, Sandrine; Froger, Nicole; Macaisne, Nicolas; Lemhemdi, Afef; Lehmemdi, Afef; Mazel, Julien; Crismani, Wayne; Mercier, Raphael

    2015-07-01

    Meiotic crossovers (COs) generate genetic diversity and are critical for the correct completion of meiosis in most species. Their occurrence is tightly constrained but the mechanisms underlying this limitation remain poorly understood. Here we identified the conserved AAA-ATPase FIDGETIN-LIKE-1 (FIGL1) as a negative regulator of meiotic CO formation. We show that Arabidopsis FIGL1 limits CO formation genome-wide, that FIGL1 controls dynamics of the two conserved recombinases DMC1 and RAD51 and that FIGL1 hinders the interaction between homologous chromosomes, suggesting that FIGL1 counteracts DMC1/RAD51-mediated inter-homologue strand invasion to limit CO formation. Further, depleting both FIGL1 and the previously identified anti-CO helicase FANCM synergistically increases crossover frequency. Additionally, we showed that the effect of mutating FANCM on recombination is much lower in F1 hybrids contrasting from the phenotype of inbred lines, while figl1 mutation equally increases crossovers in both contexts. This shows that the modes of action of FIGL1 and FANCM are differently affected by genomic contexts. We propose that FIGL1 and FANCM represent two successive barriers to CO formation, one limiting strand invasion, the other disassembling D-loops to promote SDSA, which when both lifted, leads to a large increase of crossovers, without impairing meiotic progression.

  3. Expression and genomic analysis of midasin, a novel and highly conserved AAA protein distantly related to dynein

    Directory of Open Access Journals (Sweden)

    Gibbons I R

    2002-07-01

    Full Text Available Abstract Background The largest open reading frame in the Saccharomyces genome encodes midasin (MDN1p, YLR106p, an AAA ATPase of 560 kDa that is essential for cell viability. Orthologs of midasin have been identified in the genome projects for Drosophila, Arabidopsis, and Schizosaccharomyces pombe. Results Midasin is present as a single-copy gene encoding a well-conserved protein of ~600 kDa in all eukaryotes for which data are available. In humans, the gene maps to 6q15 and encodes a predicted protein of 5596 residues (632 kDa. Sequence alignments of midasin from humans, yeast, Giardia and Encephalitozoon indicate that its domain structure comprises an N-terminal domain (35 kDa, followed by an AAA domain containing six tandem AAA protomers (~30 kDa each, a linker domain (260 kDa, an acidic domain (~70 kDa containing 35–40% aspartate and glutamate, and a carboxy-terminal M-domain (30 kDa that possesses MIDAS sequence motifs and is homologous to the I-domain of integrins. Expression of hemagglutamin-tagged midasin in yeast demonstrates a polypeptide of the anticipated size that is localized principally in the nucleus. Conclusions The highly conserved structure of midasin in eukaryotes, taken in conjunction with its nuclear localization in yeast, suggests that midasin may function as a nuclear chaperone and be involved in the assembly/disassembly of macromolecular complexes in the nucleus. The AAA domain of midasin is evolutionarily related to that of dynein, but it appears to lack a microtubule-binding site.

  4. Spectroscopic and molecular docking study on the interaction between salicylic acid and the induced disease-resistant protein OsAAA1 of rice

    Science.gov (United States)

    Chen, Ya H.; Dai, Kang; Zhang, Hua; Wu, Yun H.; Wang, Chun T.; Liu, Xue Q.; Liu, Xin Q.

    2017-02-01

    The interaction between salicylic acid (SA) and the induced disease-resistant protein OsAAA1 in rice was studied using spectroscopy and molecular docking. Ultraviolet (UV) absorption spectroscopy demonstrated an interaction between OsAAA1 protein and SA. Spectroscopy showed that this interaction was a dynamic quenching process. Synchronous fluorescence spectroscopy (SFS) further revealed that this interaction caused changes in the microenvironment of tyrosine and tryptophan and that the interaction site was closer to the tryptophan residue. The structural model of protein OsAAA1 was determined by homology modeling method, and the molecular docking simulation diagram of OsAAA1 with SA was obtained. These models, in combination with a Ramachandran plot analysis, showed amino acid residues ranging from position 240 to position 420 as the possible site interacting with SA. Among them, Gly389, Lys257 and Glu425 might be three key amino acids that can form hydrogen bonds with SA.

  5. Materials Related Forensic Analysis and Special Testing : Drying Shrinkage Evaluation of Bridge Decks with Class AAA and Class W/WD Type K Cement

    Science.gov (United States)

    2001-07-01

    This work pertains to preparation of concrete drying shrinkage data for proposed concrete mixtures during normal concrete : trial batch verification. Selected concrete mixtures will include PennDOT Classes AAA and AA and will also include the use of ...

  6. EFECTO DE DOS TIPOS DE FUNDAS SOBRE EL FRUTO DE BANANO (Musa AAA

    Directory of Open Access Journals (Sweden)

    Alfonso Vargas-Calvo

    2011-01-01

    Full Text Available El objetivo de este estudio fue determinar el efecto de dos fundas en la protección del racimo de banano (Musa AAA . En dos épocas climáticas (adversa y favorable bajo condiciones del Ca ribe de Costa Ri ca se evaluaron dos fundas: 1- azul Sa nta Lucía (bifentrina 0,1%, polie tileno de 12,7 ¿ de grosor, con perforaciones de 4 mm y 86,4 cm de ancho y 2- transparente con aditivos para filtrar la luz ultravioleta e infrarroja (bifentrina 0,1%, 20,3 ¿ de grosor, con perforaciones de 4 mm y 88,9 cm de ancho. El peso del racimo así como el grosor y la longitud del fruto central de la fila externa en la segunda, cuarta y sexta mano no difirieron (P> 0,0556 entre ambas fundas. Tampoco hubo diferencias entre estas en la apa rie ncia del racimo (P>0,4699 ni en la firmeza de la cáscara en grado 1 de maduración (P= 0,6268. En las varia bles de medición del color del fruto solamente L* presentó un valor (56,48 más alto (P=0,0109 con la funda transparente fotosensible, mie ntras que las otras dos varia bles relacionadas (a* y b* no fueron diferentes (P>0,1011 entre las fundas. El incremento adicional de 7,6 ¿ en el grosor del polie tileno de la funda transparente con respecto a la azul Sa nta Lucía, no ocasionó un incremento productivo ni una mejor apa rie ncia del racimo de banano y sus frutos.

  7. Differential proteome analysis during early somatic embryogenesis in Musa spp. AAA cv. Grand Naine.

    Science.gov (United States)

    Kumaravel, Marimuthu; Uma, Subbaraya; Backiyarani, Suthanthiram; Saraswathi, Marimuthu Somasundaram; Vaganan, Muthu Mayil; Muthusamy, Muthusamy; Sajith, Kallu Purayil

    2017-01-01

    Endogenous hormone secretion proteins along with stress and defense proteins play predominant role in banana embryogenesis. This study reveals the underlying molecular mechanism during transition from vegetative to embryogenic state. Banana (Musa spp.) is well known globally as a food fruit crop for millions. The requirement of quality planting material of banana is enormous. Although mass multiplication through tissue culture is in vogue, high-throughput techniques like somatic embryogenesis (SE) as a mass multiplication tool needs to be improved. Apart from clonal propagation, SE has extensive applications in genetic improvement and mutation. SE in banana is completely genome-dependent and most of the commercial cultivars exhibit recalcitrance. Thus, understanding the molecular basis of embryogenesis in Musa will help to develop strategies for mass production of quality planting material. In this study, differentially expressed proteins between embryogenic calli (EC) and non-embryogenic calli (NEC) with respect to the explant, immature male flower buds (IMFB), of cv. Grand Naine (AAA) were determined using two-dimensional gel electrophoresis (2DE). The 2DE results were validated through qRT-PCR. In total, 65 proteins were identified: 42 were highly expressed and 23 were less expressed in EC compared to NEC and IMFB. qRT-PCR analysis of five candidate proteins, upregulated in EC, were well correlated with expression at transcript level. Further analysis of proteins showed that embryogenesis in banana is associated with the control of oxidative stress. The regulation of ROS scavenging system and protection of protein structure occurred in the presence of heat shock proteins. Alongside, high accumulation of stress-related cationic peroxidase and plant growth hormone-related proteins like indole-3-pyruvate monooxygenase and adenylate isopentenyltransferase in EC revealed the association with the induction of SE.

  8. Long-Term Outcome of the GORE EXCLUDER AAA Endoprosthesis for Treatment of Infrarenal Aortic Aneurysms.

    Science.gov (United States)

    Poublon, Claire G; Holewijn, Suzanne; van Sterkenburg, Steven M M; Tielliu, Ignace F J; Zeebregts, Clark J; Reijnen, Michel M P J

    2017-05-01

    To evaluate long-term outcome of GORE EXCLUDER AAA Endoprosthesis (W.L. Gore & Associates, Inc, Flagstaff, Arizona) for elective treatment of infrarenal aortic aneurysms and to evaluate performance of different generations of the device. A retrospective analysis was performed of 248 patients undergoing elective endovascular aneurysm repair with the GORE EXCLUDER between January 2000 and December 2015 in 2 hospitals. Primary endpoint was reintervention-free survival. Secondary endpoints were technical success, overall survival, rupture-free survival, endoleaks, sac diameter change (> 5 mm), limb occlusion, and migration (> 5 mm). Median follow-up time was 26 months (range, 1-190 months). Assisted primary technical success was 96.8%. Reintervention-free survival for 5 and 10 years was 85.2% and 75.6%, respectively. Independent risk factors for reintervention were technical success (P < .001), type I endoleak (P < .001), and type II endoleak (P = .003). Late adverse events requiring reintervention included rupture (0.4%), limb occlusion (0.4%), and stent migration (0.4%). Type Ia (4.8%), Ib (2.8%), II (35.9%), and V (6.5%) endoleaks were reported throughout follow-up. Sac growth was more prevalent with the original GORE EXCLUDER compared with the low permeability GORE EXCLUDER (P = .001) and in the presence of type I, II, and V endoleaks (P < .05). Three conversions (1.2%) were performed. Overall survival at 5 and 10 years was 68.4% and 49.0%, with no reported aneurysm-related deaths. Treatment with the GORE EXCLUDER is effective with acceptable reintervention rates in the long-term and few device-related adverse events or ruptures up to 10 years. Observed late adverse events and new-onset endoleaks emphasize the need for long-term surveillance. Copyright © 2017 SIR. Published by Elsevier Inc. All rights reserved.

  9. Design of experiments in medical physics: Application to the AAA beam model validation.

    Science.gov (United States)

    Dufreneix, S; Legrand, C; Di Bartolo, C; Bremaud, M; Mesgouez, J; Tiplica, T; Autret, D

    2017-09-01

    The purpose of this study is to evaluate the usefulness of the design of experiments in the analysis of multiparametric problems related to the quality assurance in radiotherapy. The main motivation is to use this statistical method to optimize the quality assurance processes in the validation of beam models. Considering the Varian Eclipse system, eight parameters with several levels were selected: energy, MLC, depth, X, Y1 and Y2 jaw dimensions, wedge and wedge jaw. A Taguchi table was used to define 72 validation tests. Measurements were conducted in water using a CC04 on a TrueBeam STx, a TrueBeam Tx, a Trilogy and a 2300IX accelerator matched by the vendor. Dose was computed using the AAA algorithm. The same raw data was used for all accelerators during the beam modelling. The mean difference between computed and measured doses was 0.1±0.5% for all beams and all accelerators with a maximum difference of 2.4% (under the 3% tolerance level). For all beams, the measured doses were within 0.6% for all accelerators. The energy was found to be an influencing parameter but the deviations observed were smaller than 1% and not considered clinically significant. Designs of experiment can help define the optimal measurement set to validate a beam model. The proposed method can be used to identify the prognostic factors of dose accuracy. The beam models were validated for the 4 accelerators which were found dosimetrically equivalent even though the accelerator characteristics differ. Copyright © 2017 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  10. A proteomic study of Corynebacterium glutamicum AAA+ protease FtsH

    Directory of Open Access Journals (Sweden)

    Schluesener Daniela

    2007-01-01

    Full Text Available Abstract Background The influence of the membrane-bound AAA+ protease FtsH on membrane and cytoplasmic proteins of Corynebacterium glutamicum was investigated in this study. For the analysis of the membrane fraction, anion exchange chromatography was combined with SDS-PAGE, while the cytoplasmic protein fraction was studied by conventional two-dimensional gel electrophoresis. Results In contrast to the situation in other bacteria, deletion of C. glutamicum ftsH has no significant effect on growth in standard minimal medium or response to heat or osmotic stress. On the proteome level, deletion of the ftsH gene resulted in a strong increase of ten cytoplasmic and membrane proteins, namely biotin carboxylase/biotin carboxyl carrier protein (accBC, glyceraldehyde-3-phosphate dehydrogenase (gap, homocysteine methyltransferase (metE, malate synthase (aceB, isocitrate lyase (aceA, a conserved hypothetical protein (NCgl1985, succinate dehydrogenase A (sdhA, succinate dehydrogenase B (sdhB, succinate dehydrogenase CD (sdhCD, and glutamate binding protein (gluB, while 38 cytoplasmic and membrane-associated proteins showed a decreased abundance. The decreasing amount of succinate dehydrogenase A (sdhA in the cytoplasmic fraction of the ftsH mutant compared to the wild type and its increasing abundance in the membrane fraction indicates that FtsH might be involved in the cleavage of a membrane anchor of this membrane-associated protein and by this changes its localization. Conclusion The data obtained hint to an involvement of C. glutamicum FtsH protease mainly in regulation of energy and carbon metabolism, while the protease is not involved in stress response, as found in other bacteria.

  11. The Rice AAA-ATPase OsFIGNL1 Is Essential for Male Meiosis

    Directory of Open Access Journals (Sweden)

    Peipei Zhang

    2017-09-01

    Full Text Available Meiosis is crucial in reproduction of plants and ensuring genetic diversity. Although several genes involved in homologous recombination and DNA repair have been reported, their functions in rice (Oryza sativa male meiosis remain poorly understood. Here, we isolated and characterized the rice OsFIGNL1 (OsFidgetin-like 1 gene, encoding a conserved AAA-ATPase, and explored its function and importance in male meiosis and pollen formation. The rice Osfignl1 mutant exhibited normal vegetative growth, but failed to produce seeds and displayed pollen abortion phenotype. Phenotypic comparisons between the wild-type and Osfignl1 mutant demonstrated that OsFIGNL1 is required for anther development, and that the recessive mutation of this gene causes male sterility in rice. Complementation and CRISPR/Cas9 experiments demonstrated that wild-type OsFIGNL1 is responsible for the male sterility phenotype. Subcellular localization showed that OsFIGNL1-green fluorescent protein was exclusively localized in the nucleus of rice protoplasts. Male meiosis in the Osfignl1 mutant exhibited abnormal chromosome behavior, including chromosome bridges and multivalent chromosomes at diakinesis, lagging chromosomes, and chromosome fragments during meiosis. Yeast two-hybrid assays demonstrated OsFIGNL1 could interact with RAD51A1, RAD51A2, DMC1A, DMC1B, and these physical interactions were further confirmed by BiFC assay. Taken together, our results suggest that OsFIGNL1 plays an important role in regulation of male meiosis and anther development.

  12. Developmental localization and methylesterification of pectin epitopes during somatic embryogenesis of banana (Musa spp. AAA).

    Science.gov (United States)

    Xu, Chunxiang; Zhao, Lu; Pan, Xiao; Samaj, Jozef

    2011-01-01

    The plant cell walls play an important role in somatic embryogenesis and plant development. Pectins are major chemical components of primary cell walls while homogalacturonan (HG) is the most abundant pectin polysaccharide. Developmental regulation of HG methyl-esterification degree is important for cell adhesion, division and expansion, and in general for proper organ and plant development. Developmental localization of pectic homogalacturonan (HG) epitopes and the (1→4)-β-D-galactan epitope of rhamnogalacturonan I (RG-I) and degree of pectin methyl-esterification (DM) were studied during somatic embryogenesis of banana (Musa spp. AAA). Histological analysis documented all major developmental stages including embryogenic cells (ECs), pre-globular, globular, pear-shaped and cotyledonary somatic embryos. Histochemical staining of extracellularly secreted pectins with ruthenium red showed the most intense staining at the surface of pre-globular, globular and pear-shaped somatic embryos. Biochemical analysis revealed developmental regulation of galacturonic acid content and DM in diverse embryogenic stages. Immunodots and immunolabeling on tissue sections revealed developmental regulation of highly methyl-esterified HG epitopes recognized by JIM7 and LM20 antibodies during somatic embryogenesis. Cell walls of pre-globular/globular and late-stage embryos contained both low methyl-esterified HG epitopes as well as partially and highly methyl-esterified ones. Extracellular matrix which covered surface of early developing embryos contained pectin epitopes recognized by 2F4, LM18, JIM5, JIM7 and LM5 antibodies. De-esterification of cell wall pectins by NaOH caused a decrease or an elimination of immunolabeling in the case of highly methyl-esterified HG epitopes. However, immunolabeling of some low methyl-esterified epitopes appeared stronger after this base treatment. These data suggest that both low- and highly-methyl-esterified HG epitopes are developmentally

  13. Developmental localization and methylesterification of pectin epitopes during somatic embryogenesis of banana (Musa spp. AAA.

    Directory of Open Access Journals (Sweden)

    Chunxiang Xu

    Full Text Available The plant cell walls play an important role in somatic embryogenesis and plant development. Pectins are major chemical components of primary cell walls while homogalacturonan (HG is the most abundant pectin polysaccharide. Developmental regulation of HG methyl-esterification degree is important for cell adhesion, division and expansion, and in general for proper organ and plant development.Developmental localization of pectic homogalacturonan (HG epitopes and the (1→4-β-D-galactan epitope of rhamnogalacturonan I (RG-I and degree of pectin methyl-esterification (DM were studied during somatic embryogenesis of banana (Musa spp. AAA. Histological analysis documented all major developmental stages including embryogenic cells (ECs, pre-globular, globular, pear-shaped and cotyledonary somatic embryos. Histochemical staining of extracellularly secreted pectins with ruthenium red showed the most intense staining at the surface of pre-globular, globular and pear-shaped somatic embryos. Biochemical analysis revealed developmental regulation of galacturonic acid content and DM in diverse embryogenic stages. Immunodots and immunolabeling on tissue sections revealed developmental regulation of highly methyl-esterified HG epitopes recognized by JIM7 and LM20 antibodies during somatic embryogenesis. Cell walls of pre-globular/globular and late-stage embryos contained both low methyl-esterified HG epitopes as well as partially and highly methyl-esterified ones. Extracellular matrix which covered surface of early developing embryos contained pectin epitopes recognized by 2F4, LM18, JIM5, JIM7 and LM5 antibodies. De-esterification of cell wall pectins by NaOH caused a decrease or an elimination of immunolabeling in the case of highly methyl-esterified HG epitopes. However, immunolabeling of some low methyl-esterified epitopes appeared stronger after this base treatment.These data suggest that both low- and highly-methyl-esterified HG epitopes are

  14. The INNOVATION Trial: four-year safety and effectiveness of the INCRAFT® AAA Stent-Graft System for endovascular repair.

    Science.gov (United States)

    Pratesi, Giovanni; Pratesi, Carlo; Chiesa, Roberto; Coppi, Gioacchino; Scheinert, Dierk; Brunkwall, Jan S; van der Meulen, Stefaan; Torsello, Giovanni

    2017-10-01

    This paper reports the 4-year safety and effectiveness of the INCRAFT® AAA Stent-Graft System (Cordis Corp., Milpitas, CA, USA), an ultra-low-profile device for the treatment of abdominal aortic aneurysms. The INNOVATION Trial is the prospective, first-in-human, multicenter trial to evaluate the safety and effectiveness of the INCRAFT® System. Patients underwent annual clinical and computed tomography angiography examination as part of the study protocol. The INCRAFT® AAA Stent-Graft System is a customizable tri-modular design, with an ultra-low profile (14-Fr) delivery system. Patient were treated under approved protocol, the prescribed clinical and imaging follow-up at annually through 5 years. Results analyzed and adjudicated by a clinical events committee, independent core laboratory, and a data safety and monitoring board. This manuscript reports results through 4 years of follow-up. A total of 60 patients were enrolled in the trial, all of whom were successfully treated. Follow-up rates at 1 and 4 years were 93% (56/60) and 85% (51/60), respectively. All-cause mortality at 4 years was 17.6% and no death was AAA-, device-, or procedure-related. The secondary reintervention rate at 1 year was 4.6%, primarily the result of stent thrombosis. In total, 10 patients required 13 post-procedure interventions within 4-years of follow-up (2 to repair a type I endoleak, 4 to repair a type II endoleak, 1 for stent thrombosis, 1 for renal stenosis, 1 for aneurysm enlargement, 2 for limb migration and 2 for prosthesis stenosis or occlusion). There were 4 cases (10%) of aneurysm enlargement reported at the 4 year follow-up. At 4 years, 38 out of 39 patients were free from type I and III endoleaks. There were no proximal type I or type III endoleaks at 4-year follow-up. Core laboratory evaluation of the postoperative imaging studies indicated absence of endograft migration while a single fracture was demonstrated without any clinical sequelae. The INCRAFT® AAA Stent

  15. Pareto front analysis of 6 and 15 MV dynamic IMRT for lung cancer using pencil beam, AAA and Monte Carlo

    DEFF Research Database (Denmark)

    Ottosson, R O; Hauer, Anna Karlsson; Behrens, C.F.

    2010-01-01

    to normal tissue sparing weighted. All optimized treatment plans were calculated using three different calculation algorithms (PBC, AAA and MC). In order to study the influence of motion, two virtual lung phantoms were created. The idea was to mimic two different situations: one where the GTV is located...... with MC, but even a small overestimation of the dose level by the algorithm might lead to a large part of the PTV being underdosed. It is advisable to use low energy as a default for tumor sites involving lungs. However, there might be situations where it is favorable to use high energy. In order...

  16. Avaliação da eficácia da descontaminação de resíduos biológicos do subgrupo A1 por tratamento térmico em autoclave a vapor: um estudo de caso.

    OpenAIRE

    Galvão,Maria Aparecida

    2012-01-01

    O tratamento térmico dos resíduos infectantes do subgrupo A1 é indispensável para garantir uma disposição final ambientalmente correta e segura para os funcionários que os manipulam, tendo em vista que, alguns micro-organismos patogênicos podem permanecer viáveis, inclusive no solo, por períodos de até 180 dias. Este trabalho objetivou verificar a eficácia da descontaminação dos resíduos infectantes gerados em laboratórios de microbiologia que realiza diagnóstico e monitoramento das doenças d...

  17. HTTP as a Data Access Protocol: Trials with XrootD in CMS’s AAA Project

    Science.gov (United States)

    Balcas, J.; Bockelman, B. P.; Kcira, D.; Newman, H.; Vlimant, J.; Hendricks, T. W.; CMS Collaboration

    2017-10-01

    The main goal of the project to demonstrate the ability of using HTTP data federations in a manner analogous to the existing AAA infrastructure of the CMS experiment. An initial testbed at Caltech has been built and changes in the CMS software (CMSSW) are being implemented in order to improve HTTP support. The testbed consists of a set of machines at the Caltech Tier2 that improve the support infrastructure for data federations at CMS. As a first step, we are building systems that produce and ingest network data transfers up to 80 Gbps. In collaboration with AAA, HTTP support is enabled at the US redirector and the Caltech testbed. A plugin for CMSSW is being developed for HTTP access based on the DaviX software. It will replace the present fork/exec or curl for HTTP access. In addition, extensions to the XRootD HTTP implementation are being developed to add functionality to it, such as client-based monitoring identifiers. In the future, patches will be developed to better integrate HTTP-over-XRootD with the Open Science Grid (OSG) distribution. First results of the transfer tests using HTTP are presented in this paper together with details about the initial setup.

  18. The AAA+ proteins Pontin and Reptin enter adult age: from understanding their basic biology to the identification of selective inhibitors.

    Science.gov (United States)

    Matias, Pedro M; Baek, Sung Hee; Bandeiras, Tiago M; Dutta, Anindya; Houry, Walid A; Llorca, Oscar; Rosenbaum, Jean

    2015-01-01

    Pontin and Reptin are related partner proteins belonging to the AAA+ (ATPases Associated with various cellular Activities) family. They are implicated in multiple and seemingly unrelated processes encompassing the regulation of gene transcription, the remodeling of chromatin, DNA damage sensing and repair, and the assembly of protein and ribonucleoprotein complexes, among others. The 2nd International Workshop on Pontin and Reptin took place at the Instituto de Tecnologia Química e Biológica António Xavier in Oeiras, Portugal on October 10-12, 2014, and reported significant new advances on the mechanisms of action of these two AAA+ ATPases. The major points under discussion were related to the mechanisms through which these proteins regulate gene transcription, their roles as co-chaperones, and their involvement in pathophysiology, especially in cancer and ciliary biology and disease. Finally, they may become anticancer drug targets since small chemical inhibitors were shown to produce anti-tumor effects in animal models.

  19. Freqüência de relatos de parafunções nos subgrupos diagnósticos de DTM de acordo com os critérios diagnósticos para pesquisa em disfunções temporomandibulares (RDC/TMD Frequency of relates of parafunctions in the diagnostic subgroups of TMD according to research diagnostic criteria for temporomandibular disorders (RDC/TMD

    Directory of Open Access Journals (Sweden)

    Raquel Stumpf Branco

    2008-04-01

    Full Text Available INTRODUÇÃO: as disfunções temporomandibulares (DTM podem ser definidas como um conjunto de condições dolorosas e/ou disfuncionais, que envolvem os músculos da mastigação e/ou as articulações temporomandibulares (ATM. Um dos meios usados para o diagnóstico é o "Critério Diagnóstico para Pesquisa em Disfunções Temporomandibulares" (RDC/TMD. Hábitos parafuncionais são aqueles não relacionados à execução das funções normais do sistema estomatognático. O bruxismo é caracterizado por atividade parafuncional noturna involuntária dos músculos mastigatórios, enquanto o apertamento dentário é considerado uma parafunção diurna envolvendo esta musculatura, embora possa ocorrer também à noite. OBJETIVOS: o objetivo do presente estudo foi avaliar a freqüência do relato de parafunções orais diurna e/ou noturna em pacientes com DTM nos diferentes subgrupos diagnósticos do RDC/TMD. METODOLOGIA: foram utilizados dados provenientes de 217 pacientes que procuraram tratamento na Clínica de DTM e Dor Orofacial da Faculdade de Medicina de Petrópolis, sendo avaliados através do questionário e exame físico que compõem o RDC/TMD. RESULTADOS: dos 182 pacientes com DTM estudados, 76,9% relataram algum tipo de parafunção, podendo ser diurna, noturna ou a associação de ambas. A parafunção diurna foi a mais freqüentemente relatada entre os subgrupos de DTM, sendo encontrada em 64,8% dos casos contra 55,5% dos casos com relato de bruxismo. O relato de ambas as parafunções foi constatado em 43,4% dos pacientes com DTM. CONCLUSÕES: considerando cada subgrupo diagnóstico, os relatos de parafunções diurna e noturna foram mais freqüentes nos pacientes com dor miofascial.INTRODUCTION: temporomandibular disorders (TMD can be defined as a group of painful and/or dysfunctional conditions that involve masticatory muscles and/or the temporomandibular joints (TMJ. One of the methods used to the diagnostic is the "Research

  20. Architecture and characterization of a thermostable MoxR family AAA(+) ATPase from Thermococcus kodakarensis KOD1.

    Science.gov (United States)

    Pham, Bang Phuong; Lee, Sangmin; Jia, Baolei; Kwak, Jae Myeong; Cheong, Gang-Won

    2014-05-01

    AAA(+) ATPases are ubiquitous enzymes that can function as molecular chaperones, employing the energy obtained from ATP hydrolysis to remodel macromolecules. In this report, the MoxR enzyme from Thermococcus kodakarensis KOD1 (TkMoxR) was shown to have two native forms: a two-stack hexameric ring and a hexameric structure, under physiological conditions and cold stress, respectively. TkMoxR was altered to a microtubule-like form in the presence of ATP and tightly interacted with dsDNA molecules of various lengths. In addition, the two-stack hexameric protein catalyzed dsDNA decomposition to form and then release ssDNA, whereas the hexamer TkMoxR structure interacted with but did not release dsDNA. These results suggest that TkMoxR has DNA helicase activity involved in gene expression control.

  1. Interaction studies of resistomycin from Streptomyces aurantiacus AAA5 with calf thymus DNA and bovine serum albumin

    Science.gov (United States)

    Vijayabharathi, R.; Sathyadevi, P.; Krishnamoorthy, P.; Senthilraja, D.; Brunthadevi, P.; Sathyabama, S.; Priyadarisini, V. Brindha

    2012-04-01

    Resistomycin, a secondary metabolite produced by Streptomyces aurantiacus AAA5. The binding interaction of resistomycin with calf thymus DNA (CT DNA) and bovine serum albumin (BSA) was investigated by spectrophotometry, spectrofluorimetry, circular dichroism (CD) and synchronous fluorescence techniques under physiological conditions in vitro. Absorption spectral studies along with the fluorescence competition with ethidium bromide measurements and circular dichroism clearly suggest that the resistomycin bind with CT DNA relatively strong via groove binding. BSA interaction results revealed that the drug was found to quench the fluorescence intensity of the protein through a static quenching mechanism. The number of binding sites 'n' and apparent binding constant 'K' calculated according to the Scatchard equation exhibit a good binding property to bovine serum albumin protein. In addition, the results observed from synchronous fluorescence measurements clearly demonstrate the occurrence of conformational changes of BSA upon addition of the test compound.

  2. In vitro propagation and assessment of the genetic fidelity of Musa acuminata (AAA) cv. Vaibalhla derived from immature male flowers.

    Science.gov (United States)

    Hrahsel, Lalremsiami; Basu, Adreeja; Sahoo, Lingaraj; Thangjam, Robert

    2014-02-01

    An efficient in vitro propagation method has been developed for the first time for Musa acuminata (AAA) cv. Vaibalhla, an economically important banana cultivar of Mizoram, India. Immature male flowers were used as explants. Murashige and Skoog's (MS) medium supplemented with plant growth regulators (PGRs) were used for the regeneration process. Out of different PGR combinations, MS medium supplemented with 2 mg L(-1) 6-benzylaminopurine (BAP) + 0.5 mg L(-1) α-naphthalene acetic acid (NAA) was optimal for production of white bud-like structures (WBLS). On this medium, explants produced the highest number of buds per explant (4.30). The highest percentage (77.77) and number (3.51) of shoot formation from each explants was observed in MS medium supplemented with 2 mg L(-1) kinetin + 0.5 mg L(-1) NAA. While MS medium supplemented with a combination of 2 mg L(-1) BAP + 0.5 mg L(-1) NAA showed the maximum shoot length (14.44 cm). Rooting efficiency of the shoots was highest in the MS basal medium without any PGRs. The plantlets were hardened successfully in the greenhouse with 96% survival rate. Random amplified polymorphic DNA (RAPD) and inter-simple sequence repeat (ISSR) markers were employed to assess the genetic stability of in vitro regenerated plantlets of M. acuminata (AAA) cv. Vaibalhla. Eight RAPD and 8 ISSR primers were successfully used for the analysis from the 40 RAPD and 30 ISSR primers screened initially. The amplified products were monomorphic across all the regenerated plants and were similar to the mother plant. The present standardised protocol will find application in mass production, conservation and genetic transformation studies of this commercially important banana.

  3. AAA-ATPase NVL2 acts on MTR4-exosome complex to dissociate the nucleolar protein WDR74

    Energy Technology Data Exchange (ETDEWEB)

    Hiraishi, Nobuhiro; Ishida, Yo-ichi; Nagahama, Masami, E-mail: nagahama@my-pharm.ac.jp

    2015-11-20

    Nuclear VCP-like 2 (NVL2) is a chaperone-like nucleolar ATPase of the AAA (ATPase associated with diverse cellular activities) family, which exhibits a high level of amino acid sequence similarity with the cytosolic AAA-ATPase VCP/p97. These proteins generally act on macromolecular complexes to stimulate energy-dependent release of their constituents. We previously showed that NVL2 interacts with RNA processing/degradation machinery containing an RNA helicase MTR4/DOB1 and an exonuclease complex, nuclear exosome, and involved in the biogenesis of 60S ribosomal subunits. These observations implicate NVL2 as a remodeling factor for the MTR4-exosome complex during the maturation of pre-ribosomal particles. Here, we used a proteomic screen and identified a WD repeat-containing protein 74 (WDR74) as a factor that specifically dissociates from this complex depending on the ATPase activity of NVL2. WDR74 shows weak amino acid sequence similarity with the yeast ribosome biogenesis protein Nsa1 and is co-localized with NVL2 in the nucleolus. Knockdown of WDR74 decreases 60S ribosome levels. Taken together, our results suggest that WDR74 is a novel regulatory protein of the MTR4-exsosome complex whose interaction is regulated by NVL2 and is involved in ribosome biogenesis. - Highlights: • WDR74 accumulates in MTR4-exosome complex upon expression of dominant-negative NVL2. • WDR74 is co-localized with NVL2 in the nucleolus. • WDR74, along with NVL2, is involved in the synthesis of 60S ribosomal subunits.

  4. Genome-wide identification and characterization of the superoxide dismutase gene family in Musa acuminata cv. Tianbaojiao (AAA group).

    Science.gov (United States)

    Feng, Xin; Lai, Zhongxiong; Lin, Yuling; Lai, Gongti; Lian, Conglong

    2015-10-20

    Superoxide dismutase (SOD) is an essential enzyme of the plant antioxidant system that responds to oxidative stresses caused by adverse conditions. Banana is an important staple and economic crop in tropical and subtropical regions. However, its growth and yield are constantly affected by various abiotic stresses. To analyze the roles of distinct SOD genes under various stresses, a detailed characterization and analysis of the SOD gene family in Cavendish banana is indispensable. The presence and structure of the SOD family genes were experimentally verified using 5'/3' RACE-PCR, reverse transcription PCR and PCR. Then, their syntenic relationships, conserved motifs and phylogenetic relationships were analyzed using software. Cis-elements present in the promoters were predicted via PlantCARE. And the expression levels under abiotic and hormonal stresses were determined using real-time quantitative polymerase chain reaction. In total, 25 'Tianbaojiao' SOD cDNAs (MaSODs), which encoded six Cu/ZnSODs, four MnSODs and two FeSODs, were cloned. The 12 MaSOD genes were divided into four groups based on their conserved motifs, which corroborated their classifications based on gene-structure patterns and subcellular localizations. Eleven MaSOD promoters were isolated and found to contain many cis-acting elements involved in stress responses. Gene expression analysis showed that 11 out of the 12 MaSODs were expressed in all tested tissues (leaf, pseudostem and root), whereas MaCSD2B was expressed only in leaves and roots. Specific MaSOD members exhibited different expression patterns under abiotic and hormonal treatments. Among the 12 MaSOD genes, MaCSD1D was the only one that responded to all eight treatments, suggesting that this gene plays a predominant role in reactive oxygen species scavenging caused by various stresses in banana. A genome-wide analysis showed that the 'Tianbaojiao' banana harbored an expanded SOD gene family. Whole genome duplication, segmental

  5. Increased galectin-3 levels are associated with abdominal aortic aneurysm progression and inhibition of galectin-3 decrease elastase-induced AAA development

    DEFF Research Database (Denmark)

    Fernandez-García, Carlos-Ernesto; Tarin, Carlos; Roldan-Montero, Raquel

    2017-01-01

    in mice was induced by aortic elastase perfusion. Mice were treated i.v. with the galectin-3 inhibitor modified citrus pectin (MCP, 10mg/kg, every other day) or saline. Similar to humans, galectin-3 serum and aortic mRNA levels were also increased in elastase-induced AAA mice compared to control mice...

  6. SU-E-T-529: Dosimetric Evaluation with Heterogeneity in Acuros XB Advanced Dose Calculation Algorithm and Anisotropic Analytical Algorithm (AAA).

    Science.gov (United States)

    Rana, S; Rogers, K

    2012-06-01

    To evaluate accuracy of Acuros XB Advanced Dose Calculation Algorithm and Anisotropic Analytical Algorithm (AAA) with measurements in predicting doses beyond air gaps. Three virtual phantoms with layers were created in Eclipse Treatment Planning System. Each layer in phantoms was assigned in terms of water (top), air (middle) and water (bottom) medium. Central axis depth dose in water (bottom medium) beyond 2, 4 and 6 cm air gaps were computed for 5 cm water equivalent material positioned before air gaps. Dose computation was performed for 6MV photon beam with 3×3 and 5×5 cm(2) field sizes at 100 cm SSD to surface of phantoms using AAA_10.0.28 and Acuros XB_10.0.28. Next, solid water and Styrofoam were manufactured to mimic virtual phantoms. By keeping identical field, beam parameters, and geometries that were used for dose computation, 100 MUs were delivered to phantoms, and measurements at selected depths were acquired with cylindrical ionization chamber. Measured central axis depth doses were compared against calculated central axis depth doses computed from Acuros XB and AAA. Acuros XB predicted doses within ±2% of measured doses except at 1cm depth in phantoms with 4 cm air gap (-2.4%) and 6 cm air gap (-2.8%) for field size 3×3cm(2) . Acuros XB showed better dose prediction compared to AAA at all measured depths. Smallest test field size in phantom with largest air gap produced highest range (between depths 1 and 5 cm) in percentage dose difference (AAA: -2.9% to -9.9% and Acuros XB: -2.8% to 1.5%). Improper modeling of primary beam attenuation or lateral scatter (or combination of both) within air gap may have resulted into dose discrepancies. The findings suggest Acuros XB is more accurate to use in dose predictions when tumor is located beyond small air cavity (heterogeneity) within the patient. © 2012 American Association of Physicists in Medicine.

  7. Children with ANSD fitted with hearing aids applying the AAA Pediatric Amplification Guideline: Current Practice and Outcomes

    Science.gov (United States)

    Walker, Elizabeth A.; McCreery, Ryan W.; Spratford, Meredith; Roush, Patricia A.

    2015-01-01

    Background Up to 15% of children with permanent hearing loss have auditory neuropathy spectrum disorder (ANSD), which involves normal outer hair cell function and disordered afferent neural activity in the auditory nerve or brainstem. Given the varying presentations of ANSD in children, there is a need for more evidence-based research on appropriate clinical interventions for this population. Purpose This study compared the speech production, speech perception, and language outcomes of children with auditory neuropathy spectrum disorder (ANSD) who are hard of hearing and children with similar degrees of mild to moderately-severe sensorineural hearing loss (SNHL), all of whom were fitted with bilateral hearing aids based on the American Academy of Audiology (AAA) pediatric amplification guidelines. Research design Speech perception and communication outcomes data were gathered in a prospective accelerated longitudinal design, with entry into the study between six months and seven years of age. Three sites were involved in participant recruitment: Boys Town National Research Hospital, the University of North Carolina at Chapel Hill, and the University of Iowa. Study sample: The sample consisted of 12 children with ANSD and 22 children with SNHL. The groups were matched based on better-ear pure-tone average, better-ear aided speech intelligibility index, gender, maternal education level, and newborn hearing screening result (i.e., pass or refer). Data collection and analysis Children and their families participated in an initial baseline visit, followed by visits twice a year for children under age 2 years and once a year for children older than 2 years. Paired-sample t-tests were used to compare children with ANSD to children with SNHL. Results Paired t-tests indicated no significant differences between the ANSD and SNHL groups on language and articulation measures. Children with ANSD displayed functional speech perception skills in quiet. Although the number of

  8. SU-F-T-600: Influence of Acuros XB and AAA Dose Calculation Algorithms On Plan Quality Metrics and Normal Lung Doses in Lung SBRT

    Energy Technology Data Exchange (ETDEWEB)

    Yaparpalvi, R; Mynampati, D; Kuo, H; Garg, M; Tome, W; Kalnicki, S [Montefiore Medical Center, Bronx, NY (United States)

    2016-06-15

    Purpose: To study the influence of superposition-beam model (AAA) and determinant-photon transport-solver (Acuros XB) dose calculation algorithms on the treatment plan quality metrics and on normal lung dose in Lung SBRT. Methods: Treatment plans of 10 Lung SBRT patients were randomly selected. Patients were prescribed to a total dose of 50-54Gy in 3–5 fractions (10?5 or 18?3). Doses were optimized accomplished with 6-MV using 2-arcs (VMAT). Doses were calculated using AAA algorithm with heterogeneity correction. For each plan, plan quality metrics in the categories- coverage, homogeneity, conformity and gradient were quantified. Repeat dosimetry for these AAA treatment plans was performed using AXB algorithm with heterogeneity correction for same beam and MU parameters. Plan quality metrics were again evaluated and compared with AAA plan metrics. For normal lung dose, V{sub 20} and V{sub 5} to (Total lung- GTV) were evaluated. Results: The results are summarized in Supplemental Table 1. PTV volume was mean 11.4 (±3.3) cm{sup 3}. Comparing RTOG 0813 protocol criteria for conformality, AXB plans yielded on average, similar PITV ratio (individual PITV ratio differences varied from −9 to +15%), reduced target coverage (−1.6%) and increased R50% (+2.6%). Comparing normal lung doses, the lung V{sub 20} (+3.1%) and V{sub 5} (+1.5%) were slightly higher for AXB plans compared to AAA plans. High-dose spillage ((V105%PD - PTV)/ PTV) was slightly lower for AXB plans but the % low dose spillage (D2cm) was similar between the two calculation algorithms. Conclusion: AAA algorithm overestimates lung target dose. Routinely adapting to AXB for dose calculations in Lung SBRT planning may improve dose calculation accuracy, as AXB based calculations have been shown to be closer to Monte Carlo based dose predictions in accuracy and with relatively faster computational time. For clinical practice, revisiting dose-fractionation in Lung SBRT to correct for dose overestimates

  9. SU-E-T-490: Comparison of XVMC Monte Carlo Dose Calculations with Eclipse AAA Calculations for RapidArc Plans.

    Science.gov (United States)

    Stelljes, T; Alber, M; Poppe, B; Laub, W

    2012-06-01

    The consistency between the AAA and XVMC algorithm in the treatment planning for RapidArc is investigated. While the majority of the radiation field is blocked by the MLC system, multiple small dose islands with MLC opened only slightly can be observed in one control point. This raises questions on how accurate the clinically used AAA algorithm in Eclipse is able to calculate RapidArc dose distributions. The fast Monte Carlo Code XVMC was used as a benchmark to test the AAA algorithm. RadpidArc plans of 25 patients were calculated with AAA and XVMC. The patient cohort consisted of 4 different cancer sites (H&N, upper abdominal, lung, prostate). Dose distributions, PTV and OAR coverage were compared looking at the PTV mean dose Dmean, the volume V95% of the PTV receiving 95% of the prescribed dose, the dose D95% delivered to 95% of the PTV Volume, the percentage PTV mean dose with respect to the prescribed dose Dmean/prescr and OAR mean dose. The recalculation of RapidArc plans yielded good agreement of both calculation algorithms for treatment plans of all four cancer sites. PTV mean dose differences of AAA and XVMC were found to be in between -0.11% and 4.89% of the prescribed dose. The mean dose difference found was 0.48±0.77 Gy. Local dose differences were found when comparing dose distributions in regions of big mass density differences and in high dose regions. One head and neck plan and one prostate plan revealed significant differences in PTV coverage (ΔDmean=3.25 Gy) and OAR mean dose (prostate mean dose -13.71 Gy) respectively. The vast majority of treatment plans calculated with the AAA algorithm were found to agree within the expected and acceptable tolerances compared to XVMC results. Nevertheless in some cases dose differences were observed that could be of clinical significance. This work was funded by a Varian grant. Wolfram Laub is working in the physics group of CMS. © 2012 American Association of Physicists in Medicine.

  10. In-situ monitoring of blood glucose level for dialysis machine by AAA-battery-size ATR Fourier spectroscopy

    Science.gov (United States)

    Hosono, Satsuki; Sato, Shun; Ishida, Akane; Suzuki, Yo; Inohara, Daichi; Nogo, Kosuke; Abeygunawardhana, Pradeep K.; Suzuki, Satoru; Nishiyama, Akira; Wada, Kenji; Ishimaru, Ichiro

    2015-07-01

    For blood glucose level measurement of dialysis machines, we proposed AAA-battery-size ATR (Attenuated total reflection) Fourier spectroscopy in middle infrared light region. The proposed one-shot Fourier spectroscopic imaging is a near-common path and spatial phase-shift interferometer with high time resolution. Because numerous number of spectral data that is 60 (= camera frame rare e.g. 60[Hz]) multiplied by pixel number could be obtained in 1[sec.], statistical-averaging improvement realize high-accurate spectral measurement. We evaluated the quantitative accuracy of our proposed method for measuring glucose concentration in near-infrared light region with liquid cells. We confirmed that absorbance at 1600[nm] had high correlations with glucose concentrations (correlation coefficient: 0.92). But to measure whole-blood, complex light phenomenon caused from red blood cells, that is scattering and multiple reflection or so, deteriorate spectral data. Thus, we also proposed the ultrasound-assisted spectroscopic imaging that traps particles at standing-wave node. Thus, if ATR prism is oscillated mechanically, anti-node area is generated around evanescent light field on prism surface. By elimination complex light phenomenon of red blood cells, glucose concentration in whole-blood will be quantify with high accuracy. In this report, we successfully trapped red blood cells in normal saline solution with ultrasonic standing wave (frequency: 2[MHz]).

  11. Ultrastructural changes and the distribution of arabinogalactan proteins during somatic embryogenesis of banana (Musa spp. AAA cv. 'Yueyoukang 1').

    Science.gov (United States)

    Pan, Xiao; Yang, Xiao; Lin, Guimei; Zou, Ru; Chen, Houbin; Samaj, Jozef; Xu, Chunxiang

    2011-08-01

    A better understanding of somatic embryogenesis in banana (Musa spp.) may provide a practical way to improve regeneration of banana plants. In this study, we applied scanning electron microscopy (SEM) and transmission electron microscopy (TEM) to visualize the ultrastructural changes during somatic embryogenesis of banana (Musa AAA cv. 'Yueyoukang 1'). We also used histological and immunohistochemical techniques with 16 monoclonal antibodies to study the spatial distribution and cellular/subcellular localization of different arabinogalactan protein (AGP) components of the cell wall during somatic embryogenesis. Histological study with periodic acid-Schiff staining documented diverse embryogenic stages from embryogenic cells (ECs) to the late embryos. SEM revealed a mesh-like structure on the surface of proembryos which represented an early structural marker of somatic embryogenesis. TEM showed that ECs were rich in juvenile mitochondria, endoplasmic reticulum and Golgi stacks. Cells in proembryos and early globular embryos resembled ECs, but they were more vacuolated, showed more regular nuclei and slightly more developed organelles. Immunocytochemical study revealed that the signal of most AGP epitopes was stronger in starch-rich cells when compared with typical ECs. The main AGP component in the extracellular matrix surface network of banana proembryos was the MAC204 epitope. Later, AGP immunolabelling patterns varied with the developmental stages of the embryos. These results about developmental regulation of AGP epitopes along with developmental changes in the ultrastructure of cells are providing new insights into the somatic embryogenesis of banana. Copyright © Physiologia Plantarum 2011.

  12. Spatial distribution of nematodes in three banana ( Musa AAA) root parts considering two root thickness in three farm management systems

    Science.gov (United States)

    Araya, M.; De Waele, D.

    2004-10-01

    The spatial location of the banana ( Musa AAA) root parasitic nematodes within three root parts considering two root thickness was determined in three commercial farm management systems, which differ in weed and nematode management. Roots in each farm management system were classified in thick (>5 mm-d) and thin (1 ≤ 5 mm-d) roots. From each root type, the epidermis, the cortical parenchyma (CP) and the vascular cylinder (VC) were separated by fingernail, and nematodes were extracted by maceration of each root part. Independent of the farm management system, and for either root thickness, highest numbers of Radopholus similis per gram of root was found in the CP, followed by the epidermis and VC. The highest number of Helicotylencus spp., Pratylenchus spp. and the total nematode population per gram of root was found in the epidermis. Considering the number of nematodes per root part, the highest number of R. similis and total nematodes was located in the CP, while Helicotylenchus spp. and Pratylenchus spp. were concentrated in the epidermis. These patterns were approximately reproduced in the two root thickness and in the three farm management systems. This behavior suggests that injection of systemic nematicides into the plant pseudostem to replace the granular applications on surface soil might be promissory.

  13. Evaluation of the Analytical Anisotropic Algorithm (AAA) in dose calculation for fields with non-uniform fluences considering heterogeneity correction; Avaliacao do Algoritmo Analitico Anisotropico (AAA) no calculo de dose para campos com fluencia nao uniforme considerando correcao de heterogeneidade

    Energy Technology Data Exchange (ETDEWEB)

    Bornatto, P.; Funchal, M.; Bruning, F.; Toledo, H.; Lyra, J.; Fernandes, T.; Toledo, F.; Marciao, C., E-mail: pricila_bornatto@yahoo.com.br [Hospital Erasto Gaertner (LPCC), Curitiba, PR (Brazil). Departamento de Radioterapia

    2014-08-15

    The purpose of this study is to evaluate the calculation of dose distribution AAA (Varian Medical Systems) for fields with non-uniform fluences considering heterogeneity correction. Five different phantoms were used with different density materials. These phantoms were scanned in the CT BrightSpeed (©GE Healthcare) upon the array of detectors MAPCHECK2 TM (Sun Nuclear Corporation) and irradiated in a linear accelerator 600 CD (Varian Medical Systems) 6MV and rate dose 400MU/min with isocentric setup. The fluences used were exported from IMRT plans, calculated by ECLIPSE™ planning system (Varian Medical Systems), and a 10x10 cm{sup 2} field to assess the heterogeneity correction for uniform fluence. The measured dose distribution was compared to the calculated by Gamma analysis with approval criteria of 3% / 3 mm and 10% threshold. The evaluation was performed using the software SNCPatient (Sun Nuclear Corporation) and considering absolute dose normalized at maximum. The phantoms best performers were those with low density materials, with an average of 99.2% approval. Already phantoms with plates of higher density material presented various fluences below 95% of the points approved. The average value reached 94.3%. It was observed a dependency between fluency and approved percentage points, whereas for the same fluency, 100% of the points have been approved in all phantoms. The approval criteria for IMRT plans recommended in most centers is 3% / 3mm with at least 95% of points approved, it can be concluded that, under these conditions, the IMRT plans with heterogeneity correction can be performed , however the quality control must be careful because the difficulty of the system to accurately predict the dose distribution in certain situations. (author)

  14. The ATP Sites of AAA+ Clamp Loaders Work Together as a Switch to Assemble Clamps on DNA*

    Science.gov (United States)

    Marzahn, Melissa R.; Hayner, Jaclyn N.; Finkelstein, Jeff; O'Donnell, Mike; Bloom, Linda B.

    2014-01-01

    Clamp loaders belong to a family of proteins known as ATPases associated with various cellular activities (AAA+). These proteins utilize the energy from ATP binding and hydrolysis to perform cellular functions. The clamp loader is required to load the clamp onto DNA for use by DNA polymerases to increase processivity. ATP binding and hydrolysis are coordinated by several key residues, including a conserved Lys located within the Walker A motif (or P-loop). This residue is required for each subunit to bind ATP. The specific function of each ATP molecule bound to the Saccharomyces cerevisiae clamp loader is unknown. A series of point mutants, each lacking a single Walker A Lys residue, was generated to study the effects of abolishing ATP binding in individual clamp loader subunits. A variety of biochemical assays were used to analyze the function of ATP binding during discrete steps of the clamp loading reaction. All mutants reduced clamp binding/opening to different degrees. Decreased clamp binding activity was generally correlated with decreases in the population of open clamps, suggesting that differences in the binding affinities of Walker A mutants stem from differences in stabilization of proliferating cell nuclear antigen in an open conformation. Walker A mutations had a smaller effect on DNA binding than clamp binding/opening. Our data do not support a model in which each ATP site functions independently to regulate a different step in the clamp loading cycle to coordinate these steps. Instead, the ATP sites work in unison to promote conformational changes in the clamp loader that drive clamp loading. PMID:24436332

  15. The ATP sites of AAA+ clamp loaders work together as a switch to assemble clamps on DNA.

    Science.gov (United States)

    Marzahn, Melissa R; Hayner, Jaclyn N; Finkelstein, Jeff; O'Donnell, Mike; Bloom, Linda B

    2014-02-28

    Clamp loaders belong to a family of proteins known as ATPases associated with various cellular activities (AAA+). These proteins utilize the energy from ATP binding and hydrolysis to perform cellular functions. The clamp loader is required to load the clamp onto DNA for use by DNA polymerases to increase processivity. ATP binding and hydrolysis are coordinated by several key residues, including a conserved Lys located within the Walker A motif (or P-loop). This residue is required for each subunit to bind ATP. The specific function of each ATP molecule bound to the Saccharomyces cerevisiae clamp loader is unknown. A series of point mutants, each lacking a single Walker A Lys residue, was generated to study the effects of abolishing ATP binding in individual clamp loader subunits. A variety of biochemical assays were used to analyze the function of ATP binding during discrete steps of the clamp loading reaction. All mutants reduced clamp binding/opening to different degrees. Decreased clamp binding activity was generally correlated with decreases in the population of open clamps, suggesting that differences in the binding affinities of Walker A mutants stem from differences in stabilization of proliferating cell nuclear antigen in an open conformation. Walker A mutations had a smaller effect on DNA binding than clamp binding/opening. Our data do not support a model in which each ATP site functions independently to regulate a different step in the clamp loading cycle to coordinate these steps. Instead, the ATP sites work in unison to promote conformational changes in the clamp loader that drive clamp loading.

  16. The Interplay of Cofactor Interactions and Post-translational Modifications in the Regulation of the AAA+ ATPase p97

    Science.gov (United States)

    Hänzelmann, Petra; Schindelin, Hermann

    2017-01-01

    The hexameric type II AAA ATPase (ATPase associated with various activities) p97 (also referred to as VCP, Cdc48, and Ter94) is critically involved in a variety of cellular activities including pathways such as DNA replication and repair which both involve chromatin remodeling, and is a key player in various protein quality control pathways mediated by the ubiquitin proteasome system as well as autophagy. Correspondingly, p97 has been linked to various pathophysiological states including cancer, neurodegeneration, and premature aging. p97 encompasses an N-terminal domain, two highly conserved ATPase domains and an unstructured C-terminal tail. This enzyme hydrolyzes ATP and utilizes the resulting energy to extract or disassemble protein targets modified with ubiquitin from stable protein assemblies, chromatin and membranes. p97 participates in highly diverse cellular processes and hence its activity is tightly controlled. This is achieved by multiple regulatory cofactors, which either associate with the N-terminal domain or interact with the extreme C-terminus via distinct binding elements and target p97 to specific cellular pathways, sometimes requiring the simultaneous association with more than one cofactor. Most cofactors are recruited to p97 through conserved binding motifs/domains and assist in substrate recognition or processing by providing additional molecular properties. A tight control of p97 cofactor specificity and diversity as well as the assembly of higher-order p97-cofactor complexes is accomplished by various regulatory mechanisms, which include bipartite binding, binding site competition, changes in oligomeric assemblies, and nucleotide-induced conformational changes. Furthermore, post-translational modifications (PTMs) like acetylation, palmitoylation, phosphorylation, SUMOylation, and ubiquitylation of p97 have been reported which further modulate its diverse molecular activities. In this review, we will describe the molecular basis of p97

  17. AAA and PBC calculation accuracy in the surface build-up region in tangential beam treatments. Phantom and breast case study with the Monte Carlo code PENELOPE.

    Science.gov (United States)

    Panettieri, Vanessa; Barsoum, Pierre; Westermark, Mathias; Brualla, Lorenzo; Lax, Ingmar

    2009-10-01

    In tangential beam treatments accurate dose calculation of the absorbed dose in the build-up region is of major importance, in particular when the target has superficial extension close to the skin. In most analytical treatment planning systems (TPSs) calculations depend on the experimental measurements introduced by the user in which accuracy might be limited by the type of detector employed to perform them. To quantify the discrepancy between analytically calculated and delivered dose in the build-up region, near the skin of a patient, independent Monte Carlo (MC) simulations using the penelope code were performed. Dose distributions obtained with MC simulations were compared with those given by the Pencil Beam Convolution (PBC) algorithm and the Analytical Anisotropic Algorithm (AAA) implemented in the commercial TPS Eclipse. A cylindrical phantom was used to approximate the breast contour of a patient for MC simulations and the TPS. Calculations of the absorbed doses were performed for 6 and 18MV beams for four different angles of incidence: 15 degrees , 30 degrees , 45 degrees and 75 degrees and different field sizes: 3x3cm(2), 10x10cm(2) and 40x40cm(2). Absorbed doses along the phantom central axis were obtained with both the PBC algorithm and the AAA and compared to those estimated by the MC simulations. Additionally, a breast patient case was calculated with two opposed 6MV photon beams using all the aforementioned analytical and stochastic algorithms. For the 6MV photon beam in the phantom case, both the PBC algorithm and the AAA tend to underestimate the absorbed dose in the build-up region in comparison to MC results. These differences are clinically irrelevant and are included in a 1mm range. This tendency is also confirmed in the breast patient case. For the 18MV beam the PBC algorithm underestimates the absorbed dose with respect to the AAA. In comparison to MC simulations the PBC algorithm tends to underestimate the dose after the first 2-3mm of

  18. New AAAS committee

    CERN Multimedia

    1971-01-01

    Dr Glen Seaborg, chairman of the US Atomic Energy Commission, has been made president elect of the American Association for the Advancement of science. He defeated two other candidates despite fears of some members that his connection with the AEC could lead to a conflict of interests (2 paragraphs).

  19. LAA~AAA

    Indian Academy of Sciences (India)

    Ionic lattice energy is defined as the energy released when ... assumptions made are: ions are point charges, the crystal is ... 4lZ"co x==-2. /x/. (1). The above expression can be extended to a system of linearly arranged infinite number of alternating charges on either side of the central reference charge by summing over x ...

  20. LAAnAAA

    Indian Academy of Sciences (India)

    04 Glial Cens: The Other Cells of the Nervous System. aCIIIICl. Introduction. 94. An Introduction to Glial Cells. V Rajaraman. Wireless Telegraphic. Communication. Guglielmo Marconi. 53 at Marconi point on Cape Cod, USA. Medha S Raiadhyaksha and Yasmin Khan. GENERAL ARTICLES. 11 Splitting of Comets.

  1. The maize AAA-type protein SKD1 confers enhanced salt and drought stress tolerance in transgenic tobacco by interacting with Lyst-interacting protein 5.

    Directory of Open Access Journals (Sweden)

    Zongliang Xia

    Full Text Available ATPase associated with various cellular activities (AAA proteins are important regulators involved in diverse cellular functions. To date, the molecular mechanisms of AAA proteins involved in response to salt and drought stresses in plants are largely unknown. In this study, a putative SKD1 (suppressor of K(+ transport growth defect 1 ortholog from Zea mays (ZmSKD1, which encodes a putative AAA protein, was isolated. The transcript levels of ZmSKD1 were higher in aerial tissues and were markedly up-regulated by salt or drought stress. Over-expression of ZmSKD1 in tobacco plants enhanced their tolerances not only to salt but to drought. Moreover, reactive oxygen species accumulations in ZmSKD1 transgenic lines were relative less than those in wild-type plants during salt or PEG-induced water stress. The interaction between ZmSKD1 and NtLIP5 (Lyst-Interacting Protein 5 homolog from Nicotiana tabacum was confirmed by both yeast two-hybrid and immuno-precipitation assays; moreover, the α-helix-rich domain in the C-terminus of ZmSKD1 was identified to be required for its interaction with NtLIP5 using truncation mutations. Collectively, these data demonstrate that ZmSKD1could be involved in salt and drought stress responses and its over-expression enhances salt or drought stress tolerance possibly through interacting with LIP5 in tobacco. This study may facilitate our understandings of the biological roles of SKD1-mediated ESCRT pathway under stress conditions in higher plants and accelerate genetic improvement of crop plants tolerant to environmental stresses.

  2. The Whipple Museum and Cavendish Laboratory, Cambridge

    Science.gov (United States)

    Pippard, Brian

    The Whipple Museum is part of the History and Philosophy of Science Department in the University of Cambridge. It is on your right as soon as you enter Free School Lane from Pembroke Street, and is normally open between 1:30 and 4:30 P.M. on weekdays. The main room, a hall with hammer-beam roof, is a relic of Stephen Perse’s school (1624) now flourishing elsewhere in the city. It houses a large collection of mathematical, physical and astronomical instruments — abaci, Napier’s bones, slide rules; sextants and other surveying instruments; telescopes, compasses and pocket sundials (especially of ivory from Nuremberg 1500-1700); and a Grand Orrery by George Adams (1750). The gallery of a second room is used for special exhibitions, often of items from the well-stocked store. Some specialist catalogues have been compiled and are on sale.

  3. Influencia de la pérdida foliar sobre la cosecha en el cv. Gruesa, Musa acuminata Colla (AAA, cultivado bajo invernadero en las Islas Canarias Influence of leaf removal in yield of cv. Gruesa, Musa acuminata Colla (AAA, cultivated under greenhouse in the Canary Islands

    Directory of Open Access Journals (Sweden)

    Juan Cabrera Cabrera

    2010-12-01

    Full Text Available El cultivo de la variedad de platanera Gruesa, selección local de Dwarf Cavendish, ha experimentado un importante aumento en los últimos años en las Islas Canarias, tanto al aire libre como bajo invernadero. La eliminación de hojas, tras la floración, es una práctica habitual en los cultivos bajo invernadero. Asimismo es frecuente la pérdida de hojas por el efecto de los vientos en los cultivos al aire libre. El objetivo de este trabajo es evaluar, mediante simulación de pérdida foliar por daños mecánicos, la influencia que tiene la disminución de superficie foliar sobre el llenado y cosecha de la fruta en dicho cultivar. Para ello, cuatro meses antes de la cosecha se efectuaron cinco niveles de defoliación: 0%, 25%, 50%, 75% y 100%. Se valoran dos métodos diferentes de defoliación, eliminación de limbo foliar y tronchado de hojas con posterior corte de éstas. Se analizan y presentan datos morfológicos, fenológicos y productivos, así como valoración de la metodología empleada en este trabajo para la simulación de daños. A partir de un 25% de defoliado, equivalente a 7.5 hojas funcionales por planta, se detectaron diferencias significativas con las plantas testigos.The banana cultivar Gruesa, a local Dwarf Cavendish selection, is increasingly planted in the Canary Islands, both in greenhouse and in the open air. Both methods present some degree of leaf loss throughout the crop cycle: the leaves of greenhouse plants are traditionally cut back after flowering, and open air plantations experience frequent wind damage. A trial was set up four months prior to harvest to evaluate fruit filling rate and yield of Gruesa subjected to five levels of defoliation (0%, 25%, 50%, 75%, and 100% loss of leaf area. Two defoliation techniques were used to simulate damage: removal of the midrib, and slashing the leaf blade followed later by complete removal. Morphological, phenological and production data are presented.

  4. Influencia de la pérdida foliar sobre la cosecha en el cv. Gruesa, Musa acuminata Colla (AAA, cultivado bajo invernadero en las Islas Canarias

    Directory of Open Access Journals (Sweden)

    Juan Cabrera Cabrera

    2010-12-01

    Full Text Available El cultivo de la variedad de platanera Gruesa, selección local de Dwarf Cavendish, ha experimentado un importante aumento en los últimos años en las Islas Canarias, tanto al aire libre como bajo invernadero. La eliminación de hojas, tras la floración, es una práctica habitual en los cultivos bajo invernadero. Asimismo es frecuente la pérdida de hojas por el efecto de los vientos en los cultivos al aire libre. El objetivo de este trabajo es evaluar, mediante simulación de pérdida foliar por daños mecánicos, la influencia que tiene la disminución de superficie foliar sobre el llenado y cosecha de la fruta en dicho cultivar. Para ello, cuatro meses antes de la cosecha se efectuaron cinco niveles de defoliación: 0%, 25%, 50%, 75% y 100%. Se valoran dos métodos diferentes de defoliación, eliminación de limbo foliar y tronchado de hojas con posterior corte de éstas. Se analizan y presentan datos morfológicos, fenológicos y productivos, así como valoración de la metodología empleada en este trabajo para la simulación de daños. A partir de un 25% de defoliado, equivalente a 7.5 hojas funcionales por planta, se detectaron diferencias significativas con las plantas testigos.

  5. Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor.

    Science.gov (United States)

    Zeymer, Cathleen; Barends, Thomas R M; Werbeck, Nicolas D; Schlichting, Ilme; Reinstein, Jochen

    2014-02-01

    ATPases of the AAA+ superfamily are large oligomeric molecular machines that remodel their substrates by converting the energy from ATP hydrolysis into mechanical force. This study focuses on the molecular chaperone ClpB, the bacterial homologue of Hsp104, which reactivates aggregated proteins under cellular stress conditions. Based on high-resolution crystal structures in different nucleotide states, mutational analysis and nucleotide-binding kinetics experiments, the ATPase cycle of the C-terminal nucleotide-binding domain (NBD2), one of the motor subunits of this AAA+ disaggregation machine, is dissected mechanistically. The results provide insights into nucleotide sensing, explaining how the conserved sensor 2 motif contributes to the discrimination between ADP and ATP binding. Furthermore, the role of a conserved active-site arginine (Arg621), which controls binding of the essential Mg2+ ion, is described. Finally, a hypothesis is presented as to how the ATPase activity is regulated by a conformational switch that involves the essential Walker A lysine. In the proposed model, an unusual side-chain conformation of this highly conserved residue stabilizes a catalytically inactive state, thereby avoiding unnecessary ATP hydrolysis.

  6. Caracterização do grânulo de amido de bananas (Musa AAA-Nanicão e Musa AAB-Terra Characterization of starch granules from bananas Musa AAA-Nanicão and Musa AAB-Terra

    Directory of Open Access Journals (Sweden)

    M.C.J. Freitas

    2005-06-01

    Full Text Available O amido de bananas tem sido pesquisado na área de nutrição a partir da introdução do conceito de Amido Resistente. O amido de Musa AAA-Nanicão e Musa AAB-Terra foram caracterizados quanto as suas respostas fisiológicas [12]. Em continuidade, o presente trabalho estudou características físicas e morfológicas dos grânulos de amido de ambas as espécies de banana comparando-as com amido nativo de milho comercial. O amido de bananas foi extraído segundo CHIANG, CHU & CHU [3]. A morfologia dos grânulos foi realizada após tratamento enzimático in vitro a 37°C/24h com alfa-amilase pancreática. Foram efetuados os respectivos amilogramas e difractogramas de raios-X. Os grânulos de amido da Musa Tipo AAA-Nanicão apresentaram comprimento entre 30-40µm. Em Musa AAB-Terra, os grânulos, também ovais e alongados, eram um pouco menores, 20-30µm. A corrosão enzimática in vitro iniciava-se sobre a superfície anteriormente lisa e formavam estrias superficiais e apicais. A Microscopia Eletrônica de Varredura (MEV mostrou que a hidrólise in vitro por 24 horas foi pequena e ocorria sobretudo nas camadas amorfas dos grânulos de ambas as espécies. O padrão de corrosão demonstrou-se distinto daquele ocorrido no amido de milho. As suspensões de amido de bananas ao viscosímetro demonstraram forte capacidade de hidratação e menor capacidade de retrogradação em relação ao milho, sobretudo do amido de Musa Tipo AAA-Nanicão; o amido de Musa Tipo AAB-Terra apresentou maior estabilidade de pasta. Na análise de difração de raios-X, os grânulos de bananas apresentaram padrão tipo B e C para Musa Tipo AAA-Nanicão e Musa Tipo AAB-Terra, respectivamente. Conclui-se que os amidos de Musa AAA-Nanicão e Musa AAB-Terra são estruturalmente distintos, justificando as respostas fisiológicas distintas encontradas posteriormente pelos mesmos autores. As distinções das propriedades físicas e bioquímicas obtidas para os grânulos, embora

  7. Geometrical determinations of IMRT photon pencil-beam path in radiotherapy wedges and limit divergence angle with the Anisotropic Analytic Algorithm (AAA

    Directory of Open Access Journals (Sweden)

    Francisco Casesnoves

    2014-08-01

    Full Text Available Purpose: Static wedge filters (WF are commonly used in radiation therapy, forward and/or inverse planning. We calculated the exact 2D/3D geometrical pathway of the photon-beam through the usual alloy WF, in order to get a better dose related to the beam intensity attenuation factor(s, after the beam has passed through the WF. The objective was to provide general formulation into the Anisotropic Analytical Algorithm (AAA model coordinates system (depending on collimator/wedge angles that also can be applied to other models. Additionally, second purpose of this study was to develop integral formulation for 3D wedge exponential factor with statistical approximations, with introduction for the limit angle/conformal wedge.Methods: The radiotherapy model used to develop this mathematical task is the classical superposition-convolution algorithm, AAA (developed by Ulmer and Harder. We worked with optimal geometrical approximations to make the computational IMRT calculations quicker/reduce the planning-system time. Analytic geometry/computational-techniques to carry out simulations (for standard wedges are detailed/developed sharply. Integral developments/integral-statistical approximations are explained. Beam-divergence limit Angle for optimal wedge filtration formulas is calculated/sketched, with geometrical approximations. Fundamental trigonometry is used for this purpose.Results: Extent simulation tables for WF of 15º, 30º, 45º, and 60º are shown with errors. As a result, it is possible to determine the best individual treatment dose distribution for each patient. We presented these basic simulations/numerical examples for standard manufacturing WF of straight sloping surface, to check the accuracy/errors of the calculations. Simulations results give low RMS/Relative Error values (formulated for WF of 15º, 30º, 45º, and 60º.Conclusion: We obtained a series of formulas of analytic geometry for WF that can be applied for any particular dose

  8. Levels of H-ras codon 61 CAA to AAA mutation: response to 4-ABP-treatment and Pms2-deficiency.

    Science.gov (United States)

    Parsons, Barbara L; Delongchamp, Robert R; Beland, Frederick A; Heflich, Robert H

    2006-01-01

    DNA mismatch repair (MMR) deficiencies result in increased frequencies of spontaneous mutation and tumor formation. In the present study, we tested the hypothesis that a chemically-induced mutational response would be greater in a mouse with an MMR-deficiency than in the MMR-proficient mouse models commonly used to assay for chemical carcinogenicity. To accomplish this, the induction of H-ras codon 61 CAA-->AAA mutation was examined in Pms2 knockout mice (Pms2-/-, C57BL/6 background) and sibling wild-type mice (Pms2+/+). Groups of five or six neonatal male mice were treated with 0.3 micromol 4-aminobiphenyl (4-ABP) or the vehicle control, dimethylsulfoxide. Eight months after treatment, liver DNAs were isolated and analysed for levels of H-ras codon 61 CAA-->AAA mutation using allele-specific competitive blocker-PCR. In Pms2-proficient and Pms2-deficient mice, 4-ABP treatment caused an increase in mutant fraction (MF) from 1.65x10(-5) to 2.91x10(-5) and from 3.40x10(-5) to 4.70x10(-5), respectively. Pooling data from 4-ABP-treated and control mice, the approximately 2-fold increase in MF observed in Pms2-deficient as compared with Pms2-proficient mice was statistically significant (P=0.0207) and consistent with what has been reported previously in terms of induction of G:C-->T:A mutation in a Pms2-deficient background. Pooling data from both genotypes, the increase in H-ras MF in 4-ABP-treated mice, as compared with control mice, did not reach the 95% confidence level of statistical significance (P=0.0606). The 4-ABP treatment caused a 1.76-fold and 1.38-fold increase in average H-ras MF in Pms2-proficient and Pms2-deficient mice, respectively. Furthermore, the levels of induced mutation in Pms2-proficient and Pms2-deficient mice were nearly identical (1.26x10(-5) and 1.30x10(-5), respectively). We conclude that Pms2-deficiency does not result in an amplification of the H-ras codon 61 CAA-->AAA mutational response induced by 4-ABP.

  9. Whole-exome sequencing identifies homozygous AFG3L2 mutations in a spastic ataxia-neuropathy syndrome linked to mitochondrial m-AAA proteases.

    Directory of Open Access Journals (Sweden)

    Tyler Mark Pierson

    2011-10-01

    Full Text Available We report an early onset spastic ataxia-neuropathy syndrome in two brothers of a consanguineous family characterized clinically by lower extremity spasticity, peripheral neuropathy, ptosis, oculomotor apraxia, dystonia, cerebellar atrophy, and progressive myoclonic epilepsy. Whole-exome sequencing identified a homozygous missense mutation (c.1847G>A; p.Y616C in AFG3L2, encoding a subunit of an m-AAA protease. m-AAA proteases reside in the mitochondrial inner membrane and are responsible for removal of damaged or misfolded proteins and proteolytic activation of essential mitochondrial proteins. AFG3L2 forms either a homo-oligomeric isoenzyme or a hetero-oligomeric complex with paraplegin, a homologous protein mutated in hereditary spastic paraplegia type 7 (SPG7. Heterozygous loss-of-function mutations in AFG3L2 cause autosomal-dominant spinocerebellar ataxia type 28 (SCA28, a disorder whose phenotype is strikingly different from that of our patients. As defined in yeast complementation assays, the AFG3L2(Y616C gene product is a hypomorphic variant that exhibited oligomerization defects in yeast as well as in patient fibroblasts. Specifically, the formation of AFG3L2(Y616C complexes was impaired, both with itself and to a greater extent with paraplegin. This produced an early-onset clinical syndrome that combines the severe phenotypes of SPG7 and SCA28, in additional to other "mitochondrial" features such as oculomotor apraxia, extrapyramidal dysfunction, and myoclonic epilepsy. These findings expand the phenotype associated with AFG3L2 mutations and suggest that AFG3L2-related disease should be considered in the differential diagnosis of spastic ataxias.

  10. TU-C-BRE-05: Clinical Implications of AAA Commissioning Errors and Ability of Common Commissioning ' Credentialing Procedures to Detect Them

    Energy Technology Data Exchange (ETDEWEB)

    McVicker, A; Oldham, M; Yin, F; Adamson, J [Duke University Medical Center, Durham, NC (United States)

    2014-06-15

    Purpose: To test the ability of the TG-119 commissioning process and RPC credentialing to detect errors in the commissioning process for a commercial Treatment Planning System (TPS). Methods: We introduced commissioning errors into the commissioning process for the Anisotropic Analytical Algorithm (AAA) within the Eclipse TPS. We included errors in Dosimetric Leaf Gap (DLG), electron contamination, flattening filter material, and beam profile measurement with an inappropriately large farmer chamber (simulated using sliding window smoothing of profiles). We then evaluated the clinical impact of these errors on clinical intensity modulated radiation therapy (IMRT) plans (head and neck, low and intermediate risk prostate, mesothelioma, and scalp) by looking at PTV D99, and mean and max OAR dose. Finally, for errors with substantial clinical impact we determined sensitivity of the RPC IMRT film analysis at the midpoint between PTV and OAR using a 4mm distance to agreement metric, and of a 7% TLD dose comparison. We also determined sensitivity of the 3 dose planes of the TG-119 C-shape IMRT phantom using gamma criteria of 3% 3mm. Results: The largest clinical impact came from large changes in the DLG with a change of 1mm resulting in up to a 5% change in the primary PTV D99. This resulted in a discrepancy in the RPC TLDs in the PTVs and OARs of 7.1% and 13.6% respectively, which would have resulted in detection. While use of incorrect flattening filter caused only subtle errors (<1%) in clinical plans, the effect was most pronounced for the RPC TLDs in the OARs (>6%). Conclusion: The AAA commissioning process within the Eclipse TPS is surprisingly robust to user error. When errors do occur, the RPC and TG-119 commissioning credentialing criteria are effective at detecting them; however OAR TLDs are the most sensitive despite the RPC currently excluding them from analysis.

  11. CORRELATIONS BETWEEN COMMERCIALIZATION UNITS OF BANANA "NANICÃO" (Musa acuminata AAA IN GOIÁS, BRAZIL CORRELAÇÕES ENTRE UNIDADES DE COMERCIALIZAÇÃO PARA BANANAS “NANICÃO” (Musa acuminata AAA EM GOIÁS

    Directory of Open Access Journals (Sweden)

    Ronaldo Veloso Naves

    2007-09-01

    Full Text Available

    In Goiás, wholesalers of the “Giant Cavendish” banana use different systems of measuring. This causes constant confusion. This study was undertaken to try to establish empirical formulas which can be used to correlate the diverse systems.

    Na comercialização de bananas do sub-grupo cavendishi, em Goiás, utiliza-se de várias unidades de medida. Esta diversidade causa problemas no bom entendimento entre vendedores e compradores. Com a finalidade de estabelecer fórmulas empíricas de transformações de unidades de comercialização, empreendeu-se o presente trabalho. Com base nos resultados, conclui-se que as melhores fórmulas de transformações são as seguintes: a - Peso de um carregamento em cachos para número de frutas (NF = 80,4 P/ 11,41, sendo P tomado em Kg; b - Para a obtenção do peso líquido ( PL de frutas a serem encaixadas, subtrai-se 10% do peso bruto; c - Peso líquido (PL de frutas em caixas tipo torito (Cx (Cx = PL/ 18,85; d - Cento de frutas (CF em caixas tipo torito (Cx (Cx = CF/ 14.

  12. Analysis of MaACS2, a stress-inducible ACC Synthase Gene in Musa acuminata AAA Group Cultivar Pisang Ambon

    Directory of Open Access Journals (Sweden)

    Resnanti Utami Handayani

    2014-07-01

    Full Text Available Ethylene has an important function in plant growth and development. Ethylene production generally increases in response to pathogen attacks and other environmental stress conditions. The synthesis of this phytohormone is regulated by two enzymes, ACC synthase (ACS and ACC oxidase (ACO. ACC synthase is encoded by a multigene that regulates the production of ACC, after which this precursor is converted into ethylene by ACO. Pisang Ambon (Musa sp. AAA group, a banana cultivar originating from Indonesia, has nine ACS genes (MaACS 1-9 and one ACO gene (MaACO. One of the banana ACS genes, MaACS2, is stress-inducible. In this research, we have investigated the expression profile of MaACS2 in the roots and leaf tissues of infected tissue culture plants. Quantification of gene expression was analyzed using Real-Time PCR (qPCR using Ma18srRNA and MaGAPDH as reference genes. The results showed nine-to ten fold higher MaACS2 expression levels in the infected roots tissues compared to the uninfected roots tissues. However, MaACS2 expression in the leaves was only detected in infected tissue.

  13. Zinc and ATP binding of the hexameric AAA-ATPase PilF from Thermus thermophilus: role in complex stability, piliation, adhesion, twitching motility, and natural transformation.

    Science.gov (United States)

    Salzer, Ralf; Herzberg, Martin; Nies, Dietrich H; Joos, Friederike; Rathmann, Barbara; Thielmann, Yvonne; Averhoff, Beate

    2014-10-31

    The traffic AAA-ATPase PilF is essential for pilus biogenesis and natural transformation of Thermus thermophilus HB27. Recently, we showed that PilF forms hexameric complexes containing six zinc atoms coordinated by conserved tetracysteine motifs. Here we report that zinc binding is essential for complex stability. However, zinc binding is neither required for pilus biogenesis nor natural transformation. A number of the mutants did not exhibit any pili during growth at 64 °C but still were transformable. This leads to the conclusion that type 4 pili and the DNA translocator are distinct systems. At lower growth temperatures (55 °C) the zinc-depleted multiple cysteine mutants were hyperpiliated but defective in pilus-mediated twitching motility. This provides evidence that zinc binding is essential for the role of PilF in pilus dynamics. Moreover, we found that zinc binding is essential for complex stability but dispensable for ATPase activity. In contrast to many polymerization ATPases from mesophilic bacteria, ATP binding is not required for PilF complex formation; however, it significantly increases complex stability. These data suggest that zinc and ATP binding increase complex stability that is important for functionality of PilF under extreme environmental conditions. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. Effect of hydric stress induced by PEG 6000 on water content of Musa spp. ‘Grande naine’ (AAA and ‘Pelipita’ (ABB in vitro plants

    Directory of Open Access Journals (Sweden)

    Leonardo J Moreno-Bermúdez

    2015-10-01

    Full Text Available Bananas and bananas are grown in the tropical and subtropical regions of the world, by hence they are adapted to good humidity conditions. The productivity of these crops is affected by abiotic factors such as drought, which has increased in recent years due to the effects of climate change. In vitro selection of tolerant genotypes offers advantages over field selection as it saves time, resources and permit to work with larger plant volumes. The aim of this work was to determine the effect of in vitro water stress induced with polyethylene glycol 6000 (PEG 6000 on water content (WC of Musa spp. ‘Grande naine’ (AAA and ‘Pelipita’ (ABB cultivars. In ‘Pelipita’ cultivar WC was not affected by PEG 6000 effect, but in ‘Grande naine’ this trait was significantly reduced in those plants under stress. Both, ‘Pelipita’ and ‘Grande naine’ cultivars differentially respond to water stress induced in vitro by PEG 6000 and could be used as reference in plants evaluation obtained by plant breeding for drought tolerance. Key words: banana, climate change, drought, in vitro selection

  15. Early evaluation and on field conditions of resistance to Mycosphaerella fijiensis Morelet of plants from Grande naine (AAA cultivar, obtained through out tissue culture and mutations induction

    Directory of Open Access Journals (Sweden)

    Lourdes R. García

    2003-04-01

    Full Text Available The present work was carried out in the Plants Biotechnology Institute of the Central University of Las Villas. The plant material from the cv. Grande Naine (AAA was treated with physical mutagenic agents(gamma radiation 60Co source to induce genetic variability. The behaviour of the population to the black Sigatoka was evaluated. A somaclone was selected by its disease resistance and was in vitro multiplied and the plants were acclimatized to evaluate its behaviour facing the disease on greenhouse conditions and in a second cycle of multiplication in the field. The results showed that in the majority of the plants were not found differences respect cv Grande Naine, just one presented similar reaction to cv. ‘FHIA 18’ (AAAB (partially resistant as for the variable evaluated, being obtained a frequency of 0.018% for this character. This plant was named IBP 446. After 60 days of application of the mycelial homogenized of M. fijiensis in micropropagated plants of this somaclone, differences in the respect affectation states were found at susceptible witness in greenhouse conditions. When plants of the IBP 446 were evaluated in a second cycle of multiplication differences were found with the susceptible control only at flowering, while they behaved similar at susceptible control in the crop. Key words: early detection, breeding, mutation, Black Sigatoka

  16. Mouse brain expression patterns of Spg7, Afg3l1, and Afg3l2 transcripts, encoding for the mitochondrial m-AAA protease

    Directory of Open Access Journals (Sweden)

    Brusco Alfredo

    2010-04-01

    Full Text Available Abstract Background The m-AAA (ATPases Associated with a variety of cellular Activities is an evolutionary conserved metalloprotease complex located in the internal mitochondrial membrane. In the mouse, it is a hetero-oligomer variably formed by the Spg7, Afg3l1, and Afg3l2 encoded proteins, or a homo-oligomer formed by either Afg3l1 or Afg3l2. In humans, AFG3L2 and SPG7 genes are conserved, whereas AFG3L1 became a pseudogene. Both AFG3L2 and SPG7 are involved in a neurodegenerative disease, namely the autosomal dominant spinocerebellar ataxia SCA28 and a recessive form of spastic paraplegia, respectively. Results Using quantitative RT-PCR, we measured the expression levels of Spg7, Afg3l1, and Afg3l2 in the mouse brain. In all regions Afg3l2 is the most abundant transcript, followed by Spg7, and Afg3l1, with a ratio of approximately 5:3:1 in whole-brain mRNA. Using in-situ hybridization, we showed that Spg7, Afg3l1 and Afg3l2 have a similar cellular pattern of expression, with high levels in mitral cells, Purkinje cells, deep cerebellar nuclei cells, neocortical and hippocampal pyramidal neurons, and brainstem motor neurons. However, in some neuronal types, differences in the level of expression of these genes were present, suggesting distinct degrees of contribution of their proteins. Conclusions Neurons involved in SCA28 and hereditary spastic paraplegia display high levels of expression, but similar or even higher expression is also present in other types of neurons, not involved in these diseases, suggesting that the selective cell sensitivity should be attributed to other, still unknown, mechanisms.

  17. Identification and expression analysis of four 14-3-3 genes during fruit ripening in banana (Musa acuminata L. AAA group, cv. Brazilian).

    Science.gov (United States)

    Li, Mei-Ying; Xu, Bi-Yu; Liu, Ju-Hua; Yang, Xiao-Liang; Zhang, Jian-Bin; Jia, Cai-Hong; Ren, Li-Cheng; Jin, Zhi-Qiang

    2012-02-01

    To investigate the regulation of 14-3-3 proteins in banana (Musa acuminata L. AAA group, cv. Brazilian) fruit postharvest ripening, four cDNAs encoding 14-3-3 proteins were isolated from banana and designated as Ma-14-3-3a, Ma-14-3-3c, Ma-14-3-3e, and Ma-14-3-3i, respectively. Amino acid sequence alignment showed that the four 14-3-3 proteins shared a highly conserved core structure and variable C-terminal as well as N-terminal regions with 14-3-3 proteins from other plant species. Phylogenetic analysis revealed that the four 14-3-3 genes belong to the non-ε groups. They were differentially and specifically expressed in various tissues. Real-time RT-PCR analysis indicated that these four genes function differentially during banana fruit postharvest ripening. Three genes, Ma-14-3-3a, Ma-14-3-3c, and Ma-14-3-3e, were significantly induced by exogenous ethylene treatment. However, gene function differed in naturally ripened fruits. Ethylene could induce Ma-14-3-3c expression during postharvest ripening, but expression patterns of Ma-14-3-3a and Ma-14-3-3e suggest that these two genes appear to be involved in regulating ethylene biosynthesis during fruit ripening. No obvious relationship emerged between Ma-14-3-3i expression in naturally ripened and 1-MCP (1-methylcyclopropene)-treated fruit groups during fruit ripening. These results indicate that the 14-3-3 proteins might be involved in various regulatory processes of banana fruit ripening. Further studies will mainly focus on revealing the detailed biological mechanisms of these four 14-3-3 genes in regulating banana fruit postharvest ripening.

  18. NVL2, a nucleolar AAA-ATPase, is associated with the nuclear exosome and is involved in pre-rRNA processing

    Energy Technology Data Exchange (ETDEWEB)

    Yoshikatsu, Yuki [Department of Life Systems, Institute of Technology and Science, The University of Tokushima Graduate School, Tokushima 770-8506 (Japan); Ishida, Yo-ichi; Sudo, Haruka [Department of Molecular and Cellular Biochemistry, Meiji Pharmaceutical University, Kiyose, Tokyo 204-8588 (Japan); Yuasa, Keizo; Tsuji, Akihiko [Department of Life Systems, Institute of Technology and Science, The University of Tokushima Graduate School, Tokushima 770-8506 (Japan); Nagahama, Masami, E-mail: nagahama@my-pharm.ac.jp [Department of Molecular and Cellular Biochemistry, Meiji Pharmaceutical University, Kiyose, Tokyo 204-8588 (Japan)

    2015-08-28

    Nuclear VCP-like 2 (NVL2) is a member of the chaperone-like AAA-ATPase family and is involved in the biosynthesis of 60S ribosomal subunits in mammalian cells. We previously showed the interaction of NVL2 with a DExD/H-box RNA helicase MTR4/DOB1, which is a known cofactor for an exoribonuclease complex, the exosome. This finding implicated NVL2 in RNA metabolic processes during ribosome biogenesis. In the present study, we found that a series of mutations within the ATPase domain of NVL2 causes a defect in pre-rRNA processing into mature 28S and 5.8S rRNAs. Co-immunoprecipitation analysis showed that NVL2 was associated with the nuclear exosome complex, which includes RRP6 as a nucleus-specific catalytic subunit. This interaction was prevented by depleting either MTR4 or RRP6, indicating their essential role in mediating this interaction with NVL2. Additionally, knockdown of MPP6, another cofactor for the nuclear exosome, also prevented the interaction by causing MTR4 to dissociate from the nuclear exosome. These results suggest that NVL2 is involved in pre-rRNA processing by associating with the nuclear exosome complex and that MPP6 is required for maintaining the integrity of this rRNA processing complex. - Highlights: • ATPase-deficient mutants of NVL2 have decreased pre-rRNA processing. • NVL2 associates with the nuclear exosome through interactions with MTR4 and RRP6. • MPP6 stabilizes MTR4-RRP6 interaction and allows NVL2 to interact with the complex.

  19. EFEITO DO PERÍODO DE ARMAZENAMENTO SOBRE A BROTAÇÃO DE MUDAS DE BANANEIRA DO CULTIVAR NANICÃO (Musa acuminata AAA EFFECT OF STORAGE TIME IN THE BUDDING OF BANANA ROOTSTOCK CULTIVAR NANICÃO (Musa acuminata AAA

    Directory of Open Access Journals (Sweden)

    Ronaldo Veloso Naves

    2007-09-01

    Full Text Available

    A grande procura atual de mudas de bananeiras do cultivar Nanicão (Musa acuminata AAA em Goiás, principalmente na região do Mato Grosso Goiano, tem forçado o transporte de mudas a grandes distâncias. A maioria destas mudas são transportadas sob a forma de pedaços de rizoma com aproximadamente 1 Kg. Tem-se observado uma falha acima do previsto quando se utiliza este tipo de muda. O presente trabalho foi realizado para determinar o efeito do período de armazenamento sobre a brotação deste cultivar. Com base nos resultados concluiu-se que no período de armazenamento estudado (45 dias praticamente não houve diferença na brotação das mudas. Somente aquelas armazenadas por 5 (cinco semanas apresentaram inexplicavelmente um índice baixo de pegamento.

    Because of the tremendous current demand for Nanicão (Musa acuminata AAA banana shoots in the state of Goiás, notably in the “Mato Grosso Goiano” area, shoots have had to be imported from far away. The greater part of these shoots are transported in rootstalk form. Each rootstalk weighs approximately 1 Kg. A larger portion of these shoots than been anticipated, are defective. The present study was made to determine the effect of storage time on the budding of this particular banana rootstalk. The results of the experiment show that during the period of storage, forty-two (42 days, that was studied, there was almost no difference in budding among the rootstalks. Only those which were stored for five (5 weeks showed, unexplainably, a low budding index.

  20. SU-F-P-39: End-To-End Validation of a 6 MV High Dose Rate Photon Beam, Configured for Eclipse AAA Algorithm Using Golden Beam Data, for SBRT Treatments Using RapidArc

    Energy Technology Data Exchange (ETDEWEB)

    Ferreyra, M; Salinas Aranda, F; Dodat, D; Sansogne, R; Arbiser, S [Vidt Centro Medico, Ciudad Autonoma De Buenos Aires, Ciudad Autonoma de Buenos Aire (Argentina)

    2016-06-15

    Purpose: To use end-to-end testing to validate a 6 MV high dose rate photon beam, configured for Eclipse AAA algorithm using Golden Beam Data (GBD), for SBRT treatments using RapidArc. Methods: Beam data was configured for Varian Eclipse AAA algorithm using the GBD provided by the vendor. Transverse and diagonals dose profiles, PDDs and output factors down to a field size of 2×2 cm2 were measured on a Varian Trilogy Linac and compared with GBD library using 2% 2mm 1D gamma analysis. The MLC transmission factor and dosimetric leaf gap were determined to characterize the MLC in Eclipse. Mechanical and dosimetric tests were performed combining different gantry rotation speeds, dose rates and leaf speeds to evaluate the delivery system performance according to VMAT accuracy requirements. An end-to-end test was implemented planning several SBRT RapidArc treatments on a CIRS 002LFC IMRT Thorax Phantom. The CT scanner calibration curve was acquired and loaded in Eclipse. PTW 31013 ionization chamber was used with Keithley 35617EBS electrometer for absolute point dose measurements in water and lung equivalent inserts. TPS calculated planar dose distributions were compared to those measured using EPID and MapCheck, as an independent verification method. Results were evaluated with gamma criteria of 2% dose difference and 2mm DTA for 95% of points. Results: GBD set vs. measured data passed 2% 2mm 1D gamma analysis even for small fields. Machine performance tests show results are independent of machine delivery configuration, as expected. Absolute point dosimetry comparison resulted within 4% for the worst case scenario in lung. Over 97% of the points evaluated in dose distributions passed gamma index analysis. Conclusion: Eclipse AAA algorithm configuration of the 6 MV high dose rate photon beam using GBD proved efficient. End-to-end test dose calculation results indicate it can be used clinically for SBRT using RapidArc.

  1. Multiplicación de hongos micorriza arbuscular (h.m.a) y efecto de la micorrización en plantas micropropagadas de banano (musa aaa cv. gran enano) (musaceae).

    OpenAIRE

    Usuga Osorio, Carmen Elena; Castañeda Sánchez, Darío Antonio; Franco Molano, Ana Esperanza

    2011-01-01

    Se evaluó el proceso de multiplicación de hongos que forman micorriza arbuscular (HMA), para lo cual se usaron diferentes tipos de inóculos entre ellos nativos de agroecosistemas bananeros del Urabá (Antioquia-Colombia), en sustrato sólido, con diferentes plantas hospedadoras y la infectividad y efectividad sobre plantas de banano (Musa AAA cv. Gran Enano). La colonización micorrizal promedio general de los HMA a las plantas trampa fue de 37,76 ± 21,86 %, con respecto a este porcentaje, las p...

  2. SU-E-T-196: Comparative Analysis of Surface Dose Measurements Using MOSFET Detector and Dose Predicted by Eclipse - AAA with Varying Dose Calculation Grid Size

    Energy Technology Data Exchange (ETDEWEB)

    Badkul, R; Nejaiman, S; Pokhrel, D; Jiang, H; Kumar, P [University of Kansas Medical Center, Kansas City, KS (United States)

    2015-06-15

    Purpose: Skin dose can be the limiting factor and fairly common reason to interrupt the treatment, especially for treating head-and-neck with Intensity-modulated-radiation-therapy(IMRT) or Volumetrically-modulated - arc-therapy (VMAT) and breast with tangentially-directed-beams. Aim of this study was to investigate accuracy of near-surface dose predicted by Eclipse treatment-planning-system (TPS) using Anisotropic-Analytic Algorithm (AAA)with varying calculation grid-size and comparing with metal-oxide-semiconductor-field-effect-transistors(MOSFETs)measurements for a range of clinical-conditions (open-field,dynamic-wedge, physical-wedge, IMRT,VMAT). Methods: QUASAR™-Body-Phantom was used in this study with oval curved-surfaces to mimic breast, chest wall and head-and-neck sites.A CT-scan was obtained with five radio-opaque markers(ROM) placed on the surface of phantom to mimic the range of incident angles for measurements and dose prediction using 2mm slice thickness.At each ROM, small structure(1mmx2mm) were contoured to obtain mean-doses from TPS.Calculations were performed for open-field,dynamic-wedge,physical-wedge,IMRT and VMAT using Varian-21EX,6&15MV photons using twogrid-sizes:2.5mm and 1mm.Calibration checks were performed to ensure that MOSFETs response were within ±5%.Surface-doses were measured at five locations and compared with TPS calculations. Results: For 6MV: 2.5mm grid-size,mean calculated doses(MCD)were higher by 10%(±7.6),10%(±7.6),20%(±8.5),40%(±7.5),30%(±6.9) and for 1mm grid-size MCD were higher by 0%(±5.7),0%(±4.2),0%(±5.5),1.2%(±5.0),1.1% (±7.8) for open-field,dynamic-wedge,physical-wedge,IMRT,VMAT respectively.For 15MV: 2.5mm grid-size,MCD were higher by 30%(±14.6),30%(±14.6),30%(±14.0),40%(±11.0),30%(±3.5)and for 1mm grid-size MCD were higher by 10% (±10.6), 10%(±9.8),10%(±8.0),30%(±7.8),10%(±3.8) for open-field, dynamic-wedge, physical-wedge, IMRT, VMAT respectively.For 6MV, 86% and 56% of all measured values

  3. Suscetibilidade de oito cultivares de bananeira à sigatoka-amarela na região de Marília (SP Susceptibility to sigatoka of eight banana cultivars in the region of Marília, State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Luiz Antonio Junqueira Teixeira

    1996-01-01

    Full Text Available A suscetibilidade de oito cultivares de bananeira à sigatoka-amarela (Mycosphaerella musicola foi avaliada em um experimento de campo, na região de Marília (SP. Três cultivares pertenciam ao Grupo AAA ('Nanicão', 'Nanicão Jangada' e 'Grande Naine' e cinco, ao AAB ('Prata', 'Enxerto', 'Maçã', 'Mysore' e 'Prata Zulu'. O experimento foi implantado em fevereiro de 1992 e, durante os três primeiros anos, não foi feito controle de sigatoka. A suscetibilidade dos materiais foi estimada mediante avaliações em três épocas: março de 93, abril e julho de 94. Na primeira avaliação, foi contado o número de manchas na segunda folha e, nas outras, foram atribuídas notas de acordo com a intensidade dos sintomas. Os cultivares foram agrupados em três classes: altamente suscetível (AS, suscetível (S ou parcialmente resistente (PR. Nenhum dos cultivares pôde ser considerado imune, pois todos apresentaram lesões foliares. Os cultivares mais suscetíveis foram os do Grupo AAA, Subgrupo Cavendish ('Nanicão', 'Grande Naine' e 'Nanicão Jangada' e 'Enxerto' (AAB. 'Mysore' (AAB e 'Prata Zulu' (AAB foram classificados como parcialmente resistentes. 'Prata' (AAB e 'Maçã' (AAB mostraram-se medianamente suscetíveis.Susceptibility of eight banana cultivars to sigatoka caused by Mycosphaerella musicola was assessed in a field experiment in the region of Marília, State of São Paulo. Three cultivars were members of AAA Group ('Nanicão', 'Nanicão Jangada' and 'Grande Naine' and five belonged to AAB Group ('Prata', 'Enxerto', 'Maçã', 'Mysore' and 'Prata Zulu'. The experiment was established in February, 1992, and during the first three years, sigatoka disease was not controlled. Susceptibility was assessed in three occasions: March, 1993, April and July, 1994. In the first, it was counted the number of spots on the second leaf, and in the others, the plants were graded according to the amount of leaf scorch due to sigatoka. The cultivars were

  4. Influence of genotype and age of explant source on the capacity for ...

    African Journals Online (AJOL)

    Influence of genotype and age of explant source on the capacity for somatic embryogenesis of two Cavendish banana cultivars (Musa acuminata Colla, AAA). M Youssef, A James, A Mayo-Mosqueda, JR Ku-Cauich, R Grijalva-Arango, RM Escobedo-GM ...

  5. Influence of genotype and age of explant source on the capacity for ...

    African Journals Online (AJOL)

    ONOS

    2010-04-12

    Apr 12, 2010 ... The embryogenic capacities of flower explants from one- and two-week-old male inflorescence buds from Musa acuminata Cavendish, AAA, genotypes 'Williams' and 'Grand Naine' were investigated. Explants of hands with immature flowers were excised and induced for embryogenesis. Highly significant ...

  6. SU-E-T-447: Evaluation of the Anisotropic Analytical Algorithm (AAA) Heterogeneity Correction Dose Calculation in Flattened and Flattening- Filter-Free (FFF) Beams for High Energy X-Ray Beams Using the Radiological Physics Center (RPC) Lung Phantom.

    Science.gov (United States)

    Repchak, R; Molineu, A; Popple, R; Kry, S; Howell, R; Followill, D

    2012-06-01

    Compare the accuracy of AAA heterogeneity corrected dose calculation algorithm for high energy x-ray beams (>10 MV) for flattened and FFF beams using RPC anthropomorphic thorax phantom. Six static beam SBRT treatment plans were created using the Varian Eclipse treatment planning system (TPS) AAA v.8.9.08 heterogeneity correction algorithm. Two flattened beam plans (6 MV and 18 MV) and four other plans (6 MV, 6 MV FFF, 10 MV FFF and 15 MV) were delivered using a Clinac 21EX and TrueBeam STx, respectively. Prescription dose/coverage, 6 Gy to 95% PTV, and constraints were the same for all plans. The phantom contained radiochromic films in the 3 major planes and TLDs in the heart, spine, and tumor. Point doses and 2D dose distributions were exported from the Eclipse TPS and compared with the measured doses. The gamma index analysis evaluation criteria of ±5% dose to agreement and 3 mm distance to agreement was used. TLD to TPS tumor point dose ratios were 0.971±0.006(6MV) and 0.957±0.002(6MV), 0.995±0.005(15MV), 1.114±0.006(18MV), and 0.957±0.003(6MV FFF), 0.974±0.011(10MV FFF) for the six plans. Using ±5%/3mm gamma analysis criteria, the average passing rates for all three films were 96.3% and 95.5%, 97.4%, 66.1%, 93.7%, and 96.3% for the 6 MV, 6 MV, 15 MV, 18 MV, 6 MV FFF, and 10 MV FFF plans, respectively. Dose profiles were also evaluated. The current RPC credentialing criteria are: RPC/Inst. tumor dose ratio of 0.97±0.05 and 85% of the pixels in each film plane must pass a ±5%/5mm gamma index analysis. These data demonstrate that the AAA heterogeneity correction dose calculation algorithm is accurate for photon energies in 6-15 MV range for flattened and FFF beams. Heterogeneity corrected dose calculations for photon energies >15 MV were not accurate. Work supported by grants CA10953 and CA81647 (NCI, DHHS). © 2012 American Association of Physicists in Medicine.

  7. In vitro micropropagation of Musa sapientum L. (Cavendish Dwarf)

    African Journals Online (AJOL)

    Administrator

    2007-05-02

    May 2, 2007 ... combination. Further multiplication of shoots required habituation of cultures up to 3 passages of 21 days each on the same medium after establishment of culture and initiation of shoot buds. Thereafter 3- fold multiplication rate was achieved during every subculture. For rooting the shoots were excised and.

  8. MULTIPLICACIÓN DE HONGOS MICORRIZA ARBUSCULAR (H.M.A Y EFECTO DE LA MICORRIZACIÓN EN PLANTAS MICROPROPAGADAS DE BANANO (Musa AAA cv. Gran Enano (Musaceae MULTIPLICATION OF ARBUSCULAR MYCORRHIZAE FUNGI (AMF AND MYCORRHIZATION EFFECT IN MICROPROPAGATED PLANTS OF BANANA (Musa AAA cv. ‘Gran Enano’ (Musaceae

    Directory of Open Access Journals (Sweden)

    Carmen Elena Usuga Osorio

    2008-06-01

    Full Text Available Se evaluó el proceso de multiplicación de hongos que forman micorriza arbuscular (HMA, para lo cual se usaron diferentes tipos de inóculos entre ellos nativos de agroecosistemas bananeros del Urabá (Antioquia-Colombia, en sustrato sólido, con diferentes plantas hospedadoras y la infectividad y efectividad sobre plantas de banano (Musa AAA cv. Gran Enano. La colonización micorrizal promedio general de los HMA a las plantas trampa fue de 37,76 ± 21,86 %, con respecto a este porcentaje, las plantas B (Brachiaria decumbens y S (Sorgum vulgare fueron las que más favorecieron la simbiosis. Teniendo en cuenta el sustrato, el S2 (Arena 50 - suelo 50 y el S6 (Vermiculita 50-suelo 50 permitieron expresiones significativamente mayores respecto a los demás. El Sorgum vulgare y Pueraria phaseoloides y en el sustrato S1 (Arena 30 - suelo 70, se encontró un mayor número de esporas. La combinación planta-sustrato que más favoreció la asociación fue la planta trampa B en los sustratos S2 y S4 (cascarilla de arroz 50-suelo50 y la producción de esporas fueron las plantas K y S en el sustrato S1. La asociación micorrícica general en plantas de banano provenientes de cultivo de tejidos fue de 48,74 ± 30,44. No se encontraron diferencias significativas (P > 0,05 entre plantas de cero días con plantas de 30 de aclimatadas. Los inóculos que significativamente favorecieron la asociación fueron los provenientes de agroecosistemas bananeros al compararse con el inóculo comercial y el proveniente de ecosistemas naturales del Urabá. El mayor peso seco foliar y radical se encontró en plántulas de banano inoculadas con I5 (Inóculo proveniente de agroecosistema bananeros de la zona de estudio. Para las variables de crecimiento no se encontraron diferencias.The process of multiplication of arbuscular mycorrhizae fungi (AMF from indigenous banana agro-environments from Urabá (Antioquia - Colombia was evaluated, using solid substrate, with different

  9. Caracterización física, morfológica y evaluación de las curvas de empastamiento de musáceas (Musa spp.

    Directory of Open Access Journals (Sweden)

    Javier Darío Hoyos-Leyva

    2012-07-01

    Full Text Available Se caracterizaron veinte variedades de musáceas de diferente composición genética: AB, BB, AAA, AAB, ABB, AAAA y AAAB, del Banco de Germoplasma existente en la hacienda Las Vegas, de Fedeplátano, Chinchiná (1360 m.s.n.m., 4° 58' N y 75° 20' O, Colombia. La caracterización incluyó propiedades físicas como peso, diámetro, longitud, materia seca y porcentaje de cáscara del fruto y propiedades funcionales como harinas y almidones. El análisis de componentes principales (ACP mostró que las variedades de plátano se diferencian por su mayor tamaño (peso, longitud y diámetro. M. B. Tani, ICAFHIA 110, Saba, y los plátanos del subgrupo Bluggoe tuvieron altos porcentajes de cáscara. Entre los demás clones no se observaron diferencian entre sí. Los plátanos de cocción del subgrupo Plantain presentaron el mayor contenido de materia seca. Bocadillo Chileno e híbridos postre (exceptuando FHIA-1, presentaron mayor contenido de fracción comestible frente a las demás variedades. La temperatura de inicio de gelatinización de las harinas en el RVA varió entre 66.58 °C para la variedad Bocadillo Chileno y 75.21 °C para Mbindi. La viscosidad máxima varió entre 441.57 y 1837.17 cP para las variedades Tafetán Rojo y Dwarf Cavendish, respectivamente. La facilidad de cocción varió entre 2.76 min en Bocadillo Chileno y 7.55 min en Gros Michel Guayabo. La temperatura de inicio de gelatinización de los almidones varió entre 65.58°C para Gros Michel Guayabo y 74.41°C en Tafetán Rojo. La variedad Yangambi Km3 presentó la viscosidad máxima a 483.24 cP e Indio a 1958.44cP. La variedad Mbindi presentó la mayor facilidad de cocción (1.91 min mientras que FHIA-1 presentó el mayor tiempo (9.49 min.

  10. Efficiency of boron application in an Oxisol cultivated with banana in the Central Amazon

    Directory of Open Access Journals (Sweden)

    Adônis Moreira

    2010-12-01

    Full Text Available In the Amazon region, there is no information on the fertilization of banana plants with boron (B. Besides this, the extractant (hot water currently used to test B concentrations has many limitations. The aim of this work was to study the effect of B on the fruit yield and quality of banana plants of the Cavendish (AAA sub-group, grown in dystrophic Yellow Latosol (Oxisol or Xanthic Ferralsol, in the Amazonas State, Brazil. The experimental design was completely randomized split plot in a 4 x 2 factorial scheme, composed of four B rates (0, 4, 8 and 12 kg ha-1 and two harvest cycles (sub-treatments, with four replicates. The B availability in the soil was determined by three extractants: Mehlich 3, hot water and KCl 1.0 mol L-1. The application of B influences the fruit yield, pulp/peel ratio, pulp resistance and B content in the leaves and fruits. The KCl 1.0 mol L-1 extractant was similar to the hot water in the evaluation of available B. To obtain maximum yield, it is necessary to apply 4.1 and 6.1 kg ha-1 of B in the first and second cycles, respectively.Na Amazônia não existem informações sobre adubação com boro (B na bananeira, além disso, o extrator água quente, que é atualmente o mais utilizado, apresenta inúmeras limitações. O objetivo deste trabalho foi estudar o efeito do B sobre a produção e qualidade dos frutos da bananeira do subgrupo Cavendish (AAA, cultivada em Latossolo Amarelo distrófico, no Estado do Amazonas, Brasil. O delineamento experimental utilizado foi o inteiramente casualizado em parcela subdividida em esquema fatorial 4 x 2, constituído por quatro doses de B (0, 4, 8 e 12 kg ha-1 e dois ciclos de colheita - sub-parcelas (primeiro e segundo ciclo, com quatro repetições. A disponibilidade de B no solo foi determinada pelos extratores Mehlich 3, água quente e KCl 1,0 mol L-1. A aplicação de B influenciou a produção, relação polpa e casca, resistência da polpa e o teor de B nas folhas e nos

  11. MANUTENÇÃO DE FOLHAS ATIVAS EM BANANEIRA-'NANICÃO' POR MEIO DO MANEJO DAS ADUBAÇÕES NITROGENADA E POTÁSSICA E DA IRRIGAÇÃO IMPROVING LIFE SPAN OF THE BANANA LEAVES THROUGH NITROGEN AND POTASSIUM FERTILIZATION AND IRRIGATION

    Directory of Open Access Journals (Sweden)

    LUIZ ANTONIO JUNQUEIRA TEIXEIRA

    2001-12-01

    Full Text Available Realizou-se um experimento de campo, em Jaboticabal-SP, com o objetivo de estudar a resposta da bananeira (Musa AAA subgrupo Cavendish-'Nanicão' à adubação nitrogenada e potássica, sob irrigação e sequeiro, durante duas safras. Empregou-se o delineamento experimental de blocos ao acaso, com os tratamentos em parcelas subdivididas, sendo as parcelas principais constituídas por dois regimes hídricos: irrigado (microaspersão e sequeiro, e as subparcelas, pelas combinações de quatro doses de N (0; 200; 400 e 800 kg ha-1de N e quatro de K (0; 300; 600 e 900 kg ha-1de K2O. O bananal foi cultivado de acordo com as recomendações atuais, tomando-se cuidados especiais com o controle preventivo de sigatoca-amarela e com o manejo da irrigação. Por meio da análise do número de folhas ativas (>50% da área verde nas épocas da emissão da inflorescência (NFE e da colheita (NFC, do índice de durabilidade foliar (IDF=NFC¸NFE´100 e dos teores de N e K na folha-índice, avaliaram-se os efeitos da irrigação e da aplicação de doses crescentes de N e K sobre as condições das folhas. Nos dois ciclos de cultivo, houve efeito da adubação potássica e da irrigação sobre o estado das folhas (pA field experiment was carried out in São Paulo State, Brazil, with the objective of investigating the response of 'Nanicão' banana (Musa AAA Cavendish subgroup to nitrogen and potassium fertilization, under irrigated and non-irrigated conditions, during two crop seasons. A split-plot design was used with irrigation (micro-sprinkler and no irrigation applied to main plots and a combination of four rates of N (0, 200, 400 and 800 kg N ha-1 and K (0, 300, 600 and 900 kg K2O ha-1 as the sub-plots treatments. The area was managed according to regional recommendations; special attention was paid to disease control and irrigation management. The effects of treatments on life span of leaves were assessed counting leaves at flowering (NFE and at bunch

  12. Horizons of Physics ______ .AA~AAA

    Indian Academy of Sciences (India)

    out by the Indian Association of Physics. Teachers. The series, addressed to students and teachers, is devoted to physics teaching at the tertiary level. It aims to enhance the knowledge and vision of the teachers and let students know what is happening at the forefront of different areas of physics. These volumes could also ...

  13. AA~AAA __ ------ v VVVV v

    Indian Academy of Sciences (India)

    and Anne-Marie Perrein In Metz, France. He entered the Ecole Polytechnique, Paris, in 1807 but lost a year because of poor health. Among his teachers was Gaspard Monge (1746-1818) who is credited with the invention of descriptive geometry. Poncelet joined the Corps of military engineers in. 1810 and was called upon ...

  14. AA~AAA ______ __ v VVVV v

    Indian Academy of Sciences (India)

    1997-12-05

    Dec 5, 1997 ... Providence, RI - Prime numbers are the most basic objects in mathematics. They also are among the most mysterious, for after centuries of study, the structure of the set of prime numbers is still not well understood. Describing the distribution of primes is at the heart of much mathematics and has many.

  15. (EAHB-AAA) cultivars to drought stress

    African Journals Online (AJOL)

    Banana (Musa spp.) yields are estimated at 5-30 t ha-1yr-1, lower than the potential 60 t ha-1yr-1, with the cause being drought stress. Much evidence among stakeholders shows little understanding about banana cultivar sensitivity, escape and avoidance mechanisms to drought due to un-attempted measures of retaining ...

  16. Mammalian class E Vps proteins, SBP1 and mVps2/CHMP2A, interact with and regulate the function of an AAA-ATPase SKD1/Vps4B.

    Science.gov (United States)

    Fujita, Hideaki; Umezuki, Yusuke; Imamura, Kanako; Ishikawa, Daisuke; Uchimura, Seiko; Nara, Atsuki; Yoshimori, Tamotsu; Hayashizaki, Yoshihide; Kawai, Jun; Ishidoh, Kazumi; Tanaka, Yoshitaka; Himeno, Masaru

    2004-06-15

    SKD1 belongs to the AAA-ATPase family and is one of the mammalian class E Vps (vacuolar protein sorting) proteins. Previously we have reported that the overexpression of an ATPase activity-deficient form of SKD1 (suppressor of potassium transport growth defect), SKD1(E235Q), leads the perturbation of membrane transport through endosomes and lysosomes, however, the molecular mechanism behind the action of SKD1 is poorly understood. We have identified two SKD1-binding proteins, SBP1 and mVps2, by yeast two-hybrid screening and we assign them as mammalian class E Vps proteins. The primary sequence of SBP1 indicates 22.5% identity with that of Vta1p from Saccharomyces cerevisiae, which was recently identified as a novel class E Vps protein binding to Vps4p. In fact, SBP1 binds directly to SKD1 through its C-terminal region (198-309). Endogenous SBP1 is exclusively localized to cytosol, however it is redirected to an aberrant endosomal structure, the E235Q compartment, in the cells expressing SKD1(E235Q). The ATPase activity of SKD1 regulates both the membrane association of, and assembly of, a large hetero-oligomer protein complex, containing SBP1, which is potentially involved in membrane transport through endosomes and lysosomes. The N-terminal half (1-157) of human SBP1 is identical to lyst-interacting protein 5 and intriguingly, SKD1 ATPase activity significantly influences the membrane association of lyst protein. The SKD1-SBP1 complex, together with lyst protein, may function in endosomal membrane transport. A primary sequence of mVps2, a mouse homologue of human CHMP2A/BC-2, indicates 44.4% identity with Vps2p/Did4p/Chm2p from Saccharomyces cerevisiae. mVps2 also interacts with SKD1 and is localized to the E235Q compartment. Intriguingly, the N-terminal coiled-coil region of mVps2 is required for the formation of the E235Q compartment but not for binding to SKD1. We propose that both SBP1 and mVps2 regulate SKD1 function in mammalian cells.

  17. Estudo da interação Musa acuminata-Meloidogyne incógnita

    OpenAIRE

    Niño Castañeda, Nancy Eunice

    2016-01-01

    Na cultura da bananeira (Musa spp.) o nematoide das galhas Meloidogyne incognita é uma das espécies predominantes principalmente no subgrupo Cavendish, causando perdas consideráveis em algumas regiões do Brasil. Meloidogyne ncognita é também considerado um dos fitoparasitas de ampla importância na agricultura mundial por sua adaptabilidade ao ambiente e ampla gama de hospedeiras. Com as limitações do melhoramento convencional no desenvolvimento de variedades resistentes de bananeiras a nemato...

  18. EFECTO DE LA INMERSIÓN EN AGUA CALIENTE SOBRE LA SECRECIÓN DE LÁTEX POR LA CORONA DE GAJOS RECIÉN CONFORMADOS DE FRUTOS DE BANANO

    Directory of Open Access Journals (Sweden)

    Maricruz Ramírez

    2011-01-01

    Full Text Available Con el objetivo de evaluar el efecto de la temperatura del agua y el tiempo de inmersión sobre la secreción de látex por la corona de gajos recién conformados de frutos de banano, se realizaron 2 experimentos con racimos de 12 semanas de edad (floración-cosecha del cv. Valery (Musa AAA, subgrupo Cavendish. En el experimento 1 se evaluaron 4 temperaturas del agua: 25, 35, 45 y 55ºC y, 4 tiempos de inmersión: 5, 10, 15 y 20 min en conjunto con un tratamiento testigo comercial. En el experimento 2 se evaluó unicamente la temperatura del agua a 45ºC y 2 tiempos de inmersión: 10 y 20 min. En este experimento se incluyó un tratamiento testigo comercial (frutos tomados de la línea de empaque de la finca y otro tratamiento testigo conformado por frutos cuyos gajos fueron empacados inmediatamente después de la separación del racimo (testigo absoluto. En ambos experimentos la inmersión de los frutos en agua caliente se realizó inmediatamente después que las manos fueron seccionadas del racimo y conformadas en gajos. En ambos experimentos no hubo maduración prematura durante el periodo de simulación de transporte que fue de 15 días. En el experimento 1 los tratamientos expuestos a 55ºC, presentaron daño severo de quemadura en la cáscara. En el experimento 2 no se afectó la firmeza (p>0,2685, aunque hubo diferencias estadísticas en el color de la cáscara (p0,0001. El tratamiento de inmersión de 45ºC por 10 min demostró que puede ser tan efectivo en la remoción del látex de la corona de gajos recién conformados de frutos de banano como el tratamiento comercial, basado en la inmersión sucesiva de los frutos en depósitos de agua circulante y la posterior aplicación de fungicidas y cicatrizantes.

  19. Ganhos de eficiência fertilizante em bananeira sob irrigação e fertirrigação

    Directory of Open Access Journals (Sweden)

    Luiz Antonio Junqueira Teixeira

    2011-03-01

    Full Text Available O aumento da eficiência fertilizante tem sido cada vez mais almejado nas boas práticas de manejo da adubação de culturas, não somente buscando reduzir custos de produção, mas também reduzir possíveis impactos ambientais. Com o objetivo de avaliar a eficiência dos fertilizantes nitrogenados e potássicos no cultivo da bananeira, foram realizados dois experimentos de campo com a cultivar 'Nanicão' (Musa AAA, subgrupo Cavendish, no Planalto do Estado de São Paulo, durante quatro ciclos de produção. Esta região caracteriza-se por estação chuvosa no verão e seca no inverno. No primeiro experimento, avaliou-se a eficiência da aplicação das doses de N: 0; 200; 400 e 800 kg ha-1 e de K: 0; 300; 600 e 900 kg ha-1 de K2O, em sistema de cultivo irrigado, comparado ao de sequeiro. No segundo experimento, estudou-se a eficiência da adubação com N e K aplicada por fertirrigação e de modo convencional via solo. Nos dois experimentos, a irrigação e a fertirrigação foram feitas por microaspersão, empregando-se como fontes de N e de K nitrato de amônio e cloreto de potássio, respectivamente. A eficiência dos fertilizantes foi estimada pela relação entre a massa dos frutos produzidos por unidade de nutriente aplicado. Para a média das doses empregadas e dos ciclos de produção, observou-se que a irrigação incrementou a eficiência da adubação em relação ao sequeiro, em aproximadamente 36 % e 32 %, respectivamente, para nitrogênio e potássio. A aplicação de nitrogênio e potássio via fertirrigação promoveu aumento de 36 % na eficiência fertilizante em relação à adubação sólida convencional, via solo. Incrementos na eficiência dos fertilizantes decorrentes da irrigação e da fertirrigação possibilitaram diminuir os gastos com o uso destes insumos.

  20. Diferenças entre bananas de cultivares Prata e Nanicão ao longo do amadurecimento: características físico-químicas e compostos voláteis Differences between Prata and Nanicão banana cultivars during ripening: physicochemical characteristics and volatile compounds

    Directory of Open Access Journals (Sweden)

    Baraquizio Braga do Nascimento Junior

    2008-09-01

    Full Text Available Bananas verdes [Nanicão (Musa sp., subgrupo Cavendish e Prata (Musa sp., subgrupo Prata] foram estudadas durante o seu amadurecimento. As propriedades físicas (firmeza, físico-químicas (pH, acidez total titulável e sólidos solúveis e químicas (açúcares, compostos fenólicos e voláteis foram analisadas e demonstraram diferenças significantes (p Fresh green bananas [Nanicão (Musa sp., subgroup Cavendish and Prata (Musa sp., subgroup Prata] were studied during their ripening. Physical (firmness, physicochemical (pH, total titrable acidity and soluble solids and chemical properties (sugars, phenolics and volatile compounds were analyzed and showed significant differences (p < 0.05. Prata presented higher values of phenolic compounds, soluble solids, sugars and firmness than Nanicão. A method to quantify the emission of esters was developed by cryogenic headspace and gas chromatography. Acetates, butyrates, isobutyrates and isovalerates were predominant. Prata produced a higher volatile concentration than Nanicão, except for acetates. In most cases, the amount of volatiles increased continuously until peel browning, followed by a decrease or a plateau.

  1. Ganhos de eficiência fertilizante em bananeira sob irrigação e fertirrigação Enhancing nutrient use efficiency in banana due to irrigation and fertigation

    Directory of Open Access Journals (Sweden)

    Luiz Antonio Junqueira Teixeira

    2011-03-01

    Full Text Available O aumento da eficiência fertilizante tem sido cada vez mais almejado nas boas práticas de manejo da adubação de culturas, não somente buscando reduzir custos de produção, mas também reduzir possíveis impactos ambientais. Com o objetivo de avaliar a eficiência dos fertilizantes nitrogenados e potássicos no cultivo da bananeira, foram realizados dois experimentos de campo com a cultivar 'Nanicão' (Musa AAA, subgrupo Cavendish, no Planalto do Estado de São Paulo, durante quatro ciclos de produção. Esta região caracteriza-se por estação chuvosa no verão e seca no inverno. No primeiro experimento, avaliou-se a eficiência da aplicação das doses de N: 0; 200; 400 e 800 kg ha-1 e de K: 0; 300; 600 e 900 kg ha-1 de K2O, em sistema de cultivo irrigado, comparado ao de sequeiro. No segundo experimento, estudou-se a eficiência da adubação com N e K aplicada por fertirrigação e de modo convencional via solo. Nos dois experimentos, a irrigação e a fertirrigação foram feitas por microaspersão, empregando-se como fontes de N e de K nitrato de amônio e cloreto de potássio, respectivamente. A eficiência dos fertilizantes foi estimada pela relação entre a massa dos frutos produzidos por unidade de nutriente aplicado. Para a média das doses empregadas e dos ciclos de produção, observou-se que a irrigação incrementou a eficiência da adubação em relação ao sequeiro, em aproximadamente 36 % e 32 %, respectivamente, para nitrogênio e potássio. A aplicação de nitrogênio e potássio via fertirrigação promoveu aumento de 36 % na eficiência fertilizante em relação à adubação sólida convencional, via solo. Incrementos na eficiência dos fertilizantes decorrentes da irrigação e da fertirrigação possibilitaram diminuir os gastos com o uso destes insumos.The best nutritional practices aim to increase nutrient use efficiency in order to reduce production costs and environmental impacts. In order to evaluate

  2. Malate synthase gene expression during fruit ripening of Cavendish banana (Musa acuminata cv. Williams).

    Science.gov (United States)

    Pua, Eng-Chong; Chandramouli, Sumana; Han, Ping; Liu, Pei

    2003-01-01

    Malate synthase (MS) is a key enzyme responsible for malic acid synthesis in the glyoxylate cycle, which functions to convert stored lipids to carbohydrates, by catalysing the glyoxylate condensation reaction with acetyl-CoA in the peroxisome. In this study, the cloning of an MS cDNA, designated MaMS-1, from the banana fruit is reported. MaMS-1 was 1801 bp in length encoding a single polypeptide of 556 amino acid residues. Sequence analysis revealed that MaMS-1 possessed the conserved catalytic domain and a putative peroxisomal targeting signal SK(I/L) at the carboxyl terminal. MaMS-1 also shared an extensive sequence homology (79-81.3%) with other plant MS homologues. Southern analysis indicated that MS might be present as multiple members in the banana genome. In Northern analysis, MaMS-1 was expressed specifically in ripening fruit tissue and transcripts were not detected in other organs such as roots, pseudostem, leaves, ovary, male flower, and in fruit at different stages of development. However, the transcript abundance in fruit was affected by stage of ripening, during which transcript was barely detectable at the early stage of ripening (FG and TY), but the level increased markedly in MG and in other fruits at advanced ripening stages. Furthermore, MaMS-1 expression in FG fruit could be stimulated by treatment with 1 microl l(-1) exogenous ethylene, but the stimulatory effect was abolished by the application of an ethylene inhibitor, norbornadiene. Results of this study clearly show that MS expression in banana fruit is temporally regulated during ripening and is ethylene-inducible.

  3. EIN3-like gene expression during fruit ripening of Cavendish banana (Musa acuminata cv. Grande naine).

    Science.gov (United States)

    Mbéguié-A-Mbéguié, Didier; Hubert, Olivier; Fils-Lycaon, Bernard; Chillet, Marc; Baurens, Franc-Christophe

    2008-06-01

    Ethylene signal transduction initiates with ethylene binding at receptor proteins and terminates in a transcription cascade involving the EIN3/EIL transcription factors. Here, we have isolated four cDNAs homologs of the Arabidopsis EIN3/EIN3-like gene, MA-EILs (Musa acuminata ethylene insensitive 3-like) from banana fruit. Sequence comparison with other banana EIL gene already registered in the database led us to conclude that, at this day, at least five different genes namely MA-EIL1, MA-EIL2/AB266318, MA-EIL3/AB266319, MA-EIL4/AB266320 and AB266321 exist in banana. Phylogenetic analyses included all banana EIL genes within a same cluster consisting of rice OsEILs, a monocotyledonous plant as banana. However, MA-EIL1, MA-EIL2/AB266318, MA-EIL4/AB266320 and AB266321 on one side, and MA-EIL3/AB266319 on the other side, belong to two distant subclusters. MA-EIL mRNAs were detected in all examined banana tissues but at lower level in peel than in pulp. According to tissues, MA-EIL genes were differentially regulated by ripening and ethylene in mature green fruit and wounding in old and young leaves. MA-EIL2/AB266318 was the unique ripening- and ethylene-induced gene; MA-EIL1, MA-EIL4/Ab266320 and AB266321 genes were downregulated, while MA-EIL3/AB266319 presented an unusual pattern of expression. Interestingly, a marked change was observed mainly in MA-EIL1 and MA-EIL3/Ab266319 mRNA accumulation concomitantly with changes in ethylene responsiveness of fruit. Upon wounding, the main effect was observed in MA-EIL4/AB266320 and AB266321 mRNA levels, which presented a markedly increase in both young and old leaves, respectively. Data presented in this study suggest the importance of a transcriptionally step control in the regulation of EIL genes during banana fruit ripening.

  4. Long noncoding RNAs that respond to Fusarium oxysporum infection in 'Cavendish' banana (Musa acuminata).

    Science.gov (United States)

    Li, Wenbin; Li, Chunqiang; Li, Shuxia; Peng, Ming

    2017-12-05

    Long noncoding RNAs (lncRNAs) are a class of genes that influence a variety of biological functions through acting as signal, decoy, guide, and scaffold molecules. In banana (Musa spp.), an important economic fruit crop, particularly in Southeast Asia, the wilt disease caused by Fusarium oxysporum f. sp. cubense (Foc), especially strain Foc TR4, is disastrous. In banana, how the biogenesis of these lncRNAs is regulated in response to pathogen infection is still largely unknown. In this study, strand-specific paired-end RNA sequencing of banana samples was performed on susceptible and resistant cultivars inoculated with Foc, with three biological replicates and at two different times after infection. Overall, 5,294 lncRNAs were predicted with high confidence through strict filtration, including long intergenic ncRNA (lincRNA) and antisense lncRNA. Differentially expressed (DE) lncRNAs were identified in response to Foc infection in the inoculated versus the mock-inoculated banana of the susceptible 'BX' and resistant 'NK' cultivars. Through KEGG, GO, and the expression levels of the DE lncRNAs, some DE lncRNAs were predicted to be involved in plant-pathogen interactions and phytohormone signal transduction. In this study, this catalog of lncRNAs and their properties will facilitate further experimental studies and functional classifications of these genes.

  5. Caracterización de propiedades mecánicas del banano (cavendish valery)

    National Research Council Canada - National Science Library

    Héctor José Ciro Velásquez; Mary Luz Montoya López; Leonidas de Jesús Millán Cardona

    2005-01-01

    .... Los resultados de las pruebas de fuerza de fractura a flexión y compresión mostraron que tanto el producto en su estado natural y su pulpa tienen una resistencia mayor a flexión que a compresión. Los modelos...

  6. Condição periodontal de um subgrupo populacional do município de Guarulhos, SP Periodontal status of a population subgroup from Guarulhos, SP

    Directory of Open Access Journals (Sweden)

    Fátima de Lourdes Bolzan Pion

    2006-09-01

    Full Text Available Este estudo transversal determinou a condição periodontal e sua associação com fatores de risco em uma amostra de conveniência de 588 indivíduos atendidos na Universidade Guarulhos, entre 1999 e 2003. Características geográficas, demográficas e comportamentais, parâmetros bucais e periodontais foram tabulados e analisados em SPSS 11.5. Os testes t Student e Qui-quadrado determinaram a significância (p 3,0 mm com fatores de risco (por exemplo: idade, sexo, fumo e comportamentais. A análise de regressão linear multivariada determinou a associação entre exposição aos fatores de risco e doença. A população estudada com média de idade de 36,1 ± 14,5 anos foi composta principalmente por mulheres (72,1% e minoria fumante (13,3%. Os valores médios de dentes ausentes e profundidade de sondagem (PS foram de 5,7 ± 5,9 dentes e 2,2 ± 0,8 mm, respectivamente. A prevalência de PS > 3,0mm (valor referência foi de 13,5%; e a distribuição regional da população de acordo com este critério foi: centro, 2,0%; zona oeste, 17,8%; zona leste, 38,0%; zona sul, 6,7% ; e zona norte, 35,5%. As freqüências médias dos índices de placa e sangramento a sondagem foram de 75,3% e 34,1%, respectivamente. A condição periodontal exibiu correlação com idade, fumo e presença de biofilme supragengival. Exceto pela última, estas variáveis também mostraram associação pela análise de regressão multivariada. A população estudada exibiu elevado grau de inflamação gengival e baixo percentual de bolsas periodontais, estando a condição periodontal associada à idade e ao hábito de fumar.This cross-sectional study determined the periodontal status and its association with risk factors in a convenience sample of 588 subjects seen at the dental clinic of Guarulhos University from 1999 to 2003. To reach the study objectives, geographic, demographic and behavioral characteristics, as well as, oral and periodontal parameters were tabulated and analyzed using SPSS. Chi-square and Student's t tests determined significance (p 3mm with risk (age, sex, smoking and behavioral factors. Multivariate linear regression evaluated the association between risk factors and periodontal disease. The study population presented a mean age of 36.1 ± 14.5 years, and was primarily comprised women (72.1%, while smokers were minority (13.3%. The mean number of missing teeth and periodontal probing depth (PPD were 5.7 ± 5.9 teeth and 2.2 ± 0.8 mm, respectively. The prevalence of PPD > 3.0mm was 13.5% and the regional distribution of the population following the same cut-off point was: center 2.0%, west zone 17.8%, east zone 38.0%, south zone 6.7%, and north zone 35.5%. The average indices for plaque and bleeding on probing were 75.3% and 34.1%, respectively. Periodontal status was correlated with age, smoking habits and presence of supragingival biofilm. However, the latter did not show association when entered on the multivariate analysis, in contrast with the others. The study population showed high levels of gingival inflammation and a low percentage of periodontal pockets. Periodontal status was associated with smoking habits and age.

  7. As atividades culturais e a sala de aula no grupo étnico Herero/Helelo do sul de Angola (subgrupo Mucubal e Muhimba

    Directory of Open Access Journals (Sweden)

    Alfredo Capitango de Lúcio

    2015-07-01

    Full Text Available The Herero/Helelo people of southern Angola, still keep their daily traditions alive . This study is guided through interviews with the elderly, visits to the group and also by the study of theories of Ubiratan D'Ambrosio’s Ethnomatematics program. It was possible through the observation of Mucubais and Himba subgroups allied to urge the preservation of the people’s roots and thinking of new ways and techniques for teachers to approach school knowledge within a contextualized framework closer to the reality of both groups. In particular, an emphasis was given to thinking about the relations between Art, Culture and Mathematics that the teacher can create and weave together in order to approach the reality experienced by young people and in the school. In this sense the research is justified by the need to learn about the current knowledge surrounding the group, in order to ensure their survival today without losing the culture.

  8. As atividades culturais e a sala de aula no grupo étnico Herero/Helelo do sul de Angola (subgrupo Mucubal e Muhimba

    Directory of Open Access Journals (Sweden)

    Alfredo Capitango de Lúcio

    2015-01-01

    Full Text Available The Herero/Helelo people of southern Angola, still keep their daily traditions alive . This study is guided through interviews with the elderly, visits to the group and also by the study of theories of Ubiratan D'Ambrosio’s Ethnomatematics program. It was possible through the observation of Mucubais and Himba subgroups allied to urge the preservation of the people’s roots and thinking of new ways and techniques for teachers to approach school knowledge within a contextualized framework closer to the reality of both groups. In particular, an emphasis was given to thinking about the relations between Art, Culture and Mathematics that the teacher can create and weave together in order to approach the reality experienced by young people and in the school. In this sense the research is justified by the need to learn about the current knowledge surrounding the group, in order to ensure their survival today without losing the culture.

  9. Tireoidite de Hashimoto pode estar associada a um subgrupo de pacientes de esclerose sistêmica com hipertensão pulmonar

    Directory of Open Access Journals (Sweden)

    Ciliana Cardoso B. Costa

    2014-10-01

    Full Text Available Introdução: Estudos recentes mostram associação entre tireoidites autoimunes e esclerose sistêmica (ES, e sugerem que essa condição pode interferir no fenótipo da ES. Entretanto, esses estudos avaliam as tireoidites autoimunes como um todo e nenhum deles aborda especificamente a tireoidite de Hashimoto (TH na ES. Objetivo: Investigar a presença de TH em pacientes com ES e sua possível associação com as manifestações da doença. Casuística e métodos: Manifestações clínicas de hipotireoidismo, TSH, T4 livre e anticorpos antitireoidanos (anti-TPO, anti TBG e TRAb foram pesquisados em 56 pacientes com ES. Pacientes com ES e TH foram comparados com pacientes com ES sem tireoidite. Resultados: TH foi observada em 19,64% dos pacientes com ES. Não foi encontrada associação entre a TH e as diferentes formas de doença ou com o perfil de autoanticorpos. Da mesma forma, não houve diferença entre a média do escore de Rodnan modificado e entre a presença de fenômeno de Raynaud, cicatrizes estelares, necrose digital, miosite, artrite, sintomas sicca, dismotilidade esofágica ou crise renal esclerodérmica quando os grupos foram comparados. Por outro lado, pacientes com TH apresentaram maior frequência de hipertensão pulmonar quando comparados a pacientes sem TH (66,6% vs 22,5%; p = 0,016. Conclusões: Na amostra de ES estudada, a TH está associada a uma maior prevalência de hipertensão pulmonar. Estudos de seguimento a longo prazo, englobando um número maior de pacientes com ES e TH, são necessários para confirmar esses dados.

  10. Dimensions of Usability: Cougaar, Aglets and Adaptive Agent Architecture (AAA)

    Energy Technology Data Exchange (ETDEWEB)

    Haack, Jereme N.; Cowell, Andrew J.; Gorton, Ian

    2004-06-20

    Research and development organizations are constantly evaluating new technologies in order to implement the next generation of advanced applications. At Pacific Northwest National Laboratory, agent technologies are perceived as an approach that can provide a competitive advantage in the construction of highly sophisticated software systems in a range of application areas. An important factor in selecting a successful agent architecture is the level of support it provides the developer in respect to developer support, examples of use, integration into current workflow and community support. Without such assistance, the developer must invest more effort into learning instead of applying the technology. Like many other applied research organizations, our staff are not dedicated to a single project and must acquire new skills as required, underlining the importance of being able to quickly become proficient. A project was instigated to evaluate three candidate agent toolkits across the dimensions of support they provide. This paper reports on the outcomes of this evaluation and provides insights into the agent technologies evaluated.

  11. Talks at AAAS Meeting: Women Scientists Still Behind.

    Science.gov (United States)

    Mandula, Barbara

    1991-01-01

    Summarizes three talks from an American Association for the Advancement of Science session entitled "Science Policy for Women in Science: Lessons from Historical and Contemporary Case Studies." Considers the average academic science rank of former postdoctoral fellows, national statistics on the types of obstacles encountered by women scientists,…

  12. Nuclear Forensics: Report of the AAAS/APS Working Group

    Science.gov (United States)

    Tannenbaum, Benn

    2008-04-01

    This report was produced by a Working Group of the American Physical Society's Program on Public Affairs in conjunction with the American Association for the Advancement of Science Center for Science, Technology and Security Policy. The primary purpose of this report is to provide the Congress, U.S. government agencies and other institutions involved in nuclear forensics with a clear unclassified statement of the state of the art of nuclear forensics; an assessment of its potential for preventing and identifying unattributed nuclear attacks; and identification of the policies, resources and human talent to fulfill that potential. In the course of its work, the Working Group observed that nuclear forensics was an essential part of the overall nuclear attribution process, which aims at identifying the origin of unidentified nuclear weapon material and, in the event, an unidentified nuclear explosion. A credible nuclear attribution capability and in particular nuclear forensics capability could deter essential participants in the chain of actors needed to smuggle nuclear weapon material or carry out a nuclear terrorist act and could also encourage states to better secure such materials and weapons. The Working Group also noted that nuclear forensics result would take some time to obtain and that neither internal coordination, nor international arrangements, nor the state of qualified personnel and needed equipment were currently enough to minimize the time needed to reach reliable results in an emergency such as would be caused by a nuclear detonation or the intercept of a weapon-size quantity of material. The Working Group assesses international cooperation to be crucial for forensics to work, since the material would likely come from inadequately documented foreign sources. In addition, international participation, if properly managed, could enhance the credibility of the deterrent effect of attribution. Finally the Working Group notes that the U.S. forensics capability involved a number of agencies and other groups that would have to cooperate rapidly in an emergency and that suitable exercises to ensure such cooperation were needed.

  13. Careers Other Than Academia EPA/AAAS Graduate Fellowship Expo

    Science.gov (United States)

    NCER invited Emilie to speak to the EPA STAR graduate fellows about her transition from graduate school into a postdoctoral position with the EPA. Discussion of what led Emilie to seek a position with the EPA, how she conducted her job search, and what qualities she thinks gradu...

  14. Antimicrobial Treatment to Impair Expansion of Abdominal Aortic Aneurysm (AAA)

    DEFF Research Database (Denmark)

    Bergqvist, David; Lindeman, Johannes H N; Lindholt, Jes Sanddal

    2013-01-01

    Antimicrobial treatment to attenuate expansion of abdominal aortic aneurysm has been suggested, especially with the focus on Chlamydophila. In this systematic literature review only four randomized trials were identified. In two small studies there is an indication of an effect of roxithromycin. ...

  15. The 40th AAAS Gordon Conference on nuclear chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1991-06-27

    I am pleased to speak at the Fortieth Gordon Conference on Nuclear Chemistry. I served as Chairman of the first Gordon Conference on Nuclear Chemistry held June 23--27, 1952, at New Hampton, New Hampshire. In my remarks, during which I shall quote from my journal, I shall describe some of the background leading up to the first Gordon Conference on Nuclear Chemistry and my attendance at the first seven Gordon Conferences during the period 1952 through 1958. I shall also quote my description of my appearance as the featured speaker at the Silver Anniversary of the Gordon Research Conferences on December 27, 1956 held at the Commodore Hotel in New York City. I shall begin with reference to my participation in the predecessor to the Gordon Conferences, the Gibson Island Research Conferences 45 years ago, on Thursday, June 20, 1946, as a speaker. This was 15 years after the start of these conferences in 1931. Neil Gordon played a leading role in these conferences, which were named (in 1948) in his honor -- the Gordon Research Conferences -- soon after they were moved to Colby Junior College, New London, New Hampshire in 1947. W. George Parks became Director in 1947, Alexander Cruickshank became Assistant Director in 1947 and Director in 1968.

  16. Expression of a ripening-related cytochrome P450 cDNA in Cavendish banana (Musa acuminata cv. Williams).

    Science.gov (United States)

    Pua, Eng-Chong; Lee, Yi-Chuan

    2003-02-13

    As part of a study to understand the molecular basis of fruit ripening, this study reports the isolation and characterization of a banana cytochrome P450 (P450) cDNA, designated as MAP450-1, which was associated with fruit ripening of banana. MAP450-1 encoded a single polypeptide of 507 amino acid residues that shared an overall identity of 27-45% with that of several plant P450s, among which MAP450-1 was most related phylogenetically to the avocado P450 CYP71A1. The polypeptide that possessed residue domains conserved in all P450s was classified as CYP71N1. Expression of CYP71N1 varied greatly between banana organs. Transcripts were detected only in peel and pulp of the ripening fruit and not in unripe fruit tissues at all developmental stages or other organs (root, leaf, ovary and flower). During ripening, transcripts were barely detectable in pre-climacteric and climacteric fruits but, as ripening progressed, they began to accumulate and reached a maximum in post-climacteric fruits. CYP71N1 expression in pre-climacteric fruit could be upregulated by exogenous application of ethylene (1-5 ppm) and treatment of overripe fruit with exogenous sucrose (50-300 mM) but not glucose downregulated the expression. These results indicate that P450s may not play a role in fruit development and its expression is associated with ripening, which may be regulated, in part, by ethylene and/or sucrose, at the transcript level.

  17. PENGARUH KONSENTRASI NAA DAN BAP TERHADAP PERTUMBUHAN TUNAS EKSPLAN TANAMAN PISANG CAVENDISH (Musa paradisiaca L. MELALUI KULTUR IN VITRO

    Directory of Open Access Journals (Sweden)

    Saktiyono Sigit Tri Pamungkas

    2015-12-01

    Full Text Available The objectives of this research were to find the optimized combination micropropagation technique of Pisang “Cavendish” using Napthaleneacetic acid (NAA and Benzylaminopurin (BAP on culture in vitro. The research was conducted in Balai Benih Induk Hortikultura laboratorium (270 m upper sea level Salaman, Magelang, Central Java from November 2008 - Januari 2009. Design used was Complete Randomized Design. Experimental factor were concentration of NAA and BAP. NAA concentration comparised four levels (0, 1, 2, and 3 ppm. BAP concentration comparised four levels (0, 3, 6, and 9 ppm. Obtained data was analyzed by F test, when significantly different then followed by LSD test with 5% level. Observed variables is longest roots, total of buds, and total of roots. Statistic analysis result showed that concentration of BAP have significant effect on longest roots. Concentration 0 ppm of BAP (B0 yielding optimalized on longest root ( 8,3 cm. Concentration of NAA have significant effect on longest roots. Concentration 2 ppm of NAA (N2 yielding optimalized on longest root (6,0 cm. Concentration of BAP have significant effect on total buds. Concentration 9 ppm of BAP (B3 yielding optimalized on total of buds (2,5.

  18. Tendências da epidemia de AIDS entre subgrupos sob maior risco no Brasil, 1980-2004 Trends in the AIDS epidemic in groups at highest risk in Brazil, 1980-2004

    Directory of Open Access Journals (Sweden)

    Aristides Barbosa Júnior

    2009-04-01

    Full Text Available O presente trabalho tem por objetivo apresentar as tendências da epidemia de AIDS em grupos populacionais sob maior risco no Brasil. A técnica de análise discriminante foi utilizada para reclassificação dos casos masculinos com categoria de exposição ignorada em um dos três grupos homens que fazem sexo com homens (HSH, usuários de drogas injetáveis (UDI ou heterossexuais. Foram estimadas as taxas de incidência de AIDS por sexo e categoria de exposição no período 1980-2004. No período 1980-1988, os casos homossexuais ou bissexuais masculinos correspondiam a 63,6% dos casos, e a proporção de mulheres era de 10%. Posteriormente, há um decréscimo importante no papel desempenhado pelos HSH e ocorre um acréscimo nas outras categorias de exposição. Apesar das tendências de decréscimo para as incidências de casos HSH e UDI e acréscimo entre os heterossexuais masculinos e as mulheres, quando as taxas de incidência são comparadas o risco é maior entre os HSH e UDI. A análise da dinâmica da epidemia de AIDS no Brasil mostra a importância dos grupos HSH e UDI masculinos enquanto grupos de risco diferenciado.The objective of this paper was to present the trends in the AIDS epidemic in the population groups at highest risk in Brazil. Discriminant analysis was used to reclassify cases with unknown risk into one of the three groups: IDU (injecting drug users, MSM (men who have sex with men, and heterosexuals. AIDS incidence rates by gender and exposure category were estimated for the period 1980-2004. In 1980-1988, 63.6% of AIDS cases were homosexual or bisexual males and 10% were females. Since 1988, there has been a decrease in the proportion of MSM and an increase in the other categories. Despite the incidence trends observed by exposure category, when the incidence rates were compared, the risk was much higher among MSM as compared to heterosexuals. Analysis of the AIDS epidemic dynamics in Brazil emphasizes the importance of MSM and male IDU as higher-risk groups.

  19. Bananas--physiology and biochemistry of storage and ripening for optimum quality.

    Science.gov (United States)

    Marriott, J

    1980-01-01

    Bananas (Musa spp.) are a major food crop of the humid tropics, and although edible cultivars are diverse and numerous, most of our knowledge of the physiology and biochemistry of these fruits relates to a few dessert cultivars of the AAA type, mainly of the Cavendish subgroup, which dominate the export trade between tropical and temperate zones. The preclimacteric period of banana fruits after harvest determines their transportability, and its duration is very sensitive to changes in fruit maturity, storage temperature, ethylene concentration, and other factors; progress in measurement and resolution of each of these effects is described. Changes in composition of the ripening fruits, especially in the development of flavor volatiles, are reviewed. Progress in understanding the integration of the biochemical changes controlling ripening in banana fruits is discussed. Recent work on storage, ripening, and factors relating to sensory assessment of fruit quality is discussed for cultivars of Musa types not used in major export trades.

  20. AAA Rated: Unscrambling the Bond Market. RUSA Occasional Papers, Number 22.

    Science.gov (United States)

    LaFaro, Lydia E., Ed.

    Many people are investing these days, but many librarians, especially non-business librarians, are uncomfortable helping patrons with questions on the subject. This reference guide gives librarians the knowledge and confidence to assist patrons in identifying the correct information in a critical but little understood investment area--the bond…

  1. Reduced-Order Observer Model for Antiaircraft Artillery (AAA) Tracker Response

    Science.gov (United States)

    1979-08-01

    basic concept of this research and for many valuable discussions. 2. TABLE OF CONTENTS Section Page I INTRODUCTION 6 II REDUCED-ORDER OBSERVER MODEL...stochastic part of the gunner model. These randomness sources include the modelling error, the observation error, the neuromotor noise, etc. Mathema

  2. Tobacco arabinogalactan protein NtEPc can promote banana (Musa AAA) somatic embryogenesis.

    Science.gov (United States)

    Shu, H; Xu, L; Li, Z; Li, J; Jin, Z; Chang, S

    2014-12-01

    Banana is an important tropical fruit worldwide. Parthenocarpy and female sterility made it impossible to improve banana varieties through common hybridization. Genetic transformation for banana improvement is imperative. But the low rate that banana embryogenic callus was induced made the transformation cannot be performed in many laboratories. Finding ways to promote banana somatic embryogenesis is critical for banana genetic transformation. After tobacco arabinogalactan protein gene NtEPc was transformed into Escherichia coli (DE3), the recombinant protein was purified and filter-sterilized. A series of the sterilized protein was added into tissue culture medium. It was found that the number of banana immature male flowers developing embryogenic calli increased significantly in the presence of NtEPc protein compared with the effect of the control medium. Among the treatments, explants cultured on medium containing 10 mg/l of NtEPc protein had the highest chance to develop embryogenic calli. The percentage of lines that developed embryogenic calli on this medium was about 12.5 %. These demonstrated that NtEPc protein can be used to promote banana embryogenesis. This is the first paper that reported that foreign arabinogalactan protein (AGP) could be used to improve banana somatic embryogenesis.

  3. Accumulation of dry matter and nitrogen contents in banana 'Williams' (Musa AAA plants in Uraba, Colombia

    Directory of Open Access Journals (Sweden)

    Jaime Torres B.

    2014-12-01

    Full Text Available Banana production for export in the Uraba region of Colombia represents economic and social benefits for the country and demands improved agronomic management practices, especially for fertilization. The objective of this research was to evaluate the effect of different doses of nitrogen on crop development during two production cycles in order to adjust fertilizer recommendations to values consistent with plant requirements. Sixth-generation banana Williams plants were subjected to five treatments of nitrogen doses at five stages of development and during two production cycles. Two linear models, according to the phenological stage and vegetative structures, were used, assessing the variables of dry weight and nitrogen content. The statistical differences found for the effect of the nitrogen dose on the dry matter accumulation per plant organ and nitrogen content in the plants for the development stages per production cycle and between the cycles allowed for the selection of the 321.8 and 483 kg ha-1 ha of nitrogen doses as the better ones. In this research, the nitrogen dose of 483 kg ha-1 was the most successful at obtaining the highest nitrogen content in the plants. This research confirmed the practical utility of nutrient extraction curves because they allowed for the selection of the fertilizer dose with the best response.

  4. An Instructors Guide to Water Pollution. Test Edition. AAAS Study Guides on Contemporary Problems, No. 5.

    Science.gov (United States)

    Kidd, David E.

    This is one of several study guides on contemporary problems produced by the American Association for the Advancement of Science with support of the National Science Foundation. This study guide on water pollution includes the following units: (1) Overview of World Pollution; (2) History, Definition, Criteria; (3) Ecosystem Theory; (4) Biological…

  5. The Ethnology of Traditional and Complex Societies. Test Edition. AAAS Study Guides on Contemporary Problems.

    Science.gov (United States)

    Simic, Andrei

    This is one of several study guides on contemporary problems produced by the American Association for the Advancement of Science with support of the National Science Foundation. This guide focuses on the ethnology of traditional and complex societies. Part I, Simple and Complex Societies, includes three sections: (1) Introduction: Anthropologists…

  6. Advances in imaging and surveillance of AAA: when, how, how often?

    Science.gov (United States)

    Rudarakanchana, Nung; Powell, Janet T

    2013-01-01

    Despite rapid technological developments for imaging the aorta, ultrasonography remains the method of choice for abdominal aortic aneurysm screening and surveillance. Randomised trials, conducted in the 20th century, have provided convincing evidence in favour of screening men at age 65 years, or older. However, in the 21st century the prevalence of aneurysms in 65 year old men has fallen by more than half, probably because of lower smoking prevalence and better cardiovascular risk prevention: screening or rescreening at an older age may be helpful. A recent meta-analysis has provided good evidence for surveillance intervals, with the majority of patients with screen-detected aneurysms (up to 4.5 cm diameter) being safely managed with 3-year surveillance intervals. Even for larger aneurysms, annual surveillance intervals are likely to be acceptable. This would reduce the number of surveillance visits by approximately half. Copyright © 2013 Elsevier Inc. All rights reserved.

  7. The Hopelessly Compromised: Independent Games as a Movement against Mainstream AAA Video Games

    DEFF Research Database (Denmark)

    Juul, Jesper

    2016-01-01

    The last 10-15 years have seen the rise of a loosely defined independent games movement, often promoted as a more authentic type of video game than mainstream big budget video games (Juul 2014). For example, developer Dan Cook claims that “Indie games let me be a fan who is cheering on someone...... of the design and values of mainstream video games. As such, mainstream video games play the role of the morally and aesthetically compromised other, an other from which video games must be saved; an other that independent games are assumed to be rebelling against. In this paper I will analyze independent games...... as a number of specific (and sometimes contradictory) rejections of particular aspects of mainstream video game design. I am examining the game design of selected high-profile independent games, as well as game reviews and developer statement about their games. Here I am presenting general results...

  8. Isolation of Penicillium chrysogenum PEX1 and PEX6 encoding AAA proteins involved in peroxisome biogenesis

    NARCIS (Netherlands)

    Kiel, JAKW; Hilbrands, RE; Bovenberg, RAL; Veenhuis, M

    In Penicillium chrysogenum, key enzymes involved in the production of penicillin reside in peroxisomes. As a first step to understand the role of these organelles in penicillin biosynthesis, we set out to isolate the genes involved in peroxisome biogenesis. Here we report the cloning and

  9. Use of Banana (Musa acuminata Colla AAA) Peel Extract as an Antioxidant Source in Orange Juices.

    Science.gov (United States)

    Ortiz, Lucía; Dorta, Eva; Gloria Lobo, M; González-Mendoza, L Antonio; Díaz, Carlos; González, Mónica

    2017-03-01

    Using banana peel extract as an antioxidant in freshly squeezed orange juices and juices from concentrate was evaluated. Free radical scavenging capacity increased by adding banana peel extracts to both types of orange juice. In addition, remarkable increases in antioxidant capacity using 2,2'-azino-bis-(3-ethylbenzothiazoline)-6-sulfonic acid (ABTS) radical were observed when equal or greater than 5 mg of banana peel extract per ml of freshly squeezed juice was added. No clear effects were observed in the capacity to inhibit lipid peroxidation. Adding 5 mg banana peel extract per ml of orange juice did not substantially modify the physicochemical and sensory characteristics of either type of juice. However, undesirable changes in the sensory characteristics (in-mouth sensations and colour) were detected when equal or greater than 10 mg banana peel extract per ml of orange juice was added. These results confirm that banana peel is a promising natural additive that increases the capacity to scavenge free radicals of orange juice with acceptable sensory and physicochemical characteristics for the consumer.

  10. Formulation and evaluation of semisolid jelly produced by Musa acuminata Colla (AAA Group peels

    Directory of Open Access Journals (Sweden)

    Noor Azwani Mohd Rasidek

    2016-01-01

    Conclusions: TPC can be used as an indicator in assessing the antioxidant activity of fruits and vegetables. The present investigation reveals that TPC is mainly responsible for DPPH free radical scavenging capacity.

  11. Science, Science Signaling, and Science Translational Medicine – AAAS Special Collection on Cancer Research, March 2011

    Directory of Open Access Journals (Sweden)

    Forsythe, Katherine H.

    2011-10-01

    Full Text Available The National Cancer Act, signed in 1971, aimed to eliminate cancer deaths through a massive increase in research funding. The American Association for the Advancement of Science, the publisher of Science, Science Signaling, and Science Translational Medicine, observed the 40th anniversary of the Cancer Act in 2011, with special research articles and features, found in all three journals, on the state of cancer research 40 years later. This collection of articles explores both breakthroughs and the challenges in cancer research over the last four decades, and lets us know what we might expect in the future.

  12. AAA architectures applied in multi-domain IMS (IP Multimedia Subsystem)

    NARCIS (Netherlands)

    Ooms, W.S.; Karagiannis, G.; Deventer, M.O. van; Veldhuizen, J.

    2007-01-01

    There is a group of communication services that use resources from multiple domains in order to deliver their service. Authorization of the end-user is important for such services, because several domains are involved. There are no current solutions for delivering authentication, authorization and

  13. Responses of east African highland banana (EAHB-AAA) cultivars to ...

    African Journals Online (AJOL)

    ACSS

    yields are estimated at 5-30 t ha-1yr-1, lower than the potential 60 t ha-1yr-1, with the cause being drought .... minimum and maximum temperatures of. 15 and 31oC ..... DW=Dry Weight, PARL= Proportional Average Root Length, *means followed by the same letter within a column are not significantly different according to ...

  14. Pineapple juice and its fractions in enzymatic browning inhibition of banana [Musa (AAA group) Gros Michel].

    Science.gov (United States)

    Chaisakdanugull, Chitsuda; Theerakulkait, Chockchai; Wrolstad, Ronald E

    2007-05-16

    The effectiveness of pineapple juice in enzymatic browning inhibition was evaluated on the cut surface of banana slices. After storage of banana slices at 15 degrees C for 3 days, pineapple juice showed browning inhibition to a similar extent as 8 mM ascorbic acid but less than 4 mM sodium metabisulfite. Fractionation of pineapple juice by a solid-phase C18 cartridge revealed that the directly eluted fraction (DE fraction) inhibited banana polyphenol oxidase (PPO) about 100% when compared to the control. The DE fraction also showed more inhibitory effect than 8 mM ascorbic acid in enzymatic browning inhibition of banana puree during storage at 5 degrees C for 24 h. Further identification of the DE fraction by fractionation with ion exchange chromatography and confirmation using model systems indicated that malic acid and citric acid play an important role in the enzymatic browning inhibition of banana PPO.

  15. Accumulation of dry matter and nitrogen contents in banana 'Williams' (Musa AAA) plants in Uraba, Colombia

    National Research Council Canada - National Science Library

    Jaime Torres B; Jaiver Danilo Sánchez; Gerardo Cayón; Stanislav Magnitskiy; Aquiles Enrique Darghan

    2014-01-01

      Banana production for export in the Uraba region of Colombia represents economic and social benefits for the country and demands improved agronomic management practices, especially for fertilization...

  16. Introductory Chemistry Needs A Revolution. ACS and IUPAC and AAAS and ICUC Should Lead It

    Science.gov (United States)

    Hawkes, Stephen J.

    2005-01-01

    The standard curriculum for introductory chemistry does not reflect the needs of students, is enforced by custom and untenured teachers who deviate from it endanger prospects for tenure. Hence, revision of the introductory curriculum should involve research into actual needs and interests of students and should reflect what modern workers conceive…

  17. Diagnosis and perioperative management of ruptured AAA mimicking symptomatic groin hernia

    Directory of Open Access Journals (Sweden)

    Holger Jan Klein

    2016-01-01

    Conclusion: Computed Tomography Angiography (CTA remains the recommended diagnostic tool—for both safe diagnosis of the ruptured aneurysm and precise preoperative planning. Endovascular aortic repair of the RAAA—if feasible—is the treatment of choice. This rare form of RAAA manifestation should call physicians attention—especially in patients with known abdominal aortic aneurysms in their preceding medical history.

  18. A structural framework for replication origin opening by AAA plus initiation factors

    NARCIS (Netherlands)

    Duderstadt, Karl E.; Berger, James M.

    ATP-dependent initiation factors help process replication origins and coordinate replisome assembly to control the onset of DNA synthesis. Although the specific properties and regulatory mechanisms of initiator proteins can vary greatly between different organisms, certain nucleotide-binding

  19. Detectability of motions in AAA with ECG-gated CTA: A quantitative study

    NARCIS (Netherlands)

    Klein, Almar; Oostveen, Luuk J.; Greuter, Marcel J.W.; Hoogeveen, Yvonne; Schultze Kool, Leo J.; Slump, Cornelis H.; Renema, W. Klaas Jan

    2009-01-01

    Purpose: ECG-gated CT enables the visualization of motions caused by the beating of the heart. Although ECG gating is frequently used in cardiac CT imaging, this technique is also very promising for evaluating vessel wall motion of the aortic artery and the motions of (stent grafts inside) abdominal

  20. Gene expression analysis in Musa acuminata during compatible interactions with Meloidogyne incognita.

    Science.gov (United States)

    Castañeda, Nancy Eunice Niño; Alves, Gabriel Sergio Costa; Almeida, Rosane Mansan; Amorim, Edson Perito; Fortes Ferreira, Claudia; Togawa, Roberto Coiti; Costa, Marcos Mota Do Carmo; Grynberg, Priscila; Santos, Jansen Rodrigo Pereira; Cares, Juvenil Enrique; Miller, Robert Neil Gerard

    2017-03-01

    Endoparasitic root-knot nematodes (RKNs) ( Meloidogyne spp.) cause considerable losses in banana ( Musa spp.), with Meloidogyne incognita a predominant species in Cavendish sub-group bananas. This study investigates the root transcriptome in Musa acuminata genotypes 4297-06 (AA) and Cavendish Grande Naine (CAV; AAA) during early compatible interactions with M. incognita . Roots were analysed by brightfield light microscopy over a 35 d period to examine nematode penetration and morphological cell transformation. RNA samples were extracted 3, 7 and 10 days after inoculation (DAI) with nematode J2 juveniles, and cDNA libraries were sequenced using lllumina HiSeq technology. Sequences were mapped to the M. acuminata ssp. malaccensis var. Pahang genome sequence, differentially expressed genes (DEGs) identified and transcript representation determined by gene set enrichment and pathway mapping. Microscopic analysis revealed a life cycle of M. incognita completing in 24 d in CAV and 27 d in 4279-06. Comparable numbers of DEGs were up- and downregulated in each genotype, with potential involvement of many in early host defence responses involving reactive oxygen species and jasmonate/ethylene signalling. DEGs revealed concomitant auxin metabolism and cell wall modification processes likely to be involved in giant cell formation. Notable transcripts related to host defence included those coding for leucine-rich repeat receptor-like serine/threonine-protein kinases, peroxidases, thaumatin-like pathogenesis-related proteins, and DREB, ERF, MYB, NAC and WRKY transcription factors. Transcripts related to giant cell development included indole acetic acid-amido synthetase GH3.8 genes, involved in auxin metabolism, as well as genes encoding expansins and hydrolases, involved in cell wall modification. Expression analysis in M. acuminata during compatible interactions with RKNs provides insights into genes modulated during infection and giant cell formation. Increased

  1. Proporcionando acceso federado y SSO a servicios de internet mediante kerberos e infraestructuras AAA = Providing federated access and SSO to internet services by means of kerberos and AAA infrastructures

    OpenAIRE

    Pérez Méndez, Alejandro

    2015-01-01

    A día de hoy las federaciones de identidad para servicios web y para el acceso a la red están bastante asentadas y aceptadas. Pero, ¿qué ocurre con otros tipos de servicio que no soportan estas tecnologías? El objetivo de esta tesis es diseñar soluciones que permitan el establecimiento de federaciones de identidad más allá del Web, evitando los problemas que presentan las soluciones disponibles en el estado del arte. Para ello se han analizado y seleccionado un conjunto de tecnologías asocia...

  2. Dynamics of Growth and Development of Banana (Musa AAA Simmonds cvs. Gran Enano and Valery Dinámica del Crecimiento y Desarrollo del Banano (Musa AAA Simmonds cvs. Gran Enano y Valery

    Directory of Open Access Journals (Sweden)

    Ana María Martínez Acosta

    2011-12-01

    Full Text Available This research was conducted in the banana zone on Urabá (Colombia, whith cvs. Gran Enano and Valery. Since planting, each three to four leaves sprouted, three plants per variety were sampled, each corresponding to a repetition. These were separated into its different organs and the total dry matter was estimated. Each cv. was analyzed on a growth curve. The dry matter accumulation on both cvs. is adjusted to the typical sigmoid curve of the plant growth. In the exponential phase, the corm was the main source of assimilates for the development; while in the lineal and senescence phase, the pseudo-stem and leaves were the reservoir organs; when the bunch is formed, such reserves were sent to this drain. In general, while the development progressed, the vegetative organs did not show any dry matter lost, only reduction in the assimilates accumulation rate; unlike the bunch that from its emission kept a high rate, leading the fruit to represent, in the harvest season, almost 50% of the total dry matter of the plant.El estudio se realizó en la zona bananera de Urabá (Colombia; con los cvs. Gran Enano y Valery. A partir de la siembra, cada tres a cuatro hojas emitidas, se muestrearon tres plantas por cv., cada una correspondiente a una repetición. Estas se separaron en sus diferentes órganos y se estimó la materia seca total. Se analizó cada cv. a partir de curvas de crecimiento. La acumulación de materia seca en ambos cvs. se ajustó al modelo típico de la curva sigmoidea del crecimiento vegetal. En la fase exponencial, el cormo fue la principal fuente de asimilados para el desarrollo;mientras que en la fase lineal y de senescencia,el pseudotallo y hojas fueron órganos reservorio; al formarse el racimo, tales reservas fueron enviadas a ese sumidero. En general, a medida que avanzaba el desarrollo, los órganos vegetativos no presentaron pérdidas de materia seca, solo disminución en la tasa de acumulación de asimilados;a diferencia del racimo que desde su emisión mantuvo una tasa elevada, llevando a que al momento de la cosecha el fruto, representara cerca del 50% de la materia seca total de la planta.

  3. Effects of gamma radiation on banana 'nanica' (Musa sp., group AAA) irradiated in pre climacteric phase; Efeitos da radicao gama em banana 'nanica' (Musa sp., grupo AAA) irradiada na fase pre-climaterica

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Simone Faria [Escola Superior de Agricultura Luiz de Queiroz (ESALQ/USP), Piracicaba, SP (Brazil). Dept. de Agroindutria de Alimentos e Nutricao; Dionisio, Ana Paula [Universidade Estadual de Campinas (FEA/UNICAMP), SP (Brazil). Faculdade de Engenharia de Alimentos. Dept. de Ciencia de Alimentos; Walder, Julio Marcos Melges [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil). Lab. de Radioentomologia e Irradiacao de Alimentos

    2007-07-15

    The present work verified the effect of gamma radiation on physical and chemical parameters of banana 'nanica', analyzing possible alterations on the period of conservation and the possibility of commercial irradiation aiming the exportation. The results had demonstrated that the radiations had not produced effect on pH and total acidity. However, the bananas of the 'control group' and those that had received 0,75 kGy, had presented greater maturation degree and, radiated with 0,30 kGy, had presented greater firmness. In accordance with the results of the organoleptic analysis, can be perceived that the bananas most mature, especially of the 'control group', had had greater acceptance. The bananas of treatments 0,30 and 0,60 kGy had had minors notes for presenting minor maturation stadium. Knowing that the irradiation in adequate dose and fruits of good quality brings benefits to the storage and the process of exportation, we conclude that the dose most appropriate for the control of the maturation of the 'nanica' banana is 0,30 kGy. (author)

  4. Avaliação de genótipos de bananeira na região do baixo São Francisco, Sergipe Evaluation of banana genotypes in the low São Francisco river basin, Sergipe, Brazil

    Directory of Open Access Journals (Sweden)

    Ana da Silva Lédo

    2008-09-01

    Full Text Available Este trabalho teve como objetivo avaliar o desempenho de 20 genótipos de bananeira nas condições edafoclimáticas da região do Baixo São Francisco-SE. O experimento foi instalado em área experimental da Embrapa Tabuleiros Costeiros, no município de Propriá- SE. O delineamento foi em blocos ao acaso, com quatro repetições e três touceiras úteis por parcela. Foram avaliados caracteres de crescimento e produção no primeiro e segundo ciclos. Os híbridos PV42-53, PV42-68, PV42-85 e FHIA-02, devido ao bom desempenho com relação ao peso do cacho e peso médio do fruto, podem ser recomendados para cultivo no Baixo São Francisco. O híbrido FHIA-18 apresentou excelentes características agronômicas, sendo uma alternativa a cultivar Prata-Anã. Os híbridos Ambrósia e Bucaneiro podem ser indicados por apresentarem cachos grandes e sabor semelhante às bananas do subgrupo Cavendish. O híbrido YB42-07 tem potencial para ser lançado como cultivar em áreas de cultivo de banana Maçã.The main objective of this work was evaluated the performance of twenty genotypes of Musa sp., in the environmental conditions of the Low São Francisco River Basin, Propriá, SE, and Brazil. The experimental design was a randomized complete block with four replications and three useful plants per parcel. rowth and yield characteristics were analyzed during the first and second production cycles. Hybrids PV42-53, PV42-68, PV42-85 and FHIA-02 because of the bigger production and greater weight of the fruit, should be recommended for culture in the region. Hybrid FHIA-18 presented excellent agronomic characteristics, being an alternative to 'Prata Anã'. The hybrids Ambrosia and Buccaneer can be an alternative for Cavendish bananas, by showing great bunches and similar flavor. Hybrid YB42-07 could be an option for areas of 'Silk' banana culture in the region of the Low São Francisco River, having potential to be set up as cultivar.

  5. The hetero-hexameric nature of a chloroplast AAA+ FtsH protease contributes to its thermodynamic stability.

    Directory of Open Access Journals (Sweden)

    Ofer Moldavski

    Full Text Available FtsH is an evolutionary conserved membrane-bound metalloprotease complex. While in most prokaryotes FtsH is encoded by a single gene, multiple FtsH genes are found in eukaryotes. Genetic and biochemical data suggest that the Arabidopsis chloroplast FtsH is a hetero-hexamer. This raises the question why photosynthetic organisms require a heteromeric complex, whereas in most bacteria a homomeric one is sufficient. To gain structural information of the possible complexes, the Arabidopsis FtsH2 (type B and FtsH5 (type A were modeled. An in silico study with mixed models of FtsH2/5 suggests that heteromeric hexamer structure with ratio of 4:2 is more likely to exists. Specifically, calculation of the buried surface area at the interfaces between neighboring subunits revealed that a hetero-complex should be thermodynamically more stable than a homo-hexamer, due to the presence of additional hydrophobic and hydrophilic interactions. To biochemically assess this model, we generated Arabidopsis transgenic plants, expressing epitope-tagged FtsH2 and immuno-purified the protein. Mass-spectrometry analysis showed that FtsH2 is associated with FtsH1, FtsH5 and FtsH8. Interestingly, we found that 'type B' subunits (FtsH2 and FtsH8 were 2-3 fold more abundant than 'type A' (FtsH1 and FtsH5. The biochemical data corroborate the in silico model and suggest that the thylakoid FtsH hexamer is composed of two 'type A' and four 'type B' subunits.

  6. Developmental localization and the role of hydroxyproline rich glycoproteins during somatic embryogenesis of banana (Musa spp. AAA).

    Science.gov (United States)

    Xu, Chunxiang; Takáč, Tomáš; Burbach, Christian; Menzel, Diedrik; Samaj, Jozef

    2011-02-24

    Hydroxyproline rich glycoproteins (HRGPs) are implicated to have a role in many aspects of plant growth and development but there is limited knowledge about their localization and function during somatic embryogenesis of higher plants. In this study, the localization and function of hydroxyproline rich glycoproteins in embryogenic cells (ECs) and somatic embryos of banana were investigated by using immunobloting and immunocytochemistry with monoclonal JIM11 and JIM20 antibodies as well as by treatment with 3,4-dehydro-L-proline (3,4-DHP, an inhibitor of extensin biosynthesis), and by immunomodulation with the JIM11 antibody. Immunofluorescence labelling of JIM11 and JIM20 hydroxyproline rich glycoprotein epitopes was relatively weak in non-embryogenic cells (NECs), mainly on the edge of small cell aggregates. On the other hand, hydroxyproline rich glycoprotein epitopes were found to be enriched in early embryogenic cells as well as in various developmental stages of somatic embryos. Embryogenic cells (ECs), proembryos and globular embryos showed strong labelling of hydroxyproline rich glycoprotein epitopes, especially in their cell walls and outer surface layer, so-called extracellular matrix (ECM). This hydroxyproline rich glycoprotein signal at embryo surfaces decreased and/or fully disappeared during later developmental stages (e.g. pear-shaped and cotyledonary stages) of embryos. In these later developmental embryogenic stages, however, new prominent hydroxyproline rich glycoprotein labelling appeared in tri-cellular junctions among parenchymatic cells inside these embryos. Overall immunofluorescence labelling of late stage embryos with JIM20 antibody was weaker than that of JIM11. Western blot analysis supported the above immunolocalization data. The treatment with 3,4-DHP inhibited the development of embryogenic cells and decreased the rate of embryo germination. Embryo-like structures, which developed after 3,4-DHP treatment showed aberrant non-compact epidermis with discontinuous ECM at the outer surface as well as much less immunolabelling with the JIM11 antibody. This treatment also decreased the plant regeneration capacity in embryogenic banana cultures. Finally, immunomodulation of surface hydroxyproline rich glycoproteins by co-culture of embryos with the JIM11 antibody resulted in a much lower germination capacity of these embryos. These results suggest that hydroxyproline rich glycoproteins play an important developmental role, especially in the process of regeneration and germination of embryos during plant regeneration via somatic embryogenesis. Proper content and localization of hydroxyproline rich glycoproteins seem to be essential for the formation and regeneration of banana somatic embryos.

  7. Wound-induced pectin methylesterases enhance banana (Musa spp. AAA) susceptibility to Fusarium oxysporum f. sp. cubense.

    Science.gov (United States)

    Ma, Li; Jiang, Shuang; Lin, Guimei; Cai, Jianghua; Ye, Xiaoxi; Chen, Houbin; Li, Minhui; Li, Huaping; Takác, Tomás; Samaj, Jozef; Xu, Chunxiang

    2013-05-01

    Recent studies suggest that plant pectin methylesterases (PMEs) are directly involved in plant defence besides their roles in plant development. However, the molecular mechanisms of PME action on pectins are not well understood. In order to understand how PMEs modify pectins during banana (Musa spp.)-Fusarium interaction, the expression and enzyme activities of PMEs in two banana cultivars, highly resistant or susceptible to Fusarium, were compared with each other. Furthermore, the spatial distribution of PMEs and their effect on pectin methylesterification of 10 individual homogalacturonan (HG) epitopes with different degrees of methylesterification (DMs) were also examined. The results showed that, before pathogen treatment, the resistant cultivar displayed higher PME activity than the susceptible cultivar, corresponding well to the lower level of pectin DM. A significant increase in PME expression and activity and a decrease in pectin DM were observed in the susceptible cultivar but not in the resistant cultivar when plants were wounded, which was necessary for successful infection. With the increase of PME in the wounded susceptible cultivar, the JIM5 antigen (low methyestrified HGs) increased. Forty-eight hours after pathogen infection, the PME activity and expression in the susceptible cultivar were higher than those in the resistant cultivar, while the DM was lower. In conclusion, the resistant and the susceptible cultivars differ significantly in their response to wounding. Increased PMEs and thereafter decreased DMs acompanied by increased low methylesterified HGs in the root vascular cylinder appear to play a key role in determination of banana susceptibility to Fusarium.

  8. Extending AAA operational model for profile-based access control in ethernet-based Neutral Access Networks

    NARCIS (Netherlands)

    Matias, J.; Jacob, E.; Demchenko, Y.; de Laat, C.; Gommans, L.; Macías López, E.M.; Bogliolo, A.; Perry, M.; Ran, M

    2010-01-01

    Neutral Access Networks (NAN) have appeared as a new model to overcome some restrictions and lack of flexibility that are present currently in broadband access networks. NAN brings new business opportunities by opening this market to new stakeholders. Although the NAN model is accepted, there are

  9. Effects of Organic and Inorganic Fertilizers on Growth and Yield of Banana (Musa AAA cv. Malindi) in Oman

    OpenAIRE

    Al Busaidi, Khair Tuwair Said

    2012-01-01

    The Sultanate of Oman is located on the south-eastern coast of the Arabian Peninsula, which lies on the south-western tip of the Asian continent. The strategic geographical locations of the Sultanate with its many maritime ports distributed on the Indian Ocean have historically made it one of the Arabian Peninsula leaders in the international maritime trade sector. Intensive trading relationships over long time periods have contributed to the high plant diversity seen in Oman where agricultur...

  10. Prime Contract Awards Over $25,000 by Major System, Contractor and State Part 1 (AAA-NAVY-AVG NAVY)

    Science.gov (United States)

    1990-01-01

    W4).. 0.0 m4 U WOLc U. at- () ( III -&- - *. a -4EG - - D-EL- onK . fau -4 to be 6 w c -4 : 11 0 . I- m =. 00 M0 W0L)0 = 4 06- % 0 a. ec a oA0 31 a. L...D a, 00c a 1in 1 fiA -4 L1 00 154 IA01 W2 L r C L) II I 4-CJ% .a L Cr us a .wf~ w E 0.ccr l𔄂. W 01= -- 2~IIn U:I 4:4Z~ in A0> ULL -a L- NitIC - I0...Ir 0a I CL- .-44 -..- Co 4 .-4 -4 C en L. *.-4..C4..= toI 4 a ’.4W o NW :0O I iu7 I 0 0UC 0 _4.4 A ) 0v 4 en _4 M. .1 - fau .0. I’’’. U .- 1_qu - C.-4

  11. Pareto front analysis of 6 and 15 MV dynamic IMRT for lung cancer using pencil beam, AAA and Monte Carlo

    DEFF Research Database (Denmark)

    Ottosson, R O; Hauer, Anna Karlsson; Behrens, C.F.

    2010-01-01

    The pencil beam dose calculation method is frequently used in modern radiation therapy treatment planning regardless of the fact that it is documented inaccurately for cases involving large density variations. The inaccuracies are larger for higher beam energies. As a result, low energy beams are...

  12. Efecto biofungicida del gel de Aloe vera sobre Mycosphaerella fijiensis, agente causal de la Sigatoka negra en Musa (AAA

    Directory of Open Access Journals (Sweden)

    Edwin Jaramillo Aguilar

    2017-01-01

    Full Text Available El objetivo de este trabajo fue evaluar a nivel in vitro la actividad antifúngica del gel de Aloe vera sobre el crecimiento micelial de Mycosphaerella fijiensis. Se utilizó la técnica de envenenamiento en el medio de cultivo PDA para determinar la actividad antifúngica del gel. El diseño utilizado fue completamente al azar, con siete tratamientos y tres repeticiones. En los tratamientos se utilizó un fungicida químico comercial (propiconazol, a 250 ppm y 500 ppm; un biofungicida comercial (Trichoderma sp. a 500 ppm y 1000 ppm; ambos productos se usaron como testigo químico y biológico, respectivamente; el gel de Aloe vera a 500 ppm y 1000 ppm; y un testigo absoluto. Se determinó diferencias significativas entre los tratamientos (ANOVA, El test de Tukey demostró que todos los tratamientos registraron diferencia significativa (p ≤ 0,05 con respecto al testigo absoluto. El propiconazol presentó el mayor porcentaje de inhibición del micelio (73,10%; el test de Tukey y el porcentaje de inhibición del micelio presentaron valores similares en el control del crecimiento del hongo a los 30 días de inoculación, en los tratamientos gel de Aloe vera y el T6 de Trichoderma sp. Los resultados sugieren que el Aloe vera podría ser un adecuado biofungicida para el control de Mycosphaerella fijiensis, agente causal de la Sigatoka negra.

  13. Caracterización de harina y almidón de frutos de banano Gros Michel (Musa acuminata AAA

    Directory of Open Access Journals (Sweden)

    Jairo Montoya-López

    2015-01-01

    Full Text Available En el estudio se determinaron las características fisicoquímicas, térmicas y reológicas de la harina y el almidón de frutos de banano Gros Michel (Musa acuminata cosechado en fincas del departamento del Quindío, Colombia. En el análisis proximal, la harina presentó un contenido de fibra de 18.82% y el almidón presentó contenidos de proteína de 1.92%, grasa de 5.3% y fibra de 2.76%. La harina presentó la temperatura más alta de absorción de calor (68.88 °C y su entalpía de gelatinización fue de 2.17 J/g; mientras que para el almidón estos valores fueron de 48.36 °C y 44.62 J/g, respectivamente. El análisis termogravimétrico (TGA de la harina o temperaturas en las cuales se registra la descomposición de carbohidratos (componentes de bajo peso molecular y polisacáridos (componentes de alto peso molecular fueron, respectivamente, de 284.51 °C y 470.42 °C; y para el almidón fueron de 307.51 °C y 500.46 °C. Los gránulos de almidón de banano tienen forma elipsoidal con un tamaño longitudinal promedio de 39.39 µm y tamaño transversal promedio de 29.47 µm. Los difractogramas de rayos X mostraron patrones de difracción tipo B. Los viscoamilogramas mostraron que para la harina la temperatura de inicio de gelatinización (Tg es de 76.3 °C, la viscosidad máxima de 1120 cP, y para el almidón la Tg fue de 70.75 °C y la viscosidad máxima de 2087 cP.

  14. Phenalenone-type compounds from Musa acuminata var. "Yangambi km 5" (AAA) and their activity against Mycosphaerella fijiensis.

    Science.gov (United States)

    Otálvaro, Felipe; Nanclares, Juliana; Vásquez, Luz Estella; Quiñones, Winston; Echeverri, Fernando; Arango, Rafael; Schneider, Bernd

    2007-05-01

    Two perinaphthenone-type compounds (1 and 2) were isolated together with four known phenylphenalenones (3-6) from the rhizomes of Musa acuminata var. "Yangambi km 5". The structures of the new phenalenones were assigned as 2-hydroxy-1H-phenalen-1-one (1) and 2-methoxy-1H-phenalen-1-one (2) on the basis of their spectroscopic data and were confirmed by synthesis. Compounds 1 and 2 displayed significantly enhanced activity against Mycosphaerella fijiensis in comparison with other phenylphenalenones.

  15. Optimatization of transient transformation methods to study gene expression in Musa acuminata (AAA group) cultivar Ambon Lumut

    Science.gov (United States)

    Prayuni, Kinasih; Dwivany, Fenny M.

    2015-09-01

    Banana is classified as a climateric fruit, whose ripening is regulated by ethylene. Ethylene is synthesized from ACC (1-aminocyclopropane-1-carboxylic acid) by ACC oxidase enzyme which is encoded by ACO gene. Controling an important gene expression in ethylene biosynthesis pathway has became a target to delay the ripening process. Therefore in the previous study we have designed a MaACO-RNAi construct to control MaACO gene expression. In this research, we study the effectiveness of different transient transformation methods to deliver the construct. Direct injection, with or no vaccum infiltration methods were used to deliver MaACO-RNAi construct. All of the methods succesfully deliver the construct into banana fruits based on RT-PCR result.

  16. Transcripts and MicroRNAs Responding to Salt Stress in Musa acuminata Colla (AAA Group) cv. Berangan Roots.

    Science.gov (United States)

    Lee, Wan Sin; Gudimella, Ranganath; Wong, Gwo Rong; Tammi, Martti Tapani; Khalid, Norzulaani; Harikrishna, Jennifer Ann

    2015-01-01

    Physiological responses to stress are controlled by expression of a large number of genes, many of which are regulated by microRNAs. Since most banana cultivars are salt-sensitive, improved understanding of genetic regulation of salt induced stress responses in banana can support future crop management and improvement in the face of increasing soil salinity related to irrigation and climate change. In this study we focused on determining miRNA and their targets that respond to NaCl exposure and used transcriptome sequencing of RNA and small RNA from control and NaCl-treated banana roots to assemble a cultivar-specific reference transcriptome and identify orthologous and Musa-specific miRNA responding to salinity. We observed that, banana roots responded to salinity stress with changes in expression for a large number of genes (9.5% of 31,390 expressed unigenes) and reduction in levels of many miRNA, including several novel miRNA and banana-specific miRNA-target pairs. Banana roots expressed a unique set of orthologous and Musa-specific miRNAs of which 59 respond to salt stress in a dose-dependent manner. Gene expression patterns of miRNA compared with those of their predicted mRNA targets indicated that a majority of the differentially expressed miRNAs were down-regulated in response to increased salinity, allowing increased expression of targets involved in diverse biological processes including stress signaling, stress defence, transport, cellular homeostasis, metabolism and other stress-related functions. This study may contribute to the understanding of gene regulation and abiotic stress response of roots and the high-throughput sequencing data sets generated may serve as important resources related to salt tolerance traits for functional genomic studies and genetic improvement in banana.

  17. Molecular characterization of CONSTANS-Like (COL) genes in banana (Musa acuminata L. AAA Group, cv. Grand Nain).

    Science.gov (United States)

    Chaurasia, Akhilesh Kumar; Patil, Hemant Bhagwan; Azeez, Abdul; Subramaniam, Vadakanthara Ramakrishnan; Krishna, Bal; Sane, Aniruddha Prafullachandra; Sane, Prafullachandra Vishnu

    2016-01-01

    The CONSTANS (CO) family is an important regulator of flowering in photoperiod sensitive plants. But information regarding their role in day neutral plants is limited. We report identification of nine Group I type CONSTANS-like (COL) genes of banana and their characterization for their age dependent, diurnal and tissue-specific expression. Our studies show that the Group I genes are conserved in structure to members in other plants. Expression of these genes shows a distinct circadian regulation with a peak during light period. Developmental stage specific expression reveals high level transcript accumulation of two genes, MaCOL3a and MaCOL3b, well before flowering and until the initiation of flowering. A decrease in their transcript levels after initiation of flowering is followed by an increase in transcription of other members that coincides with the continued development of the inflorescence and fruiting. CO binding cis-elements are observed in at least three FT -like genes in banana suggesting possible CO-FT interactions that might regulate flowering. Distinct tissue specific expression patterns are observed for different family members in mature leaves, apical inflorescence, bracts, fruit skin and fruit pulp suggesting possible roles other than flowering. This is the first exhaustive study of the COL genes belonging to Group I of banana.

  18. East African highland bananas (Musa spp. AAA-EA) 'worry' more about potassium deficiency than drought stress

    NARCIS (Netherlands)

    Taulya, G.

    2013-01-01

    Drought stress, potassium (K) and nitrogen (N) deficiencies are major constraints to rain-fed East African highland banana (EAHB) production in Uganda. It was hypothesised that the reduction in fresh bunch mass and increase in dry matter (DM) allocation to corms with drought stress, K and N

  19. Developmental localization and the role of hydroxyproline rich glycoproteins during somatic embryogenesis of banana (Musa spp. AAA

    Directory of Open Access Journals (Sweden)

    Menzel Diedrik

    2011-02-01

    Full Text Available Abstract Background Hydroxyproline rich glycoproteins (HRGPs are implicated to have a role in many aspects of plant growth and development but there is limited knowledge about their localization and function during somatic embryogenesis of higher plants. In this study, the localization and function of hydroxyproline rich glycoproteins in embryogenic cells (ECs and somatic embryos of banana were investigated by using immunobloting and immunocytochemistry with monoclonal JIM11 and JIM20 antibodies as well as by treatment with 3,4-dehydro-L-proline (3,4-DHP, an inhibitor of extensin biosynthesis, and by immunomodulation with the JIM11 antibody. Results Immunofluorescence labelling of JIM11 and JIM20 hydroxyproline rich glycoprotein epitopes was relatively weak in non-embryogenic cells (NECs, mainly on the edge of small cell aggregates. On the other hand, hydroxyproline rich glycoprotein epitopes were found to be enriched in early embryogenic cells as well as in various developmental stages of somatic embryos. Embryogenic cells (ECs, proembryos and globular embryos showed strong labelling of hydroxyproline rich glycoprotein epitopes, especially in their cell walls and outer surface layer, so-called extracellular matrix (ECM. This hydroxyproline rich glycoprotein signal at embryo surfaces decreased and/or fully disappeared during later developmental stages (e.g. pear-shaped and cotyledonary stages of embryos. In these later developmental embryogenic stages, however, new prominent hydroxyproline rich glycoprotein labelling appeared in tri-cellular junctions among parenchymatic cells inside these embryos. Overall immunofluorescence labelling of late stage embryos with JIM20 antibody was weaker than that of JIM11. Western blot analysis supported the above immunolocalization data. The treatment with 3,4-DHP inhibited the development of embryogenic cells and decreased the rate of embryo germination. Embryo-like structures, which developed after 3,4-DHP treatment showed aberrant non-compact epidermis with discontinuous ECM at the outer surface as well as much less immunolabelling with the JIM11 antibody. This treatment also decreased the plant regeneration capacity in embryogenic banana cultures. Finally, immunomodulation of surface hydroxyproline rich glycoproteins by co-culture of embryos with the JIM11 antibody resulted in a much lower germination capacity of these embryos. Conclusions These results suggest that hydroxyproline rich glycoproteins play an important developmental role, especially in the process of regeneration and germination of embryos during plant regeneration via somatic embryogenesis. Proper content and localization of hydroxyproline rich glycoproteins seem to be essential for the formation and regeneration of banana somatic embryos.

  20. Transcripts and MicroRNAs Responding to Salt Stress in Musa acuminata Colla (AAA Group cv. Berangan Roots.

    Directory of Open Access Journals (Sweden)

    Wan Sin Lee

    Full Text Available Physiological responses to stress are controlled by expression of a large number of genes, many of which are regulated by microRNAs. Since most banana cultivars are salt-sensitive, improved understanding of genetic regulation of salt induced stress responses in banana can support future crop management and improvement in the face of increasing soil salinity related to irrigation and climate change. In this study we focused on determining miRNA and their targets that respond to NaCl exposure and used transcriptome sequencing of RNA and small RNA from control and NaCl-treated banana roots to assemble a cultivar-specific reference transcriptome and identify orthologous and Musa-specific miRNA responding to salinity. We observed that, banana roots responded to salinity stress with changes in expression for a large number of genes (9.5% of 31,390 expressed unigenes and reduction in levels of many miRNA, including several novel miRNA and banana-specific miRNA-target pairs. Banana roots expressed a unique set of orthologous and Musa-specific miRNAs of which 59 respond to salt stress in a dose-dependent manner. Gene expression patterns of miRNA compared with those of their predicted mRNA targets indicated that a majority of the differentially expressed miRNAs were down-regulated in response to increased salinity, allowing increased expression of targets involved in diverse biological processes including stress signaling, stress defence, transport, cellular homeostasis, metabolism and other stress-related functions. This study may contribute to the understanding of gene regulation and abiotic stress response of roots and the high-throughput sequencing data sets generated may serve as important resources related to salt tolerance traits for functional genomic studies and genetic improvement in banana.

  1. Distribuição de subgrupos com base nas respostas fisiológicas em jogadores profissionais de futebol pela técnica K Means Cluster Subgroup distribution based on physiological responses in professional soccer players by K-means cluster technique

    Directory of Open Access Journals (Sweden)

    Luiz Fernando Novack

    2013-04-01

    Full Text Available INTRODUÇÃO: A preparação física no futebol necessita estar sempre em constante atualização em virtude das exigências presentes no futebol contemporâneo. OBJETIVO: Verificar a sensibilidade da técnica estatística K Means Cluster na distribuição de grupos com base nas respostas fisiológicas pertinentes ao futebol. MÉTODOS: Os atletas foram submetidos a avaliações antropométricas para determinar o percentual de gordura (%G e de massa magra (MM, teste incremental em esteira para obter o VO2 máximo (VO2máx e a velocidade de limiar ventilatório (VLim, bem como testes de campo para a agilidade (AG e o salto vertical (SV. Os dados foram analisados pelo teste de Kruskal-Wallis e a distribuição dos grupos foi desenvolvida pela técnica de K Means Cluster conforme as semelhanças dos jogadores com essas variáveis fisiológicas, assumindo o nível de significância de p INTRODUCTION: Physical fitness in soccer needs to be constantly updated due to current demands in contemporary soccer. OBJECTIVE: To assess the sensitivity of the K Means Clustering in group distribution based on physiological responses relevant to soccer. METHODS: The athletes underwent anthropometric evaluations to determine fat percentage (%F lean mass (LM, treadmill incremental test to obtain the VO2 maximum (VO2max and ventilatory threshold velocity (VL, as well as a field test for agility (AG and vertical jump (VJ. Data were analyzed by Kruskal-Wallis and distribution of groups was determined by K Means Clustering according to their similarities with these physiological variables, assuming significance level of p < 0.05. RESULTS: Showed that both groups were significantly different only concerning VJ (p < 0.001; LM (p < 0.001; VL (p = 0.011 and VO2max (p = 0.029 indicating that the athletes need to be distributed in groups for these variables. Nevertheless, %F and AG (p = 0.317; p = 0.922 respectively, were not different, indicating that these variables can be improved in all athletes collectively. CONCLUSION: The results make us conclude that group distribution by K Means Clustering technique can be performed using physiological responses of athletes in an attempt to optimize training for professional soccer players with focus on the common main training needs regardless of their tactical function played on the field.

  2. Obtaining preliminary DRIS norms and sufficiency ranges in banana of the prata subgroup, in the region of the Lower Jaguaribe, Ceará, Brazil = Obtenção de normas DRIS preliminares e faixas de suficiência para bananeira do subgrupo prata na região do Baixo Jaguaribe, CE, Brasil

    Directory of Open Access Journals (Sweden)

    Natanael Santiago Pereira

    2015-10-01

    Full Text Available For the success of nutritional diagnosis, it is important that the nutritional evaluation of a plant be based on local data, with the Diagnosis and Recommendation Integrated System (DRIS being used as an alternative. The objective of this study was to establish preliminary DRIS norms for banana crops in the region of the Lower Jaguaribe, in the state of Ceará (CE, using a database of the results of foliar analysis. A total of 487 DRIS norms were generated for the region of the Lower Jaguaribe from 171 results of foliar analysis relating to the irrigation districts of Jaguaribe-Apodi (DIJA and Tabuleiro de Russas (DISTAR. Reference values were obtained from the dual relationship between nutrients, transformed by natural logarithm, and their mean values and standard deviations calculated. The frequency of results for a deficiency or excess of each nutrient was determined from the DRIS indices obtained. The specific DRIS norms for each site showed differences when compared to those generated from all the data. The diagnoses generated by the specific norms agreed by less than 60% in comparison to those obtained using reference norms from the literature. The DRIS norms obtained need to be validated using data from commercial production, as well as from fertilizer trials = Para o sucesso do diagnóstico nutricional é interessante que a avaliação nutricional das plantas seja fundamentada em dados locais e como alternativa tem sido utilizado o Sistema Integrado de Diagnose e Recomendação (DRIS. Objetivou-se com este trabalho estabelecer normas DRIS preliminares para a cultura da banana na região do Baixo Jaguaribe, CE, com base em banco de dados com resultados de análise foliar. Foram geradas normas DRIS para a região do Baixo Jaguaribe a partir de 171 resultados de análises foliares relativas aos distritos de irrigação Jaguaribe-Apodi (DIJA e Tabuleiro de Russas (DISTAR, de um total de 487. Os valores de referência foram obtidos através da relação dual entre os nutrientes transformadas por logaritmo neperiano, sendo calculadas as suas respectivas médias e desvios padrões. A partir dos índices DRIS obtidos foram determinadas as frequências de resultados com quadro de deficiência e de excesso de cada nutriente. As normas DRIS, específicas para cada local, mostraram diferenças quando comparadas com as geradas com a totalidade dos dados. Os diagnósticos gerados com as normas específicas coincidiram em menos de 60% quando comparados com os obtidos por normas de referência da literatura. As normas DRIS obtidas necessitam ser validadas a partir de dados de produção comercial, bem como de ensaios de adubação.

  3. Inmunodeficiencia común variable: caracterización clínica e inmunológica de pacientes e identificación de subgrupos homogéneos con base en la tipificación de subpoblaciones de linfocitos B

    Directory of Open Access Journals (Sweden)

    Alejandra Catalina Vélez

    2015-03-01

    Conclusión. La tipificación de subpoblaciones de linfocitos solo permitió asignar a 11 de los pacientes a grupos homogéneos según los esquemas de clasificación internacionales, lo que indica la necesidad de agregar más criterios hasta lograr una clasificación ideal. Este estudio permitirá establecer mejores seguimientos médicos para pacientes con inmunodeficiencia común variable en grupos con alto riesgo de desarrollar complicaciones clínicas.

  4. Effects of particle size distribution on some physical, chemical and functional properties of unripe banana flour.

    Science.gov (United States)

    Savlak, Nazlı; Türker, Burcu; Yeşilkanat, Nazlıcan

    2016-12-15

    The objective of this study was to examine the effect of particle size distribution on physical, chemical and functional properties of unripe banana flour for the first time. A pure triploid (AAA group) of Musa acuminata subgroup Cavendish (°Brix;0.2, pH;4.73, titratable acidity; 0.56g/100g malic acid, total solids; 27.42%) which was supplied from Gazipaşa, Antalya, Turkey from October 2014 to October 2015 was used. Size fractions of Particle size significantly effected color, water absorbtion index and wettability. L(∗) value decreased, a(∗) and b(∗) values decreased by increasing particle size (r(2)=-0.94, r(2)=0.72, r(2)=0.73 respectively). Particles under 212μm had the lowest rate of wettability (83.40s). A negative correlation between particle size and wettability (r(2)=-0.75) and positive correlation between particle size and water absorption index (r(2)=0.94) was observed. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Genome-wide analyses of SWEET family proteins reveal involvement in fruit development and abiotic/biotic stress responses in banana.

    Science.gov (United States)

    Miao, Hongxia; Sun, Peiguang; Liu, Qing; Miao, Yulu; Liu, Juhua; Zhang, Kaixing; Hu, Wei; Zhang, Jianbin; Wang, Jingyi; Wang, Zhuo; Jia, Caihong; Xu, Biyu; Jin, Zhiqiang

    2017-06-14

    Sugars Will Eventually be Exported Transporters (SWEET) are a novel type of sugar transporter that plays crucial roles in multiple biological processes. From banana, for the first time, 25 SWEET genes which could be classified into four subfamilies were identified. Majority of MaSWEETs in each subfamily shared similar gene structures and conserved motifs. Comprehensive transcriptomic analysis of two banana genotypes revealed differential expression patterns of MaSWEETs in different tissues, at various stages of fruit development and ripening, and in response to abiotic and biotic stresses. More than 80% MaSWEETs were highly expressed in BaXi Jiao (BX, Musa acuminata AAA group, cv. Cavendish), in sharp contrast to Fen Jiao (FJ, M. acuminata AAB group) when pseudostem was first emerged. However, MaSWEETs in FJ showed elevated expression under cold, drought, salt, and fungal disease stresses, but not in BX. Interaction networks and co-expression assays further revealed that MaSWEET-mediated networks participate in fruit development signaling and abiotic/biotic stresses, which was strongly activated during early stage of fruit development in BX. This study provides new insights into the complex transcriptional regulation of SWEETs, as well as numerous candidate genes that promote early sugar transport to improve fruit quality and enhance stress resistance in banana.

  6. Efficiency of boron application in an Oxisol cultivated with banana in the Central Amazon.

    Science.gov (United States)

    Moreira, Adônis; de Castro, César; Fageria, Nand K

    2010-12-01

    In the Amazon region, there is no information on the fertilization of banana plants with boron (B). Besides this, the extractant (hot water) currently used to test B concentrations has many limitations. The aim of this work was to study the effect of B on the fruit yield and quality of banana plants of the Cavendish (AAA) sub-group, grown in dystrophic Yellow Latosol (Oxisol or Xanthic Ferralsol), in the Amazonas State, Brazil. The experimental design was completely randomized split plot in a 4 x 2 factorial scheme, composed of four B rates (0, 4, 8 and 12 kg ha-1) and two harvest cycles (sub-treatments), with four replicates. The B availability in the soil was determined by three extractants: Mehlich 3, hot water and KCl 1.0 mol L-1. The application of B influences the fruit yield, pulp/peel ratio, pulp resistance and B content in the leaves and fruits. The KCl 1.0 mol L-1 extractant was similar to the hot water in the evaluation of available B. To obtain maximum yield, it is necessary to apply 4.1 and 6.1 kg ha-1 of B in the first and second cycles, respectively.

  7. Rhizobacteria in mycorrhizosphere improved plant health and yield of banana by offering proper nourishment and protection against diseases.

    Science.gov (United States)

    Phirke, Niteen V; Kothari, Raman M; Chincholkar, Sudhir B

    2008-12-01

    The corporate R&D banana orchards of Musa paradisiaca (dwarf Cavendish AAA, var. shrimanti) on a medium black alluvial soil with low nutrients harboured diversified species of vesicular-arbuscular mycorrhizal (VAM) fungi. These fungi infected the roots severely (69.2%), showed elevated (69.8 g(-1) soil) spore density, increased soil bacterial density (245 x 10(8) cfu g(-1)), produced siderophores (58.2%) and reduced nematode population (2.3 g(-1)) in the mycorrhizosphere of plants for integrated plant nutrition management (IPNM) system as compared to traditional treatment of applying chemical fertilisers alone and other test treatments. The interactions of plant roots with native VAM and local and applied rhizobacteria in the matrix of soil conditioner enabled proper nourishment and protection of crop in IPNM treatment as compared to traditional way. Hence, exploitation of plant growth promoting rhizobacteria through judiciously designed IPNM system revealed the (a) relatively increased banana productivity (21.6%, 76 MT ha(-1)), (b) least occurrence of fusarial wilt and negligible evidence of Sigatoka, (c) saving of 50% chemical fertilisers and (d) permitted control over soil fertility in producer's favour over traditional cultivation practices. These findings are discussed in detail.

  8. Biotechnological tools against Fusarium oxysporum f. sp. cubense Tropical race 4 in Musa spp.

    Directory of Open Access Journals (Sweden)

    Idalmis Bermúdez-Caraballoso

    2014-10-01

    attacking Musa worldwide. Race 1 caused an epidemic that destroyed the banana export industry based cultivar ‘Gros Michel’ (Musa AAA in America as well as the disappearance of commercial production of cultivar ‘Manzano’ (Musa AAB in Cuba. The Foc tropical race 4 (TR4 was first recognized in 1990 in Taiwan, causing serious damage to the standards for the export crops sub Cavendish group in several countries in Southeast Asia. Most troubling is that over 80% banana cultivars produced worldwide are susceptibles to this race, and thus represents a potential risk for producing countries of Latin America and the Caribbean where threat has not yet reached the pathogen. This review was conducted with the aim of presenting the possible implications of the entry into Cuba of tropical race 4 of Panama disease and strategies to prevent future damages caused by the disease. Include aspects of the symptomatology of the disease, mechanisms of infection, pathogenic complexity and dispersion of the pathogen as well as several biotechnological tools against the disease among which are: varietal resistance, resistance inducers and development of tolerant cultivars. Key words: bananas, fungi disease, Fusarium oxysporum, plantains, varietal resistance

  9. Role of sucrose phosphate synthase in sucrose biosynthesis in ripening bananas and its relationship to the respiratory climacteric.

    Science.gov (United States)

    Hubbard, N L; Pharr, D M; Huber, S C

    1990-09-01

    During ripening of bananas (Musa spp. [AAA group, Cavendish subgroup]), there is a massive conversion of starch to sucrose. Also during ripening there is a rise in respiration known as the respiratory climacteric. In this study changes in carbohydrate content, activities of starch and sucrose metabolizing enzymes, and respiration were measured to assess their potential interrelationships. Sucrose phosphate synthase activity increased dramatically during the first 4 days after initiation of ripening by ethylene treatment. Starch concentration decreased and sucrose concentration increased during this time period. Developmental changes in sucrose phosphate synthase activity were measured with limiting substrate (plus Pi) and saturating substrate concentrations. Activities were not parallel under the two assay conditions, providing tentative evidence that kinetically different forms of the enzyme may exist at different stages of ripening. Sucrose accumulation rate was most highly correlated with sucrose phosphate synthase activity assayed with limiting substrate concentrations (plus Pi). The cumulative amount of CO(2) respired during ripening was positively correlated with sugar accumulation (R(2) = 0.97). From this linear regression it was calculated that a constant 0.605 millimoles of CO(2) was evolved per mole of sucrose formed throughout ripening. Using this quantity, the percentage of the total respiratory ATP produced which was required for the conversion of starch to sucrose was calculated assuming different models for carbon export from the amyloplast. The results suggest that sucrose biosynthesis during ripening constitutes a significant sink for respiratory ATP.

  10. Comparative study of the banana pulp browning process of 'Giant Dwarf' and FHIA-23 during fruit ripening based on image analysis and the polyphenol oxidase and peroxidase biochemical properties.

    Science.gov (United States)

    Escalante-Minakata, Pilar; Ibarra-Junquera, Vrani; Ornelas-Paz, José de Jesús; García-Ibáñez, Victoria; Virgen-Ortíz, José J; González-Potes, Apolinar; Pérez-Martínez, Jaime D; Orozco-Santos, Mario

    2018-01-01

    This work presents a novel method to associate the polyphenol oxidase (PPO) and the peroxidase (POD) activities with the ripening-mediated color changes in banana peel and pulp by computational image analysis. The method was used to follow up the de-greening of peel and browning of homogenized pulp from 'Giant Dwarf' (GD: Musa AAA, subgroup Cavendish) and FHIA-23 (tetraploid hybrid, AAAA) banana cultivars. In both cultivars, the color changes of peel during the ripening process clearly showed four stages, which were used to group the fruit into ripening stages. The PPO and POD were extracted from pulp of fruit at these ripening stages, precipitated, and partially purified by gel filtration chromatography. Moreover, the pulp browning was digitally monitored after homogenization for a span time of up to 120 min. The browning level was higher for GD than FHIA-23 tissues. This fact correlated with an 11.7-fold higher PPO activity in the GD cultivar, as compared with that of FHIA-23. POD activity was 8.1 times higher for GD as compared that that of FHIA-23.

  11. Nutritional potential of green banana flour obtained by drying in spouted bed

    Directory of Open Access Journals (Sweden)

    Carolina Vieira Bezerra

    2013-12-01

    Full Text Available This study evaluated the chemical composition of peeled and unpeeled green banana Cavendish (AAA flour obtained by drying in spouted bed, aiming at adding nutritional value to food products. The bananas were sliced and crushed to obtain a paste and fed to the spouted bed dryer (12 cm height and T = 80 ºC in order to obtain flour. The flours obtained were subjected to analysis of moisture, protein, ash, carbohydrates, total starch, resistant starch, fiber. The green banana flours, mainly unpeeled, are good sources of fiber and resistant starch with an average of 21.91g/100g and 68.02g/100g respectively. The protein content was found in an average of 4.76g/100g, being classified as a low biological value protein with lysine as the first limiting amino acid. The results showed that unpeeled green banana flour obtained by spouted bed drying can be a valuable tool to add nutritional value to products in order to increase their non-digestible fraction.

  12. CORRELACIÓN ENTRE LAS CARACTERÍSTICAS DEL SUELO Y LOS NEMATODOS DE LAS RAÍCES DEL BANANO (Musa AAA EN ECUADOR

    Directory of Open Access Journals (Sweden)

    C\\u00E9sar Ch\\u00E1vez-Velazco

    2009-01-01

    Full Text Available El objetivo del presente trabajo fue correlacionar las características físico-químicas del suelo con el peso de raíces y su número de nematodos en banano. Se emplearon muestras pareadas de cinco hectáreas de banano en una plantación comercial del Ecuador en el 2006. En 120 unidades de producción se tomaron las muestras de raíces y suelo. Se hizo análisis físico y químico del suelo y sus valores se correlacionaron con peso de raíz total, funcional y número de nematodos presentes en las raíces de banano. De las variables de suelo estudiadas, cuatro se asociaron con peso de raíz total, nueve con el de raíz funcional, cinco con el número de Radopholus similis, seis con el de Helicotylenchus spp., cuatro con el de Pratylenchus spp. y nueve con el de nematodos totales. De las características físicas (contenidos de arena, limo y arcilla estudiadas, un 50 % correlacionaron ya fuera con el peso de raíces o número de nematodos, mientras de las químicas, solamente se encontró correlación en 15 % de las relaciones estudiadas. A pesar de la significancia estadística, el valor de correlación fue bajo o muy bajo, con un máximo de r= 0,53; P< 0,0001 para el contenido de arena y número de nematodos totales. Los resultados sugieren futuros estudios en dos líneas: el efecto de la nutrición en el número y daño de los nematodos y el efecto de los nematodos en la absorción de nutrientes.

  13. Page 1 356 R N Ray F789 °F at A-A-A7A O. 53 s 550 - # C # {- 45 O ...

    Indian Academy of Sciences (India)

    model but a number ranging up to 200 is common for training simulators. 5.2. Model for a simulator. The development of a real time model for a simulator needs special attention. A typical task requirement may illustrate the point. The load on the training simulator for RAPPI under development at BARC consists of the ...

  14. The Arabidopsis thaliana AAA protein CDC48A interacts in vivo with the somatic embryogenesis receptor-like kinase 1 receptor at the plasma membrane.

    NARCIS (Netherlands)

    Aker, J.C.M.; Borst, J.W.; Karlova, R.B.; Vries, de S.C.

    2006-01-01

    Fluorescent cell division cycle (CDC)48 proteins were studied in living plant protoplasts. CDC48A and somatic embryogenesis receptor like kinase 1 (SERK1) were found to co-localize in the endoplasmatic reticulum (ER) and at the plasma membrane (PM), but not in endosomal compartments. Fluorescent

  15. Dietary intervention with green dwarf banana flour (Musa sp AAA) prevents intestinal inflammation in a trinitrobenzenesulfonic acid model of rat colitis.

    Science.gov (United States)

    Scarminio, Viviane; Fruet, Andrea C; Witaicenis, Aline; Rall, Vera L M; Di Stasi, Luiz C

    2012-03-01

    Dietary products are among the therapeutic approaches used to modify intestinal microflora and to promote protective effects during the intestinal inflammatory process. Because the banana plant is rich in resistant starch, which is used by colonic microbiota for the anaerobic production of the short-chain fatty acids that serve as a major fuel source for colonocytes: first, green dwarf banana flour produces protective effects on the intestinal inflammation acting as a prebiotic and, second, combination of this dietary supplementation with prednisolone presents synergistic effects. For this, we used the trinitrobenzenesulphonic acid (TNBS) model of rat colitis. Our results revealed that the protective effect produced by a combination of 10% green dwarf banana flour with prednisolone was more pronounced than those promoted by a single administration of prednisolone or a diet containing 10% or 20% banana flour. This beneficial effect was associated with an improvement in the colonic oxidative status because the banana flour diet prevented the glutathione depletion and inhibited myeloperoxidase activity and lipid peroxidation. In addition, the intestinal anti-inflammatory activity was associated with an inhibition of alkaline phosphatase activity, a reduction in macroscopic and microscopic scores, and an extension of the lesions. In conclusion, the dietary use of the green dwarf banana flour constitutes an important dietary supplement and complementary medicine product to prevention and treatment of human inflammatory bowel disease. Copyright © 2012 Elsevier Inc. All rights reserved.

  16. Efecto de la sigatoka negra (Mycosphaerella fijiensis sobre la fotosíntesis y transpiración foliar del banano (Musa sp. AAA, cv. Valery

    Directory of Open Access Journals (Sweden)

    Martín Hidalgo

    2006-01-01

    Full Text Available Con el propósito de relacionar el ataque de la Sigatoka negra (Mycosphaerella fijiensis con las tasas fotosintética y de transpiración foliares, se sembraron rebrotes del tercer ciclo de producción de una plantación del cv. Valery en potes plásticos de 4 litros. Las plantas se mantuvieron dentro de un invernadero a humedad relativa y temperatura del 90% y 27°C, respectivamente. Al emitir 6 hojas, las 4 más jóvenes fueron inoculadas con conidios de M. fijiensis a partir de cultivos monospóricos de aislamientos silvestres. Dos riegos diarios por aspersión mantuvieron una película de agua sobre las hojas. Se aplicó una suspensión de 150000 conidios ml-1 sobre el envés de las hojas utilizando un aerógrafo, en 2 fechas con un intervalo de 30 días entre ellas, para obtener diferentes grados de severidad y estadios de la enfermedad en hojas de diferentes edades. Tanto la determinación visual del porcentaje de severidad como la del estadio de desarrollo de la enfermedad, fueron llevadas a cabo en los 6,25 cm2 del área foliar cubierta por la cubeta del medidor infrarrojo de gases, utilizado para determinar las tasas fotosintéticas y transpiratorias foliares. La tasa fotosintética neta foliar (Fn; μmoles de CO2 reducidos por m2 s-1 decayó con el incremento del porcentaje de severidad (Fn=-0,1517 x+6,845; R2=0,72 y el estadio de la enfermedad (Fn=-1,62 x+8,36; R2=0,60. El impacto del patógeno sobre la tasa transpiratoria foliar (E; mmoles de agua m-2 s-1 fue relativamente menor, como lo mostró la regresión de E contra el porcentaje de severidad (E=-0,0122 x+2,429; R2=0,11

  17. Efecto de la Sigatoka negra (Mycosphaerella fijiensis) sobre la fotosíntesis y transpiración foliar del banano (Musa sp. AAA, cv. Valery)

    OpenAIRE

    Martín Hidalgo; Ana Tapia; Werner Rodríguez; Edgardo Serrano

    2005-01-01

    Con el propósito de relacionar el ataque de la Sigatoka negra (Mycosphaerella fijiensis) con las tasas fotosintética y de transpiración foliares, se sembraron rebrotes del tercer ciclo de producción de una plantación del cv. Valery en potes plásticos de 4 litros. Las plantas se mantuvieron dentro de un invernadero a humedad relativa y temperatura del 90% y 27°C, respectivamente. Al emitir 6 hojas, las 4 más jóvenes fueron inoculadas con conidios de M. fijiensis a pa...

  18. Influencia del seudotallo de la planta madre cosechada sobre el crecimiento y producción del hijo de sucesión en banano (Musa AAA Simmonds

    Directory of Open Access Journals (Sweden)

    Rodríguez Carolina

    2006-12-01

    Full Text Available

    Se estudió el efecto de la altura de corte del seudotallo de la planta recién cosechada sobre el crecimiento y producción del siguiente ciclo de producción en plantas de banano cultivar Gran enano. El experimento se realizó en la región de Urabá (Antioquia, Colombia, en dos fincas comerciales de banano y durante dos épocas del año, con un mismo promedio de precipitación. Los tratamientos comprendieron tres alturas de corte desde la superficie del suelo (2, 1,2 y 0 m al momento de la cosecha de la planta madre. Las alturas de corte de 2 y 1,2 m aumentaron la altura y el diámetro del seudotallo del hijo de sucesión y disminuyeron el tiempo hasta la floración, en comparación con los hijos de sucesión de las plantas madres a las que se les eliminó la totalidad del seudotallo. En las dos fincas, los hijos de sucesión de la altura de corte de 2 m incrementaron significativamente el peso del racimo, comparados con los hijos de sucesión sin seudotallo  de la planta madre. La longitud y el calibre de los dedos no fueron afectados por los tratamientos. Los resultados indican que existe una influencia del seudotallo de la planta madre cosechada sobre el hijo de sucesión. Esto favorece el crecimiento temprano del hijo de sucesión, debido al suministro de reservas y agua por parte de esta estructura, lo que se refleja en el incremento del rendimiento. 

  19. Prime Contract Awards Over $25,000 by Major System, Contractor and State. Part 1. AAA Navy A-1 Skyraider thru AVJ Navy OV-10 Coin (Now Bronco)

    Science.gov (United States)

    1991-01-01

    a 40 n-4 _ a0-4n v’ -. L, EE an 0 w~~~~~L 0 A a. a u0 tuaa .- - ~ 3 o Lago .0 1 U) z a 1 4-U (A 00 00 .a- .. I-- 4CuE0 0 1:>>-Ia L CL >4 0) 4CO a0 a. 4...WU, a) 0 L.. NO 0c 06l 00. SO *.U~U 0 00 L- n "’aO E-) *4C 0 A E"A 4^3 -U-, LUU,.-5 03.L - 01 -4 w -1000.0SM 10 tota mO S IU S4iuw um 𔃺U ’-L , M~ U1C

  20. Enhanced yield of phenolic extracts from banana peels (Musa acuminata Colla AAA) and cinnamon barks (Cinnamomum varum) and their antioxidative potentials in fish oil.

    Science.gov (United States)

    Anal, Anil Kumar; Jaisanti, Sirorat; Noomhorm, Athapol

    2014-10-01

    The bioactive compounds of banana peels and cinnamon barks were extracted by vacuum microwave and ultrasonic-assisted extraction methods at pre-determined temperatures and times. These methods enhance the yield extracts in shorter time. The highest yields of both extracts were obtained from the conditions which employed the highest temperature and the longest time. The extracts' yield from cinnamon bark method was higher by ultrasonic than vacuum microwave method, while vacuum microwave method gave higher extraction yield from banana peel than ultrasonic method. The phenolic contents of cinnamon bark and banana peel extracts were 467 and 35 mg gallic acid equivalent/g extract, respectively. The flavonoid content found in banana peel and cinnamon bark extracts were 196 and 428 mg/g quercetin equivalent, respectively. In addition, it was found that cinnamon bark gave higher 2,2-Diphenyl-1-1 picryhydrazyl (DPPH) radical scavenging activity and total antioxidant activity (TAA). The antioxidant activity of the extracts was analyzed by measuring the peroxide and p-anisidine values after oxidation of fish oils, stored for a month (30 days) at 25 °C and showed lesser peroxide and p-anisidine values in the fish oils containing the sample extracts in comparison to the fish oil without containing any extract. The banana peel and cinnamon extracts had shown the ability as antioxidants to prevent the oxidation of fish oil and might be considered as rich sources of natural antioxidant.

  1. Expression of a rice chitinase gene in transgenic banana ('Gros Michel', AAA genome group) confers resistance to black leaf streak disease

    OpenAIRE

    Kovacs, Gabriella; Sagi; Jacon, Géraldine; Arinaitwe, Geofrey; Busogoro, Jean-Pierre; Thiry, Els; Strosse, Hannelore; Swennen, Rony; Remy, Serge

    2013-01-01

    Transgenic banana (Musa acuminata ?Gros Michel?) integrating either of two rice chitinase genes was generated and its resistance to Black Leaf Streak disease caused by the fungus Mycosphaerella fijiensis was tested using a leaf disk bioassay. PCR screening indicated the presence of the hpt selectable marker gene in more than 90?% of the lines tested, whereas more than three quarters of the lines contained the linked rice chitinase gene resulting in a co-transformation frequency of at least 71...

  2. Expression of a rice chitinase gene in transgenic banana ('Gros Michel', AAA genome group) confers resistance to black leaf streak disease.

    Science.gov (United States)

    Kovács, Gabriella; Sági, László; Jacon, Géraldine; Arinaitwe, Geofrey; Busogoro, Jean-Pierre; Thiry, Els; Strosse, Hannelore; Swennen, Rony; Remy, Serge

    2013-02-01

    Transgenic banana (Musa acuminata 'Gros Michel') integrating either of two rice chitinase genes was generated and its resistance to Black Leaf Streak disease caused by the fungus Mycosphaerella fijiensis was tested using a leaf disk bioassay. PCR screening indicated the presence of the hpt selectable marker gene in more than 90 % of the lines tested, whereas more than three quarters of the lines contained the linked rice chitinase gene resulting in a co-transformation frequency of at least 71.4 %. Further, a unique stable integration of the transgenes in each line revealed some false negative PCR results and the expected co-transformation frequency of 100 %. The transgene insert number per line ranged from 1 to 5 and single transgene insert lines (25 % of all) were identified. Considerable delay in disease development (up to 63 days post-incoculation) over a monitoring period of 108 days occurred in nine lines with extracellularly targeted chitinase out of 17 transgenic lines tested and their necrotic leaf area decreased by 73-94 % compared to the untransformed susceptible control line. Finally, correlation between symptom development and rice chitinase expression was confirmed in two lines by Western analysis. The potential of rice chitinase genes to enhance resistance against M. fijiensis in banana was demonstrated as well as the usefulness of the leaf disk bioassay for early disease screening in transgenic banana lines.

  3. The role of topolins in micropropagation and somaclonal variation of banana cultivars ´Williams´ and ´Grand Naine´ (Musa spp. AAA)

    Czech Academy of Sciences Publication Activity Database

    Bairu, M. W.; Stirk, W.A.; Doležal, Karel; van Staden, J.

    2008-01-01

    Roč. 95, č. 3 (2008), s. 373-379 ISSN 0167-6857 R&D Projects: GA ČR GA522/06/0108 Institutional research plan: CEZ:AV0Z50380511 Keywords : Abnormality index * Banana * Micropropagation Subject RIV: ED - Physiology Impact factor: 1.017, year: 2008

  4. Gerald L. Epstein, PhD: director, center for science, technology, and security policy, American Association for the Advancement of Science (AAAS). Interview by Madeline Drexler.

    Science.gov (United States)

    Epstein, Gerald L

    2009-12-01

    Over his entire career, Gerald Epstein has toiled at the nexus of science, technology, and security. From 2003 to 2009, he was Senior Fellow for Science and Security at the Center for Strategic and International Studies Homeland Security Program, where he worked on reducing biological weapons threats, improving national preparedness, and easing potential tensions between the scientific research and national security communities. Epstein came to CSIS from the Institute for Defense Analyses. From 1996 to 2001, he served in the White House Office of Science and Technology Policy. And from 1983 to 1989, and again from 1991 until its demise in 1995, Epstein worked at the Congressional Office of Technology Assessment, where he directed a study on the proliferation of weapons of mass destruction, alongside research on other global security topics. A recognized expert in biological risk reduction, Epstein was actually trained as a physicist, having received SB degrees in physics and electrical engineering from MIT, and a PhD in physics from the University of California at Berkeley. How, then, did he come to study the evolving threat from bioterrorism? "What compelled me about bioterrorism was that it was a stellar example of a topic that would lead to a train wreck between the scientific community and the security community unless they figured out how to work together," he said. "The distance between a laboratory and a very large consequence event is a lot shorter in biology than in any other field. I got into bioterrorism to help make sure that the security community doesn't get so scared of the science that it shuts it down, and that the science community isn't so oblivious of security concerns that it pays no attention to them." Epstein spoke on November 6, 2009, with contributing writer Madeline Drexler, author of Emerging Epidemics: The Menace of New Infections (Penguin, 2009), an updated version of an earlier volume. Drexler holds a visiting appointment at the Harvard School of Public Health and is a senior fellow at Brandeis University's Schuster Institute for Investigative Journalism.

  5. New protocol for the fast induction of adventicious buds and plants regeneration of banana cv. ‘Grande Naine’ (Musa AAA

    Directory of Open Access Journals (Sweden)

    Lourdes R. García

    2006-01-01

    Full Text Available A protocol for the quick formation of adventitious buds in banana cv. ‘Grande Naine’ and the development of plants was developed. Several concentrations of 6-Benzylaminopurine (6-BAP and 1-phenyl-3-(-1,2,3-thidiazol-5-ylurea (TDZ were studied in the culture media for the induction of these structures, evaluating some explants sizes for multiplication. The highest number of adventitious buds was obtained when TDZ was used in the culture medium, with only two subcultures needed to develop explants with adventitious buds. The explants of 1mm3 were selected for the multiplication and a medium of MS salts with 1.0 mg.l-1 thiamine HCl and 2.0% sucrose for plant regeneration, reaching the values of 96%. The use of this protocol could be a very useful alternative in genetic improvement programs with the cv. ´Grande naine` using the mutation induction and somaclonal variation. Key words: organogenesis, thidiazuron, tissue culture

  6. Componentes de la variabilidad espacial en el manejo por sitio específico en banano Components of the spatial variability in site-specific management in banana

    Directory of Open Access Journals (Sweden)

    Darío Antonio Castañeda Sánchez

    2010-08-01

    Full Text Available El objetivo de este trabajo fue evaluar la variabilidad espacial de la producción de banano en función de variables físicas y químicas del suelo y de las características fisiográficas de la finca, con miras a seleccionar aquellas con mayor potencial de uso en programas de manejo por sitio específico. Se georreferenciaron 130 unidades productivas de banano clon Williams (Cavendish AAA distribuidas en cuatro lotes de la finca y tres unidades de suelo. Se determinó el peso del racimo y la cantidad de raíz funcional, para cada planta, y 35 variables físicas y químicas del suelo. Se relacionó la variabilidad espacial de la producción en función de las variables del suelo, a partir de cuatro estrategias: ejes coordenados como covariables; variables físicas y químicas del suelo y raíz funcional como covariables; división del análisis por lotes; y división del análisis por unidades de suelo. La división por lotes resultó ser la mejor estrategia para modelar la variabilidad espacial de la producción de banano. El análisis por este modelo permitió establecer grupos de variables del suelo que se relacionaron significativamente y explicaron más del 69% del peso de los racimos de banano dentro de cada lote. Estos grupos de variables son los de mayor potencial para el establecimiento de un programa de manejo por sitio específico.The objective of this work was to evaluate the spatial variability of banana production, in function of physical and chemical variables of soil and of farm physiographic characteristics, in order to select those with the greatest potential for use in site-specific management program. One hundred thirty productive units of banana clone Williams (Cavendish AAA distributed in four lots and tree soils units of the farm were georeferenced. The bunch weight and root functionality were determined for each plant, as well as 35 physical and chemical soil variables. The spatial variability of the production was

  7. Isolation, expression and comparison of a pectate lyase produced ...

    African Journals Online (AJOL)

    Administrator

    2010-12-27

    Dec 27, 2010 ... Cultivar Cavendish is resistant to FOC1, but a newly occurring race 4 (FOC4) was found to be able to infect Cavendish. Studying the fungal pathogenicity is an important step towards the disease control. In this study, we cloned two pl1 genes (723 bp and 240 aa), encoding pectate lyase 1 (PL1) from both ...

  8. Production, characterization and application of banana (Musa spp ...

    African Journals Online (AJOL)

    Pasting properties of flour from six varieties of matured green banana (Musa spp) fruits identified as Gross michel (GM), Dwarf Cavendish (DC), Cavendish (CA), Lacatan (LA), Poyo (PO) and Red skin (RS) were determined. Flour of CA, used in formulation of banana–whole maize meal was assessed organoleptically for ...

  9. Characterization of an AGAMOUS-like MADS Box Protein, a Probable Constituent of Flowering and Fruit Ripening Regulatory System in Banana

    Science.gov (United States)

    Roy Choudhury, Swarup; Roy, Sujit; Nag, Anish; Singh, Sanjay Kumar; Sengupta, Dibyendu N.

    2012-01-01

    The MADS-box family of genes has been shown to play a significant role in the development of reproductive organs, including dry and fleshy fruits. In this study, the molecular properties of an AGAMOUS like MADS box transcription factor in banana cultivar Giant governor (Musa sp, AAA group, subgroup Cavendish) has been elucidated. We have detected a CArG-box sequence binding AGAMOUS MADS-box protein in banana flower and fruit nuclear extracts in DNA-protein interaction assays. The protein fraction in the DNA-protein complex was analyzed by mass spectrometry and using this information we have obtained the full length cDNA of the corresponding protein. The deduced protein sequence showed ∼95% amino acid sequence homology with MA-MADS5, a MADS-box protein described previously from banana. We have characterized the domains of the identified AGAMOUS MADS-box protein involved in DNA binding and homodimer formation in vitro using full-length and truncated versions of affinity purified recombinant proteins. Furthermore, in order to gain insight about how DNA bending is achieved by this MADS-box factor, we performed circular permutation and phasing analysis using the wild type recombinant protein. The AGAMOUS MADS-box protein identified in this study has been found to predominantly accumulate in the climacteric fruit pulp and also in female flower ovary. In vivo and in vitro assays have revealed specific binding of the identified AGAMOUS MADS-box protein to CArG-box sequence in the promoters of major ripening genes in banana fruit. Overall, the expression patterns of this MADS-box protein in banana female flower ovary and during various phases of fruit ripening along with the interaction of the protein to the CArG-box sequence in the promoters of major ripening genes lead to interesting assumption about the possible involvement of this AGAMOUS MADS-box factor in banana fruit ripening and floral reproductive organ development. PMID:22984496

  10. Immunogold silver staining associated with epi-fluorescence for cucumber mosaic virus localisation on semi-thin sections of banana tissues

    Directory of Open Access Journals (Sweden)

    B Helliot

    2009-08-01

    Full Text Available The immunogold-silver staining (IGSS technique in combination with epi-fluorescence detection was used to localise cucumber mosaic virus (CMV particles within banana infected tissues. For this purpose, tissue samples (2 mm3 were excised from CMV-infected and highly proliferating meristem cultures of Williams BSJ banana (ITC. 0570, AAA, Cavendish subgroup. These samples were immediately fixed in a 2% paraformaldehyde/0.25% glutaraldehyde mixture, dehydrated in ethanol, and finally embedded in L.R.White resin. Semi-thin sections were cut, mounted on clean treated glass slides and immunostained for CMV particles using gold-labelled secondary antibodies and silver enhancement. Sections were counterstained with basic fuchsin and examined using laser scanning confocal microscopy. Negative controls included immuno-stained samples excised from non-virus infected material as well as infected material on which primary or secondary antibodies were not applied. Images of autofluorescence (in red and of epi-reflectance of silver-enhanced immunogold particles (in green were recorded separately and merged, allowing the specific localisation of CMV particles at the cellular level on semi-thin sections of aldehyde-fixed banana tissues. The main advantage of this analytical approach compared to previously published protocols is that it combines a fast staining procedure, stable preparation, a high resolution, and a narrow plane of focus with the flexibility in generation, processing and analysis of images offered by laser scanning confocal microscopy. Finally, the presence of numerous CMV particles within banana meristems constitutes a clear explanation of the very low CMV elimination efficiency when using meristem- tip culture alone.

  11. HIDRÓLISIS ENDO-ENZIMATICA Y PRODUCCION DE ETANOL A PARTIR DEL BANANO DE RECHAZO

    Directory of Open Access Journals (Sweden)

    CARLOS A GUEVARA-BRAVO

    Full Text Available Los polisacáridos del banano de rechazo verde (Variedad Cavendish AAA, de la zona de Urabá, fueron hidrolizados eficientemente, utilizando tratamiento endoenzimático a altas temperaturas. Posteriormente los azúcares simples fueron extraídos y los jugos resultantes fermentados con levaduras comerciales. Al final del proceso se determinó la concentración de etanol y se calcularon los rendimientos. Primero, se desarrollaron experimentos a escala de 1,0 Kg y se determinaron las mejores condiciones de hidrólisis: Concentración de etileno exógeno (50 ppm, temperatura (33°C y cantidad de Ca(OH2 (10 g/Kg de banano, adecuada para la extracción. Teniendo como referencias las condiciones anteriores, fue escalado el proceso a 40 Kg, para determinar la metodología de extracción de los azúcares (en contracorriente, mediante la utilización de lechada de cal (1,0%, para precipitar los sólidos, centrifugación y posterior neutralización con H2SO4 hasta pH 5,5. Finalmente los jugos ricos en azúcares fueron fermentados con levaduras a 5 g/L, donde se alcanzó un rendimiento de 52 mL de etanol/Kg de banano. Estos resultados indican que el proceso es promisorio para producir alcohol a gran escala, Sin embargo se debe mejorar, para que sea competitivo con los rendimientos obtenidos con de caña de azúcar (86 mL de etanol/Kg de caña.

  12. Characterization of an AGAMOUS-like MADS box protein, a probable constituent of flowering and fruit ripening regulatory system in banana.

    Directory of Open Access Journals (Sweden)

    Swarup Roy Choudhury

    Full Text Available The MADS-box family of genes has been shown to play a significant role in the development of reproductive organs, including dry and fleshy fruits. In this study, the molecular properties of an AGAMOUS like MADS box transcription factor in banana cultivar Giant governor (Musa sp, AAA group, subgroup Cavendish has been elucidated. We have detected a CArG-box sequence binding AGAMOUS MADS-box protein in banana flower and fruit nuclear extracts in DNA-protein interaction assays. The protein fraction in the DNA-protein complex was analyzed by mass spectrometry and using this information we have obtained the full length cDNA of the corresponding protein. The deduced protein sequence showed ~95% amino acid sequence homology with MA-MADS5, a MADS-box protein described previously from banana. We have characterized the domains of the identified AGAMOUS MADS-box protein involved in DNA binding and homodimer formation in vitro using full-length and truncated versions of affinity purified recombinant proteins. Furthermore, in order to gain insight about how DNA bending is achieved by this MADS-box factor, we performed circular permutation and phasing analysis using the wild type recombinant protein. The AGAMOUS MADS-box protein identified in this study has been found to predominantly accumulate in the climacteric fruit pulp and also in female flower ovary. In vivo and in vitro assays have revealed specific binding of the identified AGAMOUS MADS-box protein to CArG-box sequence in the promoters of major ripening genes in banana fruit. Overall, the expression patterns of this MADS-box protein in banana female flower ovary and during various phases of fruit ripening along with the interaction of the protein to the CArG-box sequence in the promoters of major ripening genes lead to interesting assumption about the possible involvement of this AGAMOUS MADS-box factor in banana fruit ripening and floral reproductive organ development.

  13. Biscoitos produzidos com farinha de banana: avaliações química, física e sensorial Cookies produced with banana meal: chemical, physical andsensorial evaluation

    Directory of Open Access Journals (Sweden)

    Luiz Henrique Fasolin

    2007-09-01

    Full Text Available Este trabalho teve como objetivo avaliar o aproveitamento da farinha de banana verde (FBV (Musa (grupo AAACavendish anã’ na produção de biscoitos tipo cookies. Foram produzidos biscoitos com substituição parcial da farinha de trigo por FBV na proporção de 10, 20 e 30%, e biscoitos Padrão sem FBV. Os biscoitos foram avaliados quanto à composição química, características físicas (diâmetro, espessura e peso e grau de aceitação. O teste de aceitação dos biscoitos indicou não haver diferença significativa entre as diferentes formulações e o padrão, com exceção para o biscoito tipo III que apresentou menor aceitação (p The objective of this work was to evaluate the use of unripe banana meal (UBM (Musa (AAA group ‘Dwarf Cavendish’ in the production of cookies. Cookies were produced substituting 10, 20 and 30% of the wheat flour for UBM, as well as standard cookies without UBM. The chemical compositions, physical features (weight, diameter and thickness and sensorial characteristics of the cookies were evaluated. A cookie acceptance trial was conducted, which revealed no significant difference between the formulations containing UBM and the standard, except for the type III cookie, which was less well accepted (p < 0.05 by children. The chemical composition of the cookies did not differ significantly from the standpoint of moisture and total lipids. The most important differences were found in the starch, total reducing sugars and mineral salts content. The main differences in the cookies’ physical characteristics were their diameters after baking, indicating that UBM altered the properties of the wheat flour. Therefore, in view of the high nutritional value of the cookies containing banana meal, with no significant alteration of their physical and sensorial characteristics, the use of this meal as a partial substitute of wheat flour is viable and can be recommended in the preparation of alternative nutritionally

  14. EFEITO DO PESO DE MUDA TIPO PEDAÇO DE RIZOMA NO ENRAIZAMENTO INICIAL DA BANANEIRA DO CULTIVAR NANICÃO (Musa acuminata AAA EFFECT OF THE WEIGHT OF RHIZOME TYPE SEEDLING IN THE INITIAL ROOTING OF BANANA CULTIVAR NANICÃO (Musa acuminata AAA

    Directory of Open Access Journals (Sweden)

    Lincoln F. Zica

    2007-09-01

    Full Text Available

    O uso de mudas do tipo pedaço de rizoma, vem, a cada dia, sendo procurado intensivamente como material de propagação de bananeiras. Porém, ao se trabalhar com esse tipo de mudas há necessidades de se conhecer o efeito do peso do rizoma em relação ao seu enraizamento inicial, pois quanto maior o peso das raízes, melhores serão as mudas. De acordo com a análise estatística concluiu-se que há um maior enraizamento em pedaços de rizomas de maior peso.

    Pieces of rootstalk are being used more and more intensively as a means of reproducing banana plants. However, in order to work effectively with this means of reproduction, it is necessary to know the effect of the rootstalk’s weight when it is first planted, because the greater the weight of the rootstalk, the better the shoots will be. On the basis of statistical analysis, it was concluded that the heavier pieces of rootstalk root better.

  15. EFFECT OF NUMBER OF FUNCTIONAL LEAVES AT FLOWERING ON YIELD OF BANANA GRAND NAINE (Musa AAA Simmonds EFECTO DEL NÚMERO DE HOJAS FUNCIONALES A LA FLORACIÓN SOBRE LA PRODUCCIÓN DE BANANO GRAN ENANO (Musa AAA Simmonds

    Directory of Open Access Journals (Sweden)

    Carolina Rodríguez González

    2012-06-01

    Full Text Available Abstract. The effect of the selective removal of leaves at flowering on yield, growth, maturity and quality of Grand Nain banana fruits was evaluated. The present study was conducted in three regions of Urabá (Colombia with precipitation low (experiment 1, medium (experiment 2 and high (experiment 3. The experimental design used randomized complete blocks, four treatments (6, 8, 10 and 12 leaves from the start of flowering and three replications. Every 15 days, the thickness (cm and length (cm of central fruit from the second hand were measured and two fruits were taken to record fresh weight and dry weight. At harvest, leaf number, bunch weight (kg, and the thickness (cm and length (cm of central fruit from the second hand were measured. During fruit ripening (8 and 15 days, the contents of starch and sugars in the pulp were determined. The thickness and length of the fruit, bunch weight and the box-stem ratio were not affected (PResumen. Se evaluó el efecto de la eliminación selectiva de hojas a la floración sobre la producción, crecimiento, maduración y calidad de los frutos de banano Gran Enano. El estudio se realizó en tres zonas de Urabá (Colombia, con precipitación baja (experimento 1, media (experimento 2 y alta (experimento 3. Se usó un diseño de bloques completamente al azar, cuatro tratamientos (6, 8, 10 y 12 hojas desde el inicio de floración y tres repeticiones. Cada 15 días se midieron el grosor (cm y la longitud (cm del fruto central de la segunda mano y se tomaron dos frutos más para registrar el peso fresco y el peso seco. A la cosecha se midieron el número de hojas, el peso del racimo (kg, el grosor (cm y la longitud (cm del fruto central de la segunda mano. Durante la maduración de los frutos (8 y 15 días se determinaron los contenidos de almidón y azúcares en la pulpa. El grosor y la longitud del fruto, peso del racimo y la cantidad de cajas a partir de un racimo (ratio, no fueron afectados (P<0,05 por la eliminación selectiva de hojas. Los porcentajes de almidón y azúcares totales durante la maduración de los frutos no variaron (P<0,05 como consecuencia del número de hojas funcionales presentes. Estos resultados sugieren que en el cultivo de banano, es posible dejar las plantas con menos de 12 hojas desde la floración sin que se afecte la calidad de los frutos o su maduración en poscosecha.

  16. COMPORTAMENTO FISIOLÓGICO IN VITRO DE BANANEIRA (Musa sp., AAA e AAB cvs. NANICA E PRATA ANÃ: INFLUÊNCIA DE DIFERENTES NÍVEIS DE POTÁSSIO PYSIOLOGICAL BEHAVIOR OF BANANA (Musa sp., AAA and AAB cvs. 'NANICA' AND 'PRATA ANÃ' IN VITRO CONDITION: INFLUENCE OF DIFFERENT LEVELS OF POTASSIUM

    Directory of Open Access Journals (Sweden)

    Humberto Actis Zaidan

    1999-01-01

    Full Text Available Nas abordagens biotecnológicas de propagação de plantas, os meios de cultura devem ter uma composição química adequada à essa finalidade permitindo a otimização da produção. Como a bananeira (Musa sp. é exigente em potássio, a busca do nível adequado desse macronutriente envolve não somente o comprometimento com o nível dos outros nutrientes (balanço iônico, mas também a relação entre eles. Para acompanhar os efeitos fisiológicos dos vários teores de K, explantes caulinares dos cvs. "Nanica" e "Prata Anã" foram cultivados em meio MS modificado, em presença de BAP (2,5 mg/L, sacarose, vitaminas e agar, em seis diferentes concentrações de K: 5, 10, 15, 20, 25 e 30 mM, sendo 20 mM a concentração de K no MS básico. Foram feitas análises de massa de matéria seca (MMS, K na parte aérea, raiz e plântulas inteiras, e determinado o número de plântulas, aos 90 dias de idade. Após início de cultivo todos os parâmetros foram analisados segundo um delineamento inteiramente casualizado. As plântulas que se desenvolveram em baixas concentrações de K apresentaram sintomas visuais de deficiência de K, como clorose e necrose nas folhas mais velhas. Os cultivares apresentaram diferenças quantitativas entre si, relacionados à concentração de K presente no meio de cultura, seja em relação aos valores de MMS, ou quanto ao número de plântulas formadas. Em ambos os cultivares, foi observada uma relação direta entre o desenvolvimento de plântulas e as concentrações de K com otimização ao redor de 15 a 20 mM de K.The chemical composition of culture growth media to micropropagate plants should be devised to allow the best quality and high production of plant material. One of the challenges is to optimize the ionic balance involving mineral nutrients. As banana (Musa sp. requires high levels of potassium, the optimum level was investigated. Shoot apexes of two banana cultivars 'Nanica' and 'Prata Anã' were cultivated in asseptic conditions in modified MS media for 90 days in the presence of six different concentrations of K: 5, 10, 15, 20, 25 and 30 mM. The concentration of 20 mM is found in the basic MS medium. The cultures were then transferred to rooting media with the same concentrations of K. Dry matter weight and k concentration in shoots, roots and the whole plantlet, and number of plantlets produced were determined. Visual symptoms of K deficiency, such as chlorosis and necrosis in older leaves, were observed in all plantlets under low concentration of K. Quantitative differences were observed between the two cultivars in relation to dry matter weight and number of in vitro regenerated banana plantlets; K concentration was optimum around 15-20 mM.

  17. Failure to demonstrate Chlamydia pneumoniae in symptomatic abdominal aortic aneurysms by a nested polymerase chain reaction (PCR)

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Ostergård, L; Henneberg, E W

    1998-01-01

    To investigate whether Chlamydia pneumoniae is present in symptomatic abdominal aortic aneurysms (AAA).......To investigate whether Chlamydia pneumoniae is present in symptomatic abdominal aortic aneurysms (AAA)....

  18. Editorial R -ESONANCE

    Indian Academy of Sciences (India)

    molecule of electricity', an elementary unit of electric charge. By. 1891 G J Stoney had already coined the name 'electron'. It was in 1897 that Joseph John OJ) Thomson, working at the. Cavendish Laboratory in Cambridge, finally discovered the.

  19. Proteins associated with the size and expansion rate of the abdominal aortic aneurysm wall as identified by proteomic analysis

    DEFF Research Database (Denmark)

    Urbonavicius, Sigitas; Lindholt, Jes S.; Delbosc, Sandrine

    2010-01-01

    Identification of biomarkers for the natural history of abdominal aortic aneurysms (AAA) holds the key to non-surgical intervention and improved selection for AAA repair. We aimed to associate the basic proteomic composition of AAA wall tissue with the expansion rate and size in patients with AAA....

  20. Critical role of mast cell chymase in mouse abdominal aortic aneurysm formation

    DEFF Research Database (Denmark)

    Sun, J; Zhang, J; Lindholt, Jes S.

    2009-01-01

    Mast cell chymase may participate in the pathogenesis of human abdominal aortic aneurysm (AAA), yet a direct contribution of this serine protease to AAA formation remains unknown.......Mast cell chymase may participate in the pathogenesis of human abdominal aortic aneurysm (AAA), yet a direct contribution of this serine protease to AAA formation remains unknown....

  1. The abdominal aortic aneyrism : Clinical outcomes in EVAR and longitudinal biobank studies

    NARCIS (Netherlands)

    Koole, D.

    2013-01-01

    This thesis has been divided in 6 parts. Part I of this thesis focuses on AAA wall biology, rupture risk, and the value of AAA biobanks. Endoluminal stenting is currently the treatment of choice for AAA patients because of the relatively low rate of short-term complications. AAA biopsies from a

  2. Science Education in Global Perspective: Lessons from Five Countries. Selected Papers Presented at the Annual Meeting of the American Association for the Advancement of Science (Washington, D.C., January 3-8, 1982). AAAS Selected Symposium 100.

    Science.gov (United States)

    Klein, Margrete Siebert, Ed.; Rutherford, F. James, Ed.

    Designed to provide an international cross-section of data on science and mathematics education, this document describes the educational systems of countries that developed innovative approaches to science education. The science-centered systems of Japan, People's Republic of China, East Germany, West Germany, and the Soviet Union are featured in…

  3. Uso de aislamientos endofíticos de Trichoderma spp., para el biocontrol del Fusarium oxysporum f. sp. cubense (Mal de Panamá) raza 1 en vitroplantas de banano del cultivar Gros Michel (AAA) en condiciones de invernadero.

    OpenAIRE

    Caballero Hernàndez, Álvaro Jóse; Pocasangre Enamorado, Luis Ernesto; Casanoves, Fernando; Avelin, Jacques; Tapia Fernández, Ana Cecilia; Ortiz, Juan Luis

    2013-01-01

    El objetivo de la presente investigación fue seleccionar aislamientos endofíticos de Trichoderma spp., para el biocontrol de Fusarium oxysporum f. sp. cubense raza 1. Se evaluaron los tres aislamientos más patogénicos FOC2, FOC4, FOC8 obtenidos del criobanco del Laboratorio de Fitopatología de CATIE, en una prueba de antibiosis y posteriormente se procedió a realizar la prueba de biocontrol con veinte aislamientos endofíticos de Trichoderma spp. Y dos aislamientos FOC2 y FOC4 en vitroplantas ...

  4. Enfoque de un programa CRM (Customer Relationship Managment): fidelización, aplicado a detallistas tipo AAA, para un productor de confitería en la ciudad de Quito

    OpenAIRE

    Guevara Correa, Maritza

    2004-01-01

    Para la empresa la atención de cliente es una variable vinculada de forma directa con la satisfacción del mismo, de tal manera que una no puede separarse de la otra, en este estudio se revisará las acciones por las cuales se considera que la satisfacción del cliente y su fidelización son componentes esenciales para incrementar la competitividad de las organizaciones. La identificación de las necesidades y expectativas de los distintos segmentos de clientes es fundamental para a...

  5. Isolation and heterologous expression of a polygalacturonase produced by Fusarium oxysporum f. sp. cubense race 1 and 4.

    Science.gov (United States)

    Dong, Zhangyong; Wang, Zhenzhong

    2015-04-03

    Fusarium wilt (Panama disease) caused by Fusarium oxysporum f. sp. cubense (FOC) represents a significant threat to banana (Musa spp.) production. Musa AAB is susceptible to Race 1 (FOC1) and Race 4 (FOC4), while Cavendish Musa AAA is found to be resistant to FOC1 but still susceptible to Race 4. A polygalacturonase (PGC3) was purified from the supernatant of Fusarium oxysporum f. sp. cubense race 4 (FOC4), which is the pathogen of Fusarium wilt. PGC3 had an apparent molecular weight of 45 kDa according to SDS-PAGE. The enzyme hydrolyzed polygalacturonic acid in an exo-manner, as demonstrated by analysis of degradation products. The Km and Vmax values of PGC3 from FOC4 were determined to be 0.70 mg·mL-1 and 101.01 Units·mg·protein-1·min-1, respectively. Two pgc3 genes encoding PGC3 from FOC4 and FOC1, both genes of 1368 bp in length encode 456 amino-acid residues with a predicted signal peptide sequence of 21 amino acids. There are 16 nucleotide sites difference between FOC4-pgc3 and FOC1-pgc3, only leading to four amino acid residues difference. In order to obtain adequate amounts of protein required for functional studies, two genes were cloned into the expression vector pPICZaA and then expressed in Pichia pastoris strains of SMD1168. The recombinant PGC3, r-FOC1-PGC3 and r-FOC4-PGC3, were expressed and purified as active proteins. The optimal PGC3 activity was observed at 50 °C and pH 4.5. Both recombinant PGC3 retained >40% activity at pH 3-7 and >50% activity in 10-50 °C. Both recombinant PGC3 proteins could induce a response but with different levels of tissue maceration and necrosis in banana plants. In sum, our results indicate that PGC3 is an exo-PG and can be produced with full function in P. pastoris.

  6. Mycosphaerella fijiensis, the black leaf streak pathogen of banana: progress towards understanding pathogen biology and detection, disease development, and the challenges of control.

    Science.gov (United States)

    Churchill, Alice C L

    2011-05-01

    Banana (Musa spp.) is grown throughout the tropical and subtropical regions of the world. The fruits are a key staple food in many developing countries and a source of income for subsistence farmers. Bananas are also a major, multibillion-dollar export commodity for consumption primarily in developed countries, where few banana cultivars are grown. The fungal pathogen Mycosphaerella fijiensis causes black leaf streak disease (BLSD; aka black Sigatoka leaf spot) on the majority of edible banana cultivars grown worldwide. The fact that most of these cultivars are sterile and unsuitable for the breeding of resistant lines necessitates the extensive use of fungicides as the primary means of disease control. BLSD is a significant threat to the food security of resource-poor populations who cannot afford fungicides, and increases the environmental and health hazards where large-acreage monocultures of banana (Cavendish subgroup, AAA genome) are grown for export. Mycosphaerella fijiensis M. Morelet is a sexual, heterothallic fungus having Pseudocercospora fijiensis (M. Morelet) Deighton as the anamorph stage. It is a haploid, hemibiotrophic ascomycete within the class Dothideomycetes, order Capnodiales and family Mycosphaerellaceae. Its taxonomic placement is based on DNA phylogeny, morphological analyses and cultural characteristics. Mycosphaerella fijiensis is a leaf pathogen that causes reddish-brown streaks running parallel to the leaf veins, which aggregate to form larger, dark-brown to black compound streaks. These streaks eventually form fusiform or elliptical lesions that coalesce, form a water-soaked border with a yellow halo and, eventually, merge to cause extensive leaf necrosis. The disease does not kill the plants immediately, but weakens them by decreasing the photosynthetic capacity of leaves, causing a reduction in the quantity and quality of fruit, and inducing the premature ripening of fruit harvested from infected plants. Although Musa spp. are the

  7. Screening for abdominalt aortaaneurisme

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Juul, Søren; Henneberg, E W

    1997-01-01

    In spite of increasing number of elective resections of abdominal aortic aneurysms (AAA) the mortality or ruptured AAA is increasing. The advantages of elective operations are obvious; the lethality is 2-6% while the lethality of ruptured AAA is 75-95%. However, AAA seldom causes symptoms before...... rupture. Ultrasonographic screening for AAA takes 10 minutes per scan, and the sensitivity and specificity are high. Ultrasonographic screening for AAA is a reliable, safe and inexpensive method for screening, and screening for AAA is discussed worldwide. One point four percent of deaths among men from 65...... to 80 year of age are caused by ruptured AAA. Screening men over 65 for AAA can theoretically prevent a substantial number of deaths. Our calculations predict one prevented AAA-death per 200-300 scans for a cost of about 4000 DKK per saved year of life. However, cost-benefit analyses are based...

  8. Hypoperfusion of the Adventitial Vasa Vasorum Develops an Abdominal Aortic Aneurysm.

    Directory of Open Access Journals (Sweden)

    Hiroki Tanaka

    Full Text Available The aortic wall is perfused by the adventitial vasa vasorum (VV. Tissue hypoxia has previously been observed as a manifestation of enlarged abdominal aortic aneurysms (AAAs. We sought to determine whether hypoperfusion of the adventitial VV could develop AAAs. We created a novel animal model of adventitial VV hypoperfusion with a combination of a polyurethane catheter insertion and a suture ligation of the infrarenal abdominal aorta in rats. VV hypoperfusion caused tissue hypoxia and developed infrarenal AAA, which had similar morphological and pathological characteristics to human AAA. In human AAA tissue, the adventitial VV were stenotic in both small AAAs (30-49 mm in diameter and in large AAAs (> 50 mm in diameter, with the sac tissue in these AAAs being ischemic and hypoxic. These results indicate that hypoperfusion of adventitial VV has critical effects on the development of infrarenal AAA.

  9. Adventitial vasa vasorum arteriosclerosis in abdominal aortic aneurysm.

    Directory of Open Access Journals (Sweden)

    Hiroki Tanaka

    Full Text Available Abdominal aortic aneurysm (AAA is a common disease among elderly individuals. However, the precise pathophysiology of AAA remains unknown. In AAA, an intraluminal thrombus prevents luminal perfusion of oxygen, allowing only the adventitial vaso vasorum (VV to deliver oxygen and nutrients to the aortic wall. In this study, we examined changes in the adventitial VV wall in AAA to clarify the histopathological mechanisms underlying AAA. We found marked intimal hyperplasia of the adventitial VV in the AAA sac; further, immunohistological studies revealed proliferation of smooth muscle cells, which caused luminal stenosis of the VV. We also found decreased HemeB signals in the aortic wall of the sac as compared with those in the aortic wall of the neck region in AAA. The stenosis of adventitial VV in the AAA sac and the malperfusion of the aortic wall observed in the present study are new aspects of AAA pathology that are expected to enhance our understanding of this disease.

  10. Correlação entre carga de trabalho de enfermagem e gravidade dos pacientes críticos gerais, neurológicos e cardiológicos

    Directory of Open Access Journals (Sweden)

    Ellen Maria Pires Siqueira

    2015-06-01

    Full Text Available Objetivo: Correlacionar gravidade do paciente e carga de trabalho da equipe de enfermagem, utilizando os índices Simplified Acute Psysiology Score (SAPS3 e Nursing Activities Score (NAS e compará-los entre três subgrupos: cardiológicos, neurológicos e gerais. Métodos: Coorte prospectivo, em uma Unidade de Terapia Intensiva de hospital privado de São Paulo, entre agosto a outubro de 2011. Resultados: Foram acompanhados 195 pacientes, 57,9% do sexo masculino, mediana de idade 69 anos. Correlação moderada entre NAS e SAPS3 no subgrupo neurológico (p = 0,02; r = 0,430. SAPS3 do subgrupo geral foi maior comparado ao subgrupo neurológico (p = 0,002. O NAS foi maior no subgrupo geral quando comparado ao subgrupo cardiológico (p = 0,001. Conclusão: Houve correlação moderada entre a gravidade de pacientes neurológicos e a carga de trabalho de enfermagem. A gravidade e a carga de trabalho de enfermagem no subgrupo de pacientes gerais foram maiores em relação aos pacientes neurológicos e cardiológicos, respectivamente.

  11. ApoA-I/HDL-C levels are inversely associated with abdominal aortic aneurysm progression

    DEFF Research Database (Denmark)

    Burillo, Elena; Lindholt, Jes S.; Molina-Sánchez, Pedro

    2015-01-01

    Abdominal aortic aneurysm (AAA) evolution is unpredictable, and there is no therapy except surgery for patients with an aortic size> 5 cm (large AAA). We aimed to identify new potential biomarkers that could facilitate prognosis and treatment of patients with AAA. A differential quantitative...... proteomic analysis of plasma proteins was performed in AAA patients at different stages of evolution [small AAA (aortic size=3-5 cm) vs large AAA] using iTRAQ labelling, high-throughput nano-LC-MS/MS and a novel multi-layered statistical model. Among the proteins identified, ApoA-I was decreased in patients...

  12. The use of fenestrated and branched endovascular aneurysm repair for juxtarenal and thoracoabdominal aneurysms: A systematic review and cost-effectiveness analysis

    NARCIS (Netherlands)

    N. Armstrong (Nigel); L.T. Burgers (Laura); S. Deshpande (Sohan); M.J. Al (Maiwenn); R. Riemsma; S.R. Vallabhaneni; P. Holt (Peter); J.L. Severens (Hans); J. Kleijnen (Jos)

    2015-01-01

    textabstractBackground: Patients with large abdominal aortic aneurysms (AAAs) are usually offered reparative treatment given the high mortality risk. There is uncertainty about how to treat juxtarenal AAAs (JRAAAs) or thoracoabdominal aortic aneurysms (TAAAs). Endovascular repair of an abdominal

  13. Association Between Diverticular Disease and Abdominal Aortic Aneurysms

    DEFF Research Database (Denmark)

    Mark-Christensen, Anders; Lindholt, Jes Sanddal; Diederichsen, Axel

    2017-01-01

    Background The aetiology of abdominal aortic aneurysms (AAA) is multifactorial, and many risk factors are shared with diverticular disease. It is unknown whether an independent association exists between these conditions. Methods Individuals enrolled in two Danish population based randomised AAA ...

  14. A review of macrolide treatment of atherosclerosis and abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Stovring, Jette; Andersen, Paul Lehm

    2003-01-01

    Seroepidemiological studies have shown an association between Chlamydia pneumoniae and atherosclerosis, the risk of acute myocardial infarction and abdominal aortic aneurysms (AAA). Several studies have detected C. pneumoniae in atherosclerotic lesions from coronary and carotid arteries, in AAA, ...

  15. Treatment of abdominal aortic aneurysm in nine countries 2005-2009: a vascunet report

    DEFF Research Database (Denmark)

    Mani, K; Lees, T; Beiles, B

    2011-01-01

    To study contemporary treatment and outcome of abdominal aortic aneurysm (AAA) repair in nine countries.......To study contemporary treatment and outcome of abdominal aortic aneurysm (AAA) repair in nine countries....

  16. Hospitalsomkostninger og nytte af screening for abdominalt aortaaneurisme. Resultater fra en randomiseret screeningsundersøgelse

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Juul, Svend; Fasting, Helge

    2003-01-01

    The hospital costs and benefits of screening older males for abdominal aortic aneurysms (AAA) are unknown.......The hospital costs and benefits of screening older males for abdominal aortic aneurysms (AAA) are unknown....

  17. Inform@ed space

    DEFF Research Database (Denmark)

    Bjerrum, Peter; Olsen, Kasper Nefer

    2001-01-01

    Inform@ed space Sensorial Perception And Computer Enchancement - bidrag til Nordisk Arkitekturforskningsforenings IT-konference, AAA april 2001.......Inform@ed space Sensorial Perception And Computer Enchancement - bidrag til Nordisk Arkitekturforskningsforenings IT-konference, AAA april 2001....

  18. Systemic levels of cotinine and elastase, but not pulmonary function, are associated with the progression of small abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Jørgensen, B; Klitgaard, N A

    2003-01-01

    to study whether smoking and impaired pulmonary function are associated with the expansion of abdominal aortic aneurysms (AAA).......to study whether smoking and impaired pulmonary function are associated with the expansion of abdominal aortic aneurysms (AAA)....

  19. Vascular surgical society of great britain and ireland: immunoglobulin A antibodies against chlamydia pneumoniae are associated with expansion of small abdominal aortic aneurysms and declining ankle blood pressure

    DEFF Research Database (Denmark)

    Lindholt, Jes S.; Vammen; Henneberg

    1999-01-01

    BACKGROUND: The potential correlation between chronic infection with Chlamydia pneumoniae and the progression of small abdominal aortic aneurysms (AAAs) and lower limb atherosclerosis was studied. METHODS: Mass screening for AAA was carried out in outdoor clinics at all hospitals in the county....... CONCLUSION: A high proportion of men with a small AAA have signs of chronic C. pneumoniae infection. The progression of AAAs and lower limb atherosclerosis seems to be correlated to chronic infection with C. pneumoniae....

  20. Plasma cathepsin S and cystatin C levels and risk of abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Lv, Bing-Jie; Lindholt, Jes Sanddal; Cheng, Xiang

    2012-01-01

    Human abdominal aortic aneurysm (AAA) lesions contain high levels of cathepsin S (CatS), but are deficient in its inhibitor, cystatin C. Whether plasma CatS and cystatin C levels are also altered in AAA patients remains unknown.......Human abdominal aortic aneurysm (AAA) lesions contain high levels of cathepsin S (CatS), but are deficient in its inhibitor, cystatin C. Whether plasma CatS and cystatin C levels are also altered in AAA patients remains unknown....

  1. Revascularización miocárdica de repetición tras cirugía de derivación coronaria en adultos mayores: experiencia nacional de la Sociedad de Cirujanos Torácicos, 1991–2007

    Directory of Open Access Journals (Sweden)

    Bernardo Romero-Ferrer

    2013-04-01

    Conclusiones: Infrecuentemente se repite la revascularización en los pacientes mayores sometidos a CABG; sin embargo, las proporciones varían de manera sustancial según los subgrupos de pacientes y los centros.

  2. The collected papers of Lord Rutherford of Nelson

    CERN Document Server

    Rutherford, Ernest

    1962-01-01

    This is the third of three volumes which together contain the complete range of Lord Rutherford's scientific papers, incorporating in addition addresses, general lectures, letters to editors, accounts of his scientific work and personal recollections by friends and colleagues. The final volume, first published in 1965, covers his period as Cavendish Professor from 1919 to 1937. Following on the immense fertility of his years in Manchester - only overshadowed towards the end by the war - we now turn to his last years as a world figure at the Cavendish Laboratory, where he continued his work on

  3. Doxycycline therapy for abdominal aneurysm: Improved proteolytic balance through reduced neutrophil content

    NARCIS (Netherlands)

    Abdul-Hussien, H.; Hanemaaijer, R.; Verheijen, J.H.; Bockel, J.H. van; Geelkerken, R.H.; Lindeman, J.H.N.

    2009-01-01

    Background: Matrix metalloproteinase-9 (MMP-9) is thought to play a central role in abdominal aortic aneurysm (AAA) initiation. Doxycycline, a tetracycline analogue, has direct MMP-9-inhibiting properties in vitro, and it effectively suppresses AAA development in rodents. Observed inhibition of AAA

  4. Validation of endovascular aneurysm sealing for treatment of abdominal aortic aneurysm

    NARCIS (Netherlands)

    Boersen, Johannes Thomas

    2017-01-01

    Infrarenal abdominal aortic aneurysm (AAA) is dilation of the infrarenal aorta of more than twice the normal diameter. The risk of AAA rupture increases with size. The standard treatment of infrarenal AAA is endovascular aneurysm repair (EVAR), in which the diseased part of the aorta is supported by

  5. From tissue iron retention to low systemic haemoglobin levels, new pathophysiological biomarkers of human abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Martinez-Pinna, Roxanna; Lindholt, Jes Sanddal; Madrigal-Matute, Julio

    2014-01-01

    Iron deposits are observed in tissue of abdominal aortic aneurysm (AAA) patients, although the underlying mechanisms are not completely elucidated. Therefore we explored circulating markers of iron metabolism in AAA patients, and tested if they could serve as biomarkers of AAA. Increased red bloo...

  6. Antagonism of toll-like receptor 2 attenuates the formation and progression of abdominal aortic aneurysm

    Directory of Open Access Journals (Sweden)

    Huimin Yan

    2015-05-01

    Full Text Available Abdominal aortic aneurysm (AAA is an inflammatory vascular disorder with high mortality. Accumulating evidence shows that toll-like receptor 2 (TLR2 plays a critical role in the regulation of wound-repairing process after tissue injury. We wondered if TLR2 signaling contributed to the pathogenesis of AAA and that targeting TLR2 would attenuate AAA development and progression. In this study, enhanced expression of TLR2 and its ligands were observed in human AAA tissue. Neutralization of TLR2 protected against AAA development and caused established AAA to regress in mouse models of AAA. In addition, TLR2-deficient mice also failed to develop AAA. The prophylactic and therapeutic effects of blocking TLR2 were accompanied by a significant resolution of inflammation and vascular remodeling, as indicated by the decreased expression or activity of MMP-2/9, α-SMA, inflammatory cytokines, and transcription factors NF-κB, AP-1 and STAT1/3 in AAA tissue. Mechanistically, blocking TLR2 decreased the expression and interaction of TLR2 and several endogenous ligands, which diminished chronic inflammation and vascular remodeling in the vascular tissue of AAA. Our studies indicate that the interactions between TLR2 and its endogenous ligands contribute to the pathogenesis of AAA and that targeting TLR2 offers great potential toward the development of therapeutic agents against AAA.

  7. The Bottom Line for U.S. Life Scientists

    National Research Council Canada - National Science Library

    Renuka Chander; Jeffrey Mervis

    2001-01-01

    ... be most helpful to the next generation of scientists. The questionnaire was developed by the AAAS membership office in consultation with other AAAS staff members, salary survey experts, and Shugoll Research of Bethesda, Maryland. It was mailed in June to a sample of 19,000 members, including those with no discipline listed in the AAAS files. The population ...

  8. Lack of association between inguinal hernia and abdominal aortic aneurysm in a population-based male cohort

    DEFF Research Database (Denmark)

    Henriksen, N A; Sorensen, L T; Jørgensen, Lars Nannestad

    2013-01-01

    Previous studies have reported a higher prevalence of inguinal hernia in patients with abdominal aortic aneurysm (AAA). The aim of this study was to explore the association between inguinal hernia and AAA in a large population-based cohort of men who had screening for AAA....

  9. Statin use and rupture of abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Wemmelund, H; Høgh, A; Hundborg, H H

    2014-01-01

    BACKGROUND: Ruptured abdominal aortic aneurysm (rAAA) is associated with high mortality. Research suggests that statins may reduce abdominal aortic aneurysm (AAA) growth and improve rAAA outcomes. However, the clinical impact of statins remains uncertain in relation to both the risk and prognosis...

  10. Meta-Analysis of Genome-Wide Association Studies for Abdominal Aortic Aneurysm Identifies Four New Disease-Specific Risk Loci

    NARCIS (Netherlands)

    Jones, Gregory T; Tromp, Gerard; Kuivaniemi, Helena; Gretarsdottir, Solveig; Baas, Annette F|info:eu-repo/dai/nl/26922517X; Giusti, Betti; Strauss, Ewa; Van't Hof, Femke N G; Webb, Thomas R; Erdman, Robert; Ritchie, Marylyn D; Elmore, James R; Verma, Anurag; Pendergrass, Sarah; Kullo, Iftikhar J; Ye, Zi; Peissig, Peggy L; Gottesman, Omri; Verma, Shefali S; Malinowski, Jennifer; Rasmussen-Torvik, Laura J; Borthwick, Kenneth M; Smelser, Diane T; Crosslin, David R; de Andrade, Mariza; Ryer, Evan J; McCarty, Catherine A; Böttinger, Erwin P; Pacheco, Jennifer A; Crawford, Dana C; Carrell, David S; Gerhard, Glenn S; Franklin, David P; Carey, David J; Phillips, Victoria L; Williams, Michael J A; Wei, Wenhua; Blair, Ross; Hill, Andrew A; Vasudevan, Thodor M; Lewis, David R; Thomson, Ian A; Krysa, Jo; Hill, Geraldine B; Roake, Justin; Merriman, Tony R; Oszkinis, Grzegorz; Galora, Silvia; Saracini, Claudia; Abbate, Rosanna; Pulli, Raffaele; Pratesi, Carlo; Saratzis, Athanasios; Verissimo, Ana R; Bumpstead, Suzannah; Badger, Stephen A; Clough, Rachel E; Cockerill, Gillian; Hafez, Hany; Scott, D Julian A; Futers, T Simon; Romaine, Simon P R; Bridge, Katherine; Griffin, Kathryn J; Bailey, Marc A; Smith, Alberto; Thompson, Matthew M; van Bockxmeer, Frank M; Matthiasson, Stefan E; Thorleifsson, Gudmar; Thorsteinsdottir, Unnur; Blankensteijn, Jan D; Teijink, Joep A W; Wijmenga, Cisca; de Graaf, Jacqueline; Kiemeney, Lambertus A; Lindholt, Jes S; Hughes, Anne; Bradley, Declan T; Stirrups, Kathleen; Golledge, Jonathan; Norman, Paul E; Powell, Janet T; Humphries, Steve E; Hamby, Stephen E; Goodall, Alison H; Nelson, Christopher P; Sakalihasan, Natzi; Courtois, Audrey; Ferrell, Robert E; Eriksson, Per; Folkersen, Lasse; Franco-Cereceda, Anders; Eicher, John D; Johnson, Andrew D; Betsholtz, Christer; Ruusalepp, Arno; Franzén, Oscar; Schadt, Eric E; Björkegren, Johan L M; Lipovich, Leonard; Drolet, Anne M; Verhoeven, Eric L; Zeebregts, Clark J; Geelkerken, Robert H; van Sambeek, Marc R; van Sterkenburg, Steven M; de Vries, Jean-Paul; Stefansson, Kari; Thompson, John R; de Bakker, Paul I W|info:eu-repo/dai/nl/342957082; Deloukas, Panos; Sayers, Robert D; Harrison, Seamus C; van Rij, Andre M; Samani, Nilesh J; Bown, Matthew J

    2017-01-01

    RATIONALE: Abdominal aortic aneurysm (AAA) is a complex disease with both genetic and environmental risk factors. Together, 6 previously identified risk loci only explain a small proportion of the heritability of AAA. OBJECTIVE: To identify additional AAA risk loci using data from all available

  11. Meta-Analysis of Genome-Wide Association Studies for Abdominal Aortic Aneurysm Identifies Four New Disease-Specific Risk Loci

    NARCIS (Netherlands)

    Jones, Gregory T.; Tromp, Gerard; Kuivaniemi, Helena; Gretarsdottir, Solveig; Baas, Annette F.; Giusti, Betti; Strauss, Ewa; van't Hof, Femke N. G.; Webb, Thomas R.; Erdman, Robert; Ritchie, Marylyn D.; Elmore, James R.; Verma, Anurag; Pendergrass, Sarah A; Kullo, Iftikhar J.; Zy, Zi Ye; Peissig, Peggy L.; Gottesman, Omri; Verma, Shefali S.; Malinowski, Jennifer; Rasmussen-Torvik, Laura J.; Borthwick, Kenneth M.; Smelser, Diane T.; Crosslin, David R; de Andrade, Mariza; Ryer, Evan J.; McCarty, Catherine A.; Bottinger, Erwin P.; Pacheco, Jennifer A.; Crawford, Dana C.; Carrell, David S; Gerhard, Glenn S.; Franklin, David P.; Carey, David J.; Phillips, Victoria L.; Williams, Michael J. A.; Wei, Wenhua; Blair, Ross; Hill, Andrew A.; Vasudevan, Thodor M.; Lewis, David R.; Thomson, Ian A.; Krysa, Jo; Hill, Geraldine B.; Roake, Justin; Merriman, Tony R.; Oszkinis, Grzegorz; Galora, Silvia; Saracini, Claudia; Abbate, Rosanna; Pulli, Raffaele; Pratesi, Carlo; Saratzis, Athanasios; Verissimo, Ana R.; Bumpstead, Suzannah; Badger, Stephen A.; Clough, Rachel E.; Cockerill, Gillian; Hafez, Hany; Scott, D. Julian A.; Futers, T. Simon; Romaine, Simon P. R.; Bridge, Katherine; Griffin, Kathryn J.; Bailey, Marc A.; Smith, Alberto; Thompson, Matthew; van Bockxmeer, Frank M.; Matthiasson, Stefan E.; Thorleifsson, Gudmar; Thorsteinsdottir, Unnur; Blankensteijn, Jan D.; Teijink, Joep A. W.; Wijmenga, Cisca; de Graaf, Jacqueline; Kiemeney, Lambertus A.; Lindholt, Jes S.; Hughes, Anne E.; Bradley, Declan T.; Stirrups, Kathleen; Golledge, Jonathan; Norman, Paul E.; Powell, Janet T.; Humphries, Steve E.; Hamby, Stephen E.; Goodall, Alison H.; Nelson, Christopher P.; Sakalihasan, Natzi; Courtois, Audrey; Ferrell, Robert E.; Eriksson, Per; Folkersen, Lasse; Franco-Cereceda, Anders; Eicher, John D.; Johnson, Andrew D.; Betsholtz, Christer; Ruusalepp, Arno; Franzen, Oscar; Schadt, Eric; Bjorkegren, Johan L. M.; Lipovich, Leonard; Drolet, Anne M.; Verhoeven, Eric L.; Zeebregts, Clark J.; Geelkerken, Robert H.; Sambeek, Marc R.; van Sterkenburg, Steven M.; De Vries, Jean-Paul; Stefansson, Kari; Thompson, John R.; de Bakker, Paul I. W.; Deloukas, Panos; Sayers, Robert D.; Harrison, Seamus C.; van Rij, Andre M.; Samani, Nilesh J.; Bown, Matthew J.

    2017-01-01

    Rationale: Abdominal aortic aneurysm (AAA) is a complex disease with both genetic and environmental risk factors. Together, 6 previously identified risk loci only explain a small proportion of the heritability of AAA. Objective: To identify additional AAA risk loci using data from all available

  12. Association of Ficolin-3 with abdominal aortic aneurysm presence and progression

    DEFF Research Database (Denmark)

    Fernandez-García, Carlos-Ernesto; Burillo, Elena; Lindholt, Jes S

    2017-01-01

    from healthy tissue. Moreover, ficolin-3 mRNA levels in AAA wall were greatly increased compared with healthy aortic walls. Immunohistochemistry of AAA tissue demonstrated increased ficolin-3, while little staining was present in healthy walls. Finally, increased ficolin-3 levels were observed in AAA...

  13. High prevalence of unsuspected abdominal aortic aneurysms in patients hospitalised for surgical coronary revascularisation.

    Science.gov (United States)

    Monney, Pierre; Hayoz, Daniel; Tinguely, Francine; Cornuz, Jacques; Haesler, Erik; Mueller, Xavier M; von Segesser, Ludwig K; Tevaearai, Hendrik T

    2004-01-01

    Prevalence of abdominal aortic aneurysms (AAA) is not exactly known among patients with coronary artery disease (CAD) who are considered for surgical revascularisation. We evaluated the value of screening AAA among coronary patients admitted in our cardiovascular surgery unit. Over a 24-month period, an abdominal echography was proposed to male patients aged 60 or more while hospitalised for surgical coronary revascularisation. Patients with previous investigation of the aorta were excluded. The aorta was considered aneurysmal when the anterior-posterior diameter was of 30 mm or more. Three hundred and ninety-five consecutive patients all accepted a proposed abdominal echographic screening for AAA. Forty unsuspected AAA were detected (10.1%). The mean diameter was 38.9 +/- 1.3 mm. Four AAA were larger than 50 mm and considered for surgery after the CABG procedure. Surveillance was proposed to the other 36, especially the 10 patients with an AAA larger than 40 mm. Patients with AAA were significantly older than those without AAA (71.3 +/- 0.8 vs. 69.4 +/- 0.3 years, P<0.05). Smoking history (P<0.05) and hypertension (P<0.05) were also associated more frequently with AAA. More than 16% of the patients being smokers and suffering hypertension presented with unsuspected AAA. In-hospital screening of AAA is very efficient among patients with coronary artery disease. Therefore, patients with CAD may be considered for routine AAA screening.

  14. Risk stratification of aortic aneurysms : Predictors of natural and clinical course

    NARCIS (Netherlands)

    Schlösser, F.J.V.

    2008-01-01

    Rupture of an abdominal aortic aneurysm (AAA) is a dramatic and often fatal process with an overall risk of mortality that ranges from 79 to 94%. The risk of AAA rupture increases strongly with increasing diameter of the AAA. Approximately 14,000 persons die each year due to aortic aneurysm rupture

  15. Hemoglobin induces monocyte recruitment and CD163-macrophage polarization in abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Rubio-Navarro, Alfonso; Amaro Villalobos, Juan Manuel; Lindholt, Jes S

    2015-01-01

    163 expressing macrophages ex vivo, in vitro and in human AAA. METHODS AND RESULTS: CD163 mRNA and protein expression was significantly higher in human AAA (n=7) vs. healthy wall (n=6). CD163 was predominantly found in adventitia of AAA, coinciding with areas rich in hemosiderin and adjacent...

  16. Hospitalization rates and post-operative mortality for abdominal aortic aneurysm in Italy over the period 2000-2011.

    Directory of Open Access Journals (Sweden)

    Luigi Sensi

    Full Text Available BACKGROUND: Recent studies have reported declines in incidence, prevalence and mortality for abdominal aortic aneurysms (AAAs in various countries, but evidence from Mediterranean countries is lacking. The aim of this study is to examine the trend of hospitalization and post-operative mortality rates for AAAs in Italy during the period 2000-2011, taking into account the introduction of endovascular aneurysm repair (EVAR in 1990s. METHODS: This retrospective cohort study was carried out in Emilia-Romagna, an Italian region with 4.5 million inhabitants. A total of 19,673 patients hospitalized for AAAs between 2000 and 2011, were identified from the hospital discharge records (HDR database. Hospitalization rates, percentage of OSR and EVAR and 30-day mortality rates were calculated for unruptured (uAAAs and ruptured AAAs (rAAAs. RESULTS: Adjusted hospitalization rates decreased on average by 2.9% per year for uAAAs and 3.2% for rAAAs (p<0.001. The temporal trend of 30-day mortality rates remained stable for both groups. The percentage of EVAR for uAAAs increased significantly from 2006 to 2011 (42.7 versus 60.9% respectively, mean change of 3.9% per year, p<0.001. No significant difference in mortality was found between OSR and EVAR for uAAAs and rAAAs. CONCLUSIONS: The incidence and trend of hospitalization rates for rAAAs and uAAAs decreased significantly in the last decade, while 30-day mortality rates in operated patients remained stable. OSR continued to be the most common surgery in rAAAs, although the gap between OSR and EVAR recently declined. The EVAR technique became the preferred surgery for uAAAs since 2008.

  17. Immunoglobulin A antibodies against Chlamydia pneumoniae are associated with expansion of abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Lindholt, J.S; Juul, Svend; Vammen, S

    1999-01-01

    BACKGROUND: The aim of this study was to examine the possible association between the progression of small abdominal aortic aneurysm (AAA) and chronic infection with Chlamydia pneumoniae. METHODS: Patients from a hospital-based mass screening programme for AAA with annual follow-up (mean 2.7 years...... or more was a significant independent predictor of increased AAA expansion, adjusted for known risk factors of expansion. Initial AAA size and serum total cholesterol level were also predictors of expansion. CONCLUSION: A high proportion of men with a small AAA had signs of chronic infection with C...

  18. The Antiaircraft Journal. Volume 93, Number 2, March-April 1950

    Science.gov (United States)

    1950-04-01

    Precedents for such control had been established in England where the RAF took under 12 its control the British Army AAA and in Germany, AAA was a part of...34 974 RAF Balloon Squad- ron (see map), and were supported by an additional nine AAA automatic weapons battalions, deployed covering the approaches...Caoc I Borden, H. W., to 504th AAA Gun Bn, Ft Custer , Mich. Bradshaw, N. F., to 78th AAA Gun Bn. FI Lewis, Wash. Brantley, Ed, Jr., to US Army Alaska

  19. Update on Abdominal Aortic Aneurysm Research: From Clinical to Genetic Studies

    Directory of Open Access Journals (Sweden)

    Helena Kuivaniemi

    2014-01-01

    Full Text Available An abdominal aortic aneurysm (AAA is a dilatation of the abdominal aorta with a diameter of at least 3.0 cm. AAAs are often asymptomatic and are discovered as incidental findings in imaging studies or when the AAA ruptures leading to a medical emergency. AAAs are more common in males than females, in individuals of European ancestry, and in those over 65 years of age. Smoking is the most important environmental risk factor. In addition, a positive family history of AAA increases the person’s risk for AAA. Interestingly, diabetes has been shown to be a protective factor for AAA in many large studies. Hallmarks of AAA pathogenesis include inflammation, vascular smooth muscle cell apoptosis, extracellular matrix degradation, and oxidative stress. Autoimmunity may also play a role in AAA development and progression. In this Outlook paper, we summarize our recent studies on AAA including clinical studies related to surgical repair of AAA and genetic risk factor and large-scale gene expression studies. We conclude with a discussion on our research projects using large data sets available through electronic medical records and biobanks.

  20. Cyclooxygenase-2 inhibition attenuates abdominal aortic aneurysm progression in hyperlipidemic mice.

    Directory of Open Access Journals (Sweden)

    Sarbani Ghoshal

    Full Text Available Abdominal aortic aneurysms (AAAs are a chronic inflammatory disease that increase the risk of life-threatening aortic rupture. In humans, AAAs have been characterized by increased expression of cyclooxygenase-2 and the inactivation of COX-2 prior to disease initiation reduces AAA incidence in a mouse model of the disease. The current study examined the effectiveness of selective cyclooxygenase-2 (COX-2 inhibition on reducing AAA progression when administered after the initiation of AAA formation. AAAs were induced in hyperlipidemic apolipoprotein E-deficient mice by chronic angiotensin II (AngII infusion and the effect of treatment with the COX-2 inhibitor celecoxib was examined when initiated at different stages of the disease. Celecoxib treatment that was started 1 week after initiating AngII infusion reduced AAA incidence by 61% and significantly decreased AAA severity. Mice treated with celecoxib also showed significantly reduced aortic rupture and mortality. Treatment with celecoxib that was started at a late stage of AAA development also significantly reduced AAA incidence and severity. Celecoxib treatment significantly increased smooth muscle alpha-actin expression in the abdominal aorta and did not reduce expression of markers of macrophage-dependent inflammation. These findings indicate that COX-2 inhibitor treatment initiated after formation of AngII-induced AAAs effectively reduces progression of the disease in hyperlipidemic mice.

  1. Time trends in hospital admissions and mortality due to abdominal aortic aneurysms in France, 2002-2013.

    Science.gov (United States)

    Robert, M; Juillière, Y; Gabet, A; Kownator, S; Olié, V

    2017-05-01

    Abdominal aortic aneurysms (AAA) are serious disease with a high fatality rate but recent epidemiologic data showed a decrease of AAA mortality. Our objective was to estimate, in France, the hospitalization, inhospital mortality and mortality rates due to AAA and to analyze their trends over time. Hospitalization data were extracted from the hospital discharge summaries in the national database between 2002 and 2013. The analysis covered all patients hospitalized for AAA as a principal diagnosis. During the same period, all death certificates mentioning AAA as an initial cause of death were included in the study. Crude and standardized rates were calculated according to age and sex. Poisson regression was used to analyze the average annual percent change. In 2013, there were 8853 patients hospitalized for AAA in France (7986 unruptured and 867 ruptured). Between 2002 and 2013, the rate of patients hospitalized for unruptured AAA decreased slightly in men (-5.0%) but increased in women (+5.2%). By contrast, the rate of patients hospitalized for ruptured AAA has decreased by >20% in men and women. The proportion of endovascular treatment of unruptured AAA rose from <10% in 2005 to 35% in women and 40% in men in 2013. In 2013, 939 deaths from AAA were recorded. Mortality for this disease declined significantly from 2002 to 2013 in men and women. The unfavorable epidemiological trends in women and important evolution of the management of AAA call for an epidemiological surveillance of this disease. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Foreløbige resultater af screening for abdominalt aortaaneurisme i Viborg Amt

    DEFF Research Database (Denmark)

    Lindholt, J S; Fasting, H; Henneberg, E W

    1997-01-01

    The incidence of abdominal aortic aneurysms (AAA) and ruptured AAA is increasing. One to three percent of deaths among 65-80 year-old males are caused by AAA. Sixty-six to ninety-five percent of ruptured AAA are lethal, while elective resection has a 3-6% operative mortality. Most AAA's are asymp......The incidence of abdominal aortic aneurysms (AAA) and ruptured AAA is increasing. One to three percent of deaths among 65-80 year-old males are caused by AAA. Sixty-six to ninety-five percent of ruptured AAA are lethal, while elective resection has a 3-6% operative mortality. Most AAA...... of three years. In 1994-1995 4938 were invited and 3748 were scanned, resulting in an acceptance rate of 76%. The aorta was visible in 99.7%, and the total time consumption was 9.7 minutes per scan. The costs were 83.75 DKK per scan. One hundred and fifty-three (4.1%) had an AAA defined as an aortic...

  3. Hospitalsomkostninger og nytte af screening for abdominalt aortaaneurisme. Resultater fra en randomiseret screeningsundersøgelse

    DEFF Research Database (Denmark)

    Lindholt, Jes S; Juul, Svend; Fasting, Helge

    2003-01-01

    INTRODUCTION: The hospital costs and benefits of screening older males for abdominal aortic aneurysms (AAA) are unknown. MATERIAL AND METHODS: In 1994, a hospital-based screening trial of 12,658 65-73-year-old males in the County of Viborg, Denmark, was started. AAA > 5 cm were referred for surgery....... The remaining AAA were offered annual control scans. Those with aortic ectasia (def.: 2.5-2.9 cm) were rescreened at 5-year intervals. AAA-operations and deaths of AAA at hospital were registered. Finally, costs of screening, surveillance, and treatment were registered. Data on causes of death outside hospitals...... could not be obtained. RESULTS: The attendance rate was 76%, of whom 191 (4.0%) had AAA. The average observation time was 5.13 years. 60 in the screened and 41 in the control group were operated (P = 0.06), 7 and 27 were operated as an emergency (P AAA...

  4. Abdominal aortic aneurysm, arterial stiffening and the role of the intraluminal thrombus

    DEFF Research Database (Denmark)

    Lyck Hansen, Maria; Dahl Thomsen, Marie; Melholt Rasmussen, Lars

    2015-01-01

    PATIENTS AND METHODS: PWV and PWA were measured in male patients with AAA from an ongoing Danish AAA screening trial. Information on blood pressure, medications, BMI and smoking status was obtained at inclusion. RESULTS: In total, 157 patients were included. Mean age was 73 years. Mean AAA size...... was 42.2 mm. Fifty-six of the patients had an intraluminal thrombus, and patients with AAA and ILT had a significantly higher Aix75 than patients with AAA but without ILT (Mean = 28.3 ± 1.4 SEM vs. 24.9 ± 0.81, p=0.027), a difference that was also significant when adjusting for AAA size, blood pressure...... and age. There was no difference in PWV between the groups. CONCLUSIONS: Haemodynamic properties of the aorta are affected by the presence of ILT in patients with AAA that is not explained by aortic size. Alternatively, these findings could be explained by associations between ILT and properties...

  5. First report of alternaria leaf spot of banana caused by Alternaria alternata in the United States

    Science.gov (United States)

    Research efforts were initiated in 2003 to identify and introduce banana (Musa spp.) cultivars suitable for production in Georgia. In spring and summer 2012, seven of the cultivars (Veinte Cohol, Novaria, Cacambou, Chinese Cavendish, Raja Puri, Blue Torres Island, and African Red) grown in the field...

  6. 7. Lungu

    African Journals Online (AJOL)

    therefore are to correct the deformity, improve the function and improve the cosmesis and above all physical therapy to maintain the range of motion and improve strength is a requirement. There are, however, factors that must be considered before surgery. Cosmesis will be considered in patients with a Cavendish Grade III ...

  7. Friend, Prof. Sir Richard

    Indian Academy of Sciences (India)

    Date of birth: 18 January 1953. Address: Cavendish Laboratory, JJ Thomson Avenue, Cambridge CB3 0HE, UK Contact: Office: (+44-1223) 337 218. Email: rhf10@cam.ac.uk. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the Three ...

  8. Modifying Bananas: From Transgenics to Organics?

    Directory of Open Access Journals (Sweden)

    James Dale

    2017-02-01

    Full Text Available Bananas are one of the top ten world food crops. Unlike most other major food crops, bananas are difficult to genetically improve. The challenge is that nearly all banana cultivars and landraces are triploids, with high levels of male and female infertility. There are a number of international conventional breeding programs and many of these are developing new cultivars. However, it is virtually impossible to backcross bananas, thus excluding the possibility of introgressing new traits into a current cultivar. The alternative strategy is to “modify” the cultivar itself. We have been developing the capacity to modify Cavendish bananas and other cultivars for both disease resistance and enhanced fruit quality. Initially, we were using transgenes; genes that were derived from species outside of the Musa or banana genus. However, we have recently incorporated two banana genes (cisgenes into Cavendish; one to enhance the level of pro-vitamin A and the other to increase the resistance to Panama disease. Modified Cavendish with these cisgenes have been employed in a field trial. Almost certainly, the next advance will be to edit the Cavendish genome, to generate the desired traits. As these banana cultivars are essentially sterile, transgene flow and the outcrossing of modified genes into wild Musa species. are highly unlikely and virtually impossible in other triploid cultivars. Therefore, genetic changes in bananas may be compatible with organic farming.

  9. proliferation and shoot recovery among the east african highland ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Uptake and metabolism of 6- benzyladenine in shoot proliferation of Musa and Rhododendron. Plant Cell, Tissue and. Organ Culture 25:69-74. Damasco, O.P., Smith, M.K. and Adkins, S.W.. 1996. Gibberellic acid detection of dwarf offtypes in micropropagated Cavendish bananas. Australian Journal of Experimental.

  10. agronomic performance of introduced banana varieties in lowlands ...

    African Journals Online (AJOL)

    jen

    yield characteristics over two successive crop cycles. The experimental material consisted of nine varieties: FHIA 17, FHIA 18, FHIA 21, FHIA. 23, FHIA25, SH 3640 and SH 3436-9 obtained from. Bioversity International via Du Roi tissue culture laboratory, South Africa; Poyo (Cavendish sub- group, dessert variety) from ISAR ...

  11. Flicker noise in degenerately doped Si single crystals near the metal ...

    Indian Academy of Sciences (India)

    In this paper we report some of the important results of experimental investigations of the flicker noise near the metal–insulator (MI) transition in doped silicon ... Department of Physics, Indian Institute of Science, Bangalore 560 012, India; Cavendish Laboratory, University of Cambridge, Madingley Road, Cambridge, UK ...

  12. Page 1 44 N P Weatherill Benek J A, Buning P G. Steger J L 1985 A ...

    Indian Academy of Sciences (India)

    methods in fluid dynamics (3) (eds) K W Morton, M J Baines (Oxford: University Press) p. 187. Bowyer A 1981 Computing Dirichlet tessellations. Comput. J. 24. 162–166. Cavendish J C, Field D A, Frey W H 1985 An approach to automatic three-dimensional finite element mesh generation. Int. J. Numer. Methods Eng. 21: ...

  13. Controlled wear of vitrified abrasive materials for precision grinding ...

    Indian Academy of Sciences (India)

    Cavendish Laboratory, University of Cambridge, Madingley Road, Cambridge, CB3 0HE, United Kingdom; Machining Research Group, Department of Engineering, University of Liverpool, P.O. Box 147, Liverpool, L69 3BX, United Kingdom; Clarendon Laboratory, University of Oxford, Parks Road, Oxford, OX1 3PU, United ...

  14. Preliminary evaluation of improved banana varieties in Mozambique.

    African Journals Online (AJOL)

    Administrator

    Banana (Musa spp.) production in Mozambique is largely confined to the Cavendish variety that is eaten as a dessert. On the other hand, banana is a staple food crop in many countries in sub-Saharan Africa. The introduc- tion of a range of high yielding and disease resistant cooking and dessert varieties in Mozambique ...

  15. CONSTITUTIONALISM

    African Journals Online (AJOL)

    eliasn

    1 Hilaire Barnett, Constitutional and Administrative Law 5 (London: Cavendish ... 3(2) Mizan Law Rev. NOTES ON CONSTITUTIONALISM. 359 independent judiciary, respect for individual rights and the right to self- determination as essential ..... “Our principle is the party commands the gun, and the gun must never be.

  16. Impact of Diseases on Export and Smallholder Production of Banana

    NARCIS (Netherlands)

    Ploetz, R.C.; Kema, G.H.J.; Ma, Li Jun

    2015-01-01

    Banana (Musa spp.) is one of the world's most valuable primary agricultural commodities. Exported fruit are key commodities in several producing countries yet make up less than 15 of the total annual output of 145 million metric tons (MMT). Transnational exporters market fruit of the Cavendish

  17. Combating a Global Threat to a Clonal Crop: Banana Black Sigatoka Pathogen Pseudocercospora fijiensis (Synonym Mycosphaerella fijiensis) Genomes Reveal Clues for Disease Control

    NARCIS (Netherlands)

    Arango Isaza, Rafael E.; Diaz-Trujillo, Caucasella; Dhillon, Braham; Aerts, Andrea; Carlier, Jean; Crane, Charles F.; V. de Jong, Tristan; de Vries, Ineke; Dietrich, Robert; Farmer, Andrew D.; Fortes Fereira, Claudia; Garcia, Suzana; Guzman, Mauricio; Hamelin, Richard C.; Lindquist, Erika A.; Mehrabi, Rahim; Quiros, Olman; Schmutz, Jeremy; Shapiro, Harris; Reynolds, Elizabeth; Scalliet, Gabriel; Souza Manoel, Jr.; Stergiopoulos, Ioannis; Van der Lee, Theo A. J.; De Wit, Pierre J. G. M.; Zapater, Marie-Françoise; Zwiers, Lute-Harm; Grigoriev, Igor V.; Goodwin, Stephen B.; Kema, Gert H. J.

    2016-01-01

    Black Sigatoka or black leaf streak disease, caused by the ascomycete fungus Pseudocercospora fijiensis, inflicts huge costs on banana producers, due to crop losses and expenses for disease control. The global banana export trade relies on Cavendish clones that are highly susceptible to P.

  18. The Discovery of the Double Helix

    CERN Multimedia

    CERN. Geneva

    2011-01-01

    Professor James D. Watson has kindly agreed to make a presentation on the 1953 finding of the Double Helix at the Cavendish Laboratory by Francis Crick and himself. Being one of the greatest scientific discoveries in human history, little else needs to be added.

  19. Caracterización morfológica y contenido de almidón resistente y disponible en bananos (Musa sapientum) exportables del Ecuador

    National Research Council Canada - National Science Library

    Martínez-Mora, Edison Omar

    2015-01-01

    ... en almidón resistente (AR) y disponible (AD), de las variedades de banano de exportación: Cavendish (AC), Filipino (AF), Orito (AO) y Valery (AV).Material y Métodos: Se determinó tamaño y forma del gránulo de almidón a través de microscopia...

  20. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the N16-FliM might be sandwiched between CheY and the remainder of FliM to change the direction of flagellar rotation.

  1. Cryo electron microscopy structures of Hsp100 proteins: crowbars in or out?This paper is one of a selection of papers published in this special issue entitled 8th International Conference on AAA Proteins and has undergone the Journal's usual peer review process

    National Research Council Canada - National Science Library

    Wendler, Petra; Saibil, Helen R

    2010-01-01

    Independent cryo electron microscopy (cryo-EM) studies of the closely related protein disaggregases ClpB and Hsp104 have resulted in two different models of subunit arrangement in the active hexamer...

  2. Monitoreo asistido de plantaciones agrícolas: Técnicas de procesamiento digital de imágenes e inteligencia artificial para diagnosticar y controlar la incidencia de la Sigatoka Negra (Mycosphaerella fijiensis var diformis Morelet) en plantaciones de banano (Musa spp. cv. AAA) y plátano curraré (Musa spp. cv. AAB).

    OpenAIRE

    Vargas-Jarquín, Edgardo; Alvarado-Moya, José Pablo; Muñoz,Carlos; Umaña, Denis; Alarcon, Teresa; Rodríguez, Roberto; Guevara, Miguel Angel

    2012-01-01

    Informe Final de Proyecto de Investigación. La mayor limitación que enfrenta la producción de musáceas es ocasionada por la enfermedad sigatoka negra o la mancha de la hoja donde el agente causal es Mycosphaerella fijiensis var diformis Morelet (Jegert et al, 1996). En el Instituto Tecnológico de Costa Rica se inició en el año 2000 un proyecto de investigación que contemplaba pruebas agronómicas y el desarrollo de un sistema de información computacional para el procesamiento de informac...

  3. Efecto de la aplicación de compost y nematicida sobre la dinámica de las poblaciones de microorganismos, nematodos fitoparásitos del suelo y la salud del sistema radical en el cultivo del banano (Musa AAA sembrado en domos

    Directory of Open Access Journals (Sweden)

    María Araya

    2014-12-01

    Full Text Available Se evaluó el efecto de la aplicación de 6 dosis de compost más un testigo, en interacción con la aplicación ó no aplicación de nematicida, sobre la dinámica de las poblaciones de microorganismos del suelo (bacterias, hongos y actinomicetes, las poblaciones de nematodos fitoparásitos y la salud del sistema radical en el cultivo del banano. Los resultados obtenidos no indicaron diferencias en las poblaciones de microorganismos con respecto a las diferentes dosis de compost ni con respecto a la aplicación ó no aplicación de nematicida. En cuanto a los índices de diversidad biológica, en las poblaciones de hongos, no se obtuvieron diferencias de acuerdo con las dosis de compost, pero sí en lo referente a la aplicación ó no aplicación de nematicida, siendo mayor en el primer caso para la variable riqueza. La sanidad del sistema radical no difirió con las diferentes dosis de compost ni con ó sin nematicida, solamente hubo diferencias según los muestreos realizados. Por último, las poblaciones de nematodos fitoparásitos no presentaron diferencias debidas a las dosis de compost, a excepción de Pratylenchus. Con respecto a la aplicación de nematicida, todas las poblaciones fueron mayores en el área donde no se aplicó nematicida.

  4. Possible dual role of decorin in abdominal aortic aneurysm.

    Directory of Open Access Journals (Sweden)

    Koshiro Ueda

    Full Text Available Abdominal aortic aneurysm (AAA is characterized by chronic inflammation, which leads to pathological remodeling of the extracellular matrix. Decorin, a small leucine-rich repeat proteoglycan, has been suggested to regulate inflammation and stabilize the extracellular matrix. Therefore, the present study investigated the role of decorin in the pathogenesis of AAA. Decorin was localized in the aortic adventitia under normal conditions in both mice and humans. AAA was induced in mice using CaCl2 treatment. Initially, decorin protein levels decreased, but as AAA progressed decorin levels increased in all layers. Local administration of exogenous decorin prevented the development of CaCl2-induced AAA. However, decorin was highly expressed in the degenerative lesions of human AAA walls, and this expression positively correlated with matrix metalloproteinase (MMP-9 expression. In cell culture experiments, the addition of decorin inhibited secretion of MMP-9 in vascular smooth muscle cells, but had the opposite effect in macrophages. The results suggest that decorin plays a dual role in AAA. Adventitial decorin in normal aorta may protect against the development of AAA, but macrophages expressing decorin in AAA walls may facilitate the progression of AAA by up-regulating MMP-9 secretion.

  5. Allosteric Communication in the Dynein Motor Domain

    Science.gov (United States)

    Bhabha, Gira; Cheng, Hui-Chun; Zhang, Nan; Moeller, Arne; Liao, Maofu; Speir, Jeffrey A.; Cheng, Yifan; Vale, Ronald D.

    2014-01-01

    SUMMARY Dyneins power microtubule motility using ring-shaped, AAA-containing motor domains. Here, we report X-ray and electron microscopy (EM) structures of yeast dynein bound to different ATP analogs, which collectively provide insight into the roles of dynein’s two major ATPase sites, AAA1 and AAA3, in the conformational change mechanism. ATP binding to AAA1 triggers a cascade of conformational changes that propagate to all six AAA domains and cause a large movement of the “linker,” dynein’s mechanical element. In contrast to the role of AAA1 in driving motility, nucleotide transitions in AAA3 gate the transmission of conformational changes between AAA1 and the linker, suggesting that AAA3 acts as a regulatory switch. Further structural and mutational studies also uncover a role for the linker in regulating the catalytic cycle of AAA1. Together, these results reveal how dynein’s two major ATP-binding sites initiate and modulate conformational changes in the motor domain during motility. PMID:25417161

  6. Expression and Cellular Localization of 15-Hydroxy-Prostaglandin-Dehydrogenase in Abdominal Aortic Aneurysm.

    Directory of Open Access Journals (Sweden)

    David Solà-Villà

    Full Text Available PGE2 has been implicated in abdominal aortic aneurysm (AAA associated hypervascularization. PGE2-metabolism involves 15-hydroxyprostaglandin-dehydrogenase (15-PGDH the expression of which in AAA is unknown. The aim of this study was to examine the expression and cell distribution of 15-PGDH in AAA. Here, we show that 15-PGDH mRNA levels were significantly higher in aorta samples from patients undergoing AAA repair than in those from healthy multiorgan donors. Consequently, the ratio of metabolized PGE2 secreted by aortic samples was significantly higher in AAA. AAA production of total PGE2 and PGE2 metabolites correlated positively with PGI2 production, while the percentage of metabolized PGE2 correlated negatively with the total amount of PGE2 and with PGI2. Transcript levels of 15-PGDH were statistically associated with leukocyte markers but did not correlate with microvascular endothelial cell markers. Immunohistochemistry revealed 15-PGDH in the areas of leukocyte infiltration in AAA samples, mainly associated with CD45-positive cells, but not in normal aorta samples. We provide new data concerning 15-PGDH expression in human AAA, showing that 15-PGDH is upregulated in AAA and mainly expressed in infiltrating leukocytes. Our data suggest that microvasculature was not involved in PGE2 catabolism, reinforcing the potential role of microvasculature derived PGE2 in AAA-associated hypervascularization.

  7. New Insights into Effects of Aromatic Amino Acids on Hydroxyapatite.

    Science.gov (United States)

    Guo, Y R; Yang, X; Feng, X W; Sa, Y; Wang, M; Li, P; Jiang, T

    2017-11-01

    Biomimetics inspired by superstructures and extraordinary properties of teeth have resulted in tooth repair and the generation of novel materials. However, little attention has been paid to tooth color, whose origin remains unknown. Based on recent studies, fluorophores-mainly aromatic amino acids (AAAs) in proteins-might be responsible for tooth color. We synthesized carbonated hydroxyapatite (HA; the mineral phase of teeth) in the presence of different amino acids (AAs; the basic units of protein matrix of teeth) as a simplified model of teeth to explore the color source at the AA level. After measuring the fluorescence and color characteristics of HA-AAs before and after bleaching treatment, we found that only HA, synthesized in the presence of AAAs, exhibited remarkable fluorescence and color property. Furthermore, linearly increased fluorescence intensity and deeper color were observed with an increase in AAA content in HA-AAAs. Similarly, significantly decreased absorbance of HA-AAAs between 250 and 300 nm in ultraviolet spectra, declined fluorescence intensity, and decolored performance of HA-AAAs were observed after bleaching treatment. The results showed that AAAs contributed to the fluorescence and color properties of HA and that hydrogen peroxide might whiten HA-AAAs by oxidizing the benzene ring in AAAs. These findings are of great significance in promoting the synthesis of advanced tooth-colored materials and furthering our understanding of the possible mechanisms of hydrogen peroxide. Moreover, our study shed light on the importance of AAAs and might provide new ideas for investigations of biomineralization and biomimetics.

  8. Abdominal aortic aneurysm is associated with a variant in low-density lipoprotein receptor-related protein 1

    DEFF Research Database (Denmark)

    Bown, Matthew J; Jones, Gregory T; Harrison, Seamus C

    2011-01-01

    Abdominal aortic aneurysm (AAA) is a common cause of morbidity and mortality and has a significant heritability. We carried out a genome-wide association discovery study of 1866 patients with AAA and 5435 controls and replication of promising signals (lead SNP with a p value ... additional cases and 32,687 controls and performed further follow-up in 1491 AAA and 11,060 controls. In the discovery study, nine loci demonstrated association with AAA (p ...-density-lipoprotein receptor-related protein 1 (LRP1) demonstrated significant association (p = 0.0042). We confirmed the association of rs1466535 and AAA in our follow-up study (p = 0.035). In a combined analysis (6228 AAA and 49182 controls), rs1466535 had a consistent effect size and direction in all sample sets (combined...

  9. The validity of ultrasonographic scanning as screening method for abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Lindholt, J.S; Vammen, S; Juul, Svend

    1999-01-01

    Objective:the sensitivity and specificity of screening for abdominal aortic aneurysms (AAAs) with ultrasonographic scanning (US) is unknown. The aim of the study was to validate US as screening test for AAAs.Methods and material:4176 (76.3%) of 5470 men aged 65–73 attended hospital-based US...... screening for an AAA at their local hospital. Two observers and one scanner were used. The maximal anterior–posterior (AP) of the dilated aorta, or 2 cm above the bifurcation, and at the crossing of left renal vein was recorded. In 50 cases, blinded measurements were carried out by two observers. An AAA...... for AAA. Screening for proximal infrarenal aorta aneurysm remains acceptable because the majority of aortic diameters in this segment are so much smaller than the diameters that define an AAA....

  10. An 18-cm unruptured abdominal aortic aneurysm

    Directory of Open Access Journals (Sweden)

    Nathan M. Droz, MD

    2017-03-01

    Full Text Available Abdominal aortic aneurysm (AAA is a significant source of morbidity and ranked by the Centers for Disease Control and Prevention as the 15th leading cause of death among adults aged 60 to 64 years. Size confers the largest risk factor for aneurysm rupture, with aneurysms >6 cm having an annual rupture risk of 14.1%. We present the case of a 60-year-old man found on ultrasound imaging at a health fair screening to have a 15-cm AAA. Follow-up computed tomography angiography revealed an 18-cm × 10-cm unruptured, infrarenal, fusiform AAA. Giant AAAs, defined as >11 cm, are rarely described in the literature. Our patient underwent successful transperitoneal AAA repair with inferior mesenteric artery reimplantation and was discharged home on operative day 6. We believe this case represents one of the largest unruptured AAAs in the literature and demonstrates the feasible approach for successful repair.

  11. Dicty_cDB: Contig-U11043-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 999 ) PCAA-aaa42f04.g2 UCI-12 Podocoryne carnea cDNA 5'... 40 0.004 2 ( DY450665 ) PCAA-aaa25c08.g2 UCI-12 Podocoryne carne...a cDNA 5'... 40 0.004 2 ( DV205433 ) PCAA-aaa61d07.g1 UCI-12 Podocoryne carne... 40 0.004 2 ( DY452171 ) PCAA-aaa22e12.g1 UCI-12 Podocoryne carnea cDNA 5'... 40 0.004 2 ( AM758282 ) Clytia... hemisphaerica EST, 5' end sequence, clone ... 38 0.004 2 ( DY450872 ) PCAA-aaa28c10.g2 UCI-12 Podocoryne carne...clone:VS... 40 0.004 2 ( DY452050 ) PCAA-aaa107j17.g2 UCI-12 Podocoryne carnea cDNA 5... 40 0.004 2 ( DY4511

  12. Dicty_cDB: Contig-U08720-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 824719 ) CTOY16330.b1_C04.ab1 CTO(XYZ) dandelion Taraxacum... 48 0.76 1 ( DY452366 ) PCAA-aaa18h07.g1 UCI-12 Podocoryne carne...a cDNA 5'... 48 0.76 1 ( DY452309 ) PCAA-aaa17g03.g1 UCI-12 Podocoryne carne...a cDNA 5'... 48 0.76 1 ( DY452033 ) PCAA-aaa107d19.g2 UCI-12 Podocoryne carnea cDNA 5... 48 0.76... 1 ( DY451980 ) PCAA-aaa106c14.g2 UCI-12 Podocoryne carnea cDNA 5... 48 0.76 1 ( DY451654 ) PCAA-aaa04f11.g1 UCI-12 Podocoryne carne...a cDNA 5'... 48 0.76 1 ( DY451437 ) PCAA-aaa12h10.g2 UCI-12 Podocoryne carne

  13. Abdominal Aortic Diameter Is Increased in Males with a Family History of Abdominal Aortic Aneurysms

    DEFF Research Database (Denmark)

    Mejnert Jørgensen, Trine; Houlind, K; Green, A

    2014-01-01

    measurement of maximum antero-posterior aortic diameter. Family history obtained by questionnaire. Multivariate regression analysis was used to test for confounders: age, sex, smoking, comorbidity and medication. RESULTS: From the screened cohort, 569 participants had at least one first degree relative......OBJECTIVE: To investigate, at a population level, whether a family history of abdominal aortic aneurysm (AAA) is independently related to increased aortic diameter and prevalence of AAA in men, and to elucidate whether the mean aortic diameter and the prevalence of AAA are different between...... participants with male and female relatives with AAA. DESIGN: Observational population-based cross-sectional study. MATERIALS: 18,614 male participants screened for AAA in the VIVA-trial 2008-2011 with information on both family history of AAA and maximal aortic diameter. METHODS: Standardized ultrasound scan...

  14. Iliacaaneurismer sammenlignet med abdominale aortaaneurismer

    DEFF Research Database (Denmark)

    Vammen, Sten; Henneberg, E W; Fasting, H

    2000-01-01

    IAs were ruptured, while only 27% of AAAs were ruptured (p IA, 47% in ruptured combined aneurysms, and 31% in ruptured isolated AAA (p IA seems to be more under-diagnosed than AAA, and are often diagnosed because...... aneurysms in the county of Viborg in Denmark 1989-1997. Four thousand one hundred and seventy-six attended screening. One hundred and seventy (4.0%) had an AAA. Twenty-one (0.56%) required operation, while the prevalence of operation-requiring iliac aneurysm (IA) was 0.17%. The operative incidence of IA...... was 18.4 per mill. per year, and 92.4 per mill. per year were operated for AAA. Patients with IA had lower cholesterol-levels, and urological symptoms were present in 42% of cases with isolated IA, and 25% of combined aneurysms compared to 8% of isolated AAA (p

  15. Dicty_cDB: Contig-U04580-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nosize Bicyclus anynan... 46 1.9 1 ( FD779287 ) NADG-aaa01e12.g1 Rhodnius_prolixu...s_EST_NADG_Bacte... 46 1.9 1 ( FD779229 ) NADG-aaa13e09.g1 Rhodnius_prolixus_EST_NADG_Bacte... 46 1.9 1 ( FD...778983 ) NADG-aaa13e09.b1 Rhodnius_prolixus_EST_NADG_Bacte... 46 1.9 1 ( FD482290 ) NADI-aaa29b11.g1 Rhodnius_prolix...us_EST_NADI_5th_i... 46 1.9 1 ( FD481836 ) NADI-aaa32c09.b1 Rhodnius_prolix...us_EST_NADI_5th_i... 46 1.9 1 ( FD481321 ) NADI-aaa29b11.b1 Rhodnius_prolixus_EST_NADI_5th_i... 46 1.9 1 (

  16. An update on the etiology of abdominal aortic aneurysms: implications for future diagnostic testing.

    Science.gov (United States)

    Miner, Grace H; Faries, Peter L; Costa, Kevin D; Hanss, Basil G; Marin, Michael L

    2015-10-01

    Abdominal aortic aneurysm (AAA) disease is multifactorial with both environmental and genetic risk factors. The current research in AAA revolves around genetic profiles and expression studies in both human and animal models. Variants in genes involved in extracellular matrix degradation, inflammation, the renin-angiotensin system, cell growth and proliferation and lipid metabolism have been associated with AAA using a variety of study designs. However, the results have been inconsistent and without a standard animal model for validation. Thus, despite the growing body of knowledge, the specific variants responsible for AAA development, progression and rupture have yet to be determined. This review explores some of the more significant genetic studies to provide an overview of past studies that have influenced the current understanding of AAA etiology. Expanding our understanding of disease pathogenesis will inform research into novel diagnostics and therapeutics and ultimately to improve outcomes for patients with AAA.

  17. No Tryptophan, Tyrosine and Phenylalanine Abnormalities in Children with Attention-Deficit/Hyperactivity Disorder.

    Directory of Open Access Journals (Sweden)

    Catharina Elisabeth Bergwerff

    Full Text Available The aim of the current study was to explore the role of aromatic amino acids (AAAs in blood in relation to attention-deficit/hyperactivity disorder (ADHD. Given their impact on the synthesis of serotonin and dopamine, decreased concentrations of the AAAs tryptophan, tyrosine and phenylalanine in blood may contribute to the expression of ADHD symptoms. Decreased AAA blood concentrations, in turn, may be related to lowered dietary protein intake or to abnormal AAA catabolism, as evidenced by increased urinary AAA concentrations.Eighty-three children with ADHD (75% males and 72 typically developing (TD children (51% males, aged 6 to 13 years, participated in the study. AAA concentrations were assessed in blood spots and an 18-hour urinary sample. A nutritional diary was filled out by parents to calculate dietary protein intake. Parent and teacher questionnaires assessed symptoms of ADHD, oppositional defiant disorder, conduct disorder, and autism spectrum disorder.Children with ADHD showed normal AAA concentrations in blood spots and urine, as well as normal protein intake compared to controls. No associations between AAA concentrations and symptoms of ADHD or comorbid psychiatric disorders were found.This study is the first to explore AAA metabolism in children with ADHD using a well-defined and relatively large sample. We found that AAA deficiencies are not related to ADHD. The results do not support treatment with AAA supplements in children with ADHD. Future studies regarding the cause of serotonin and dopamine alterations in ADHD should focus on other explanations, such as effects of altered transport of AAAs.

  18. Tank Tests on Water Rudders for Float Seaplanes

    Science.gov (United States)

    1939-11-01

    aara halved. l.a. 3780 lb., a hing« aaaaat of M lb.ft. oauld to reellaed for an aapaat ratio of O.t. ao that tha araa and yawing aoaent wool« to «ore...10 aaa double*, x of t.»° aaa tasted to aaba aara thara waa aa nth thla tppa of balaaaa than la a alight of flat aaa teeenlag «edged totaaaa tha

  19. Cerebral net exchange of large neutral amino acids after lipopolysaccharide infusion in healthy humans

    DEFF Research Database (Denmark)

    Berg, Ronan Mg; Taudorf, Sarah; Bailey, Damian M

    2010-01-01

    Alterations in circulating large neutral amino acids (LNAAs), leading to a decrease in the plasma ratio between branched-chain and aromatic amino acids (BCAA/AAA ratio), may be involved in sepsis-associated encephalopathy. We hypothesised that a decrease in the BCAA/AAA ratio occurs along...... with a net cerebral influx of the neurotoxic AAA phenylalanine in a human experimental model of systemic inflammation....

  20. Feasibility of Home-Use Animal-Assisted Activities in Patients With Implanted Cardiac Electronic Devices

    Directory of Open Access Journals (Sweden)

    Peter Jirak

    2016-02-01

    Full Text Available Animal-assisted activities (AAAs are mainly carried out in institutions. The aim of this prospective pilot study was to assess the willingness of patients with cardiac implanted electronic devices (IEDs to participate in AAA. The sample included 75 ambulatory patients (18 females, M age = 69 years, who attended an outpatient clinic for control of antibradycardic pacemakers (n = 15 or implanted cardioverter defibrillators (n = 60. Twenty-three percent were current and 48% were previous pet-owners. Current pet-owners were younger than non-pet-owners (63.5 vs. 72.0 years, p = .0003. Twelve patients (16% showed interest in AAA visits. However, only two patients agreed to an AAA visit. Both patients were visited once, but declined further visits. Hence, AAA sessions at home were poorly accepted, mainly because the patients considered themselves too busy or healthy, or due to a general disinterest in AAA. Potential health benefits associated with AAA may not be feasible to investigate during home visits of AAA-teams in patients with IEDs who are healthy enough to leave their homes. For further studies concerning AAA in patients with cardiovascular diseases, we suggest focusing on institutions like rehabilitation centers or day care centers and on more severely sick, homebound patients.

  1. Mona Lisa, lesbiahvid ja seksilaulud / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2003-01-01

    Ameerika Teaduse Edendamise Assotsiatsiooni (AAA) konverentsil esitatud uusimatest teadusuuringutest. Artiklid: Mona Lisa naeratuse saladus paljastatud ; Lesbilised Jaapani makaagid seljatavad Darwini ; Linnud õpivad uusi laule uue partneri leidmiseks

  2. Science, Society, and Social Networking

    Science.gov (United States)

    White, K. S.; Lohwater, T.

    2009-12-01

    The increased use of social networking is changing the way that scientific societies interact with their members and others. The American Association for the Advancement of Science (AAAS) uses a variety of online networks to engage its members and the broader scientific community. AAAS members and non-members can interact with AAAS staff and each other on AAAS sites on Facebook, YouTube, and Twitter, as well as blogs and forums on the AAAS website (www.aaas.org). These tools allow scientists to more readily become engaged in policy by providing information on current science policy topics as well as methods of involvement. For example, members and the public can comment on policy-relevant stories from Science magazine’s ScienceInsider blog, download a weekly policy podcast, receive a weekly email update of policy issues affecting the scientific community, or watch a congressional hearing from their computer. AAAS resource websites and outreach programs, including Communicating Science (www.aaas.org/communicatingscience), Working with Congress (www.aaas.org/spp/cstc/) and Science Careers (http://sciencecareers.sciencemag.org) also provide tools for scientists to become more personally engaged in communicating their findings and involved in the policy process.

  3. MicroRNA expression signature in human abdominal aortic aneurysms

    Directory of Open Access Journals (Sweden)

    Pahl Matthew C

    2012-06-01

    Full Text Available Abstract Background Abdominal aortic aneurysm (AAA is a dilatation of the aorta affecting most frequently elderly men. Histologically AAAs are characterized by inflammation, vascular smooth muscle cell apoptosis, and extracellular matrix degradation. The mechanisms of AAA formation, progression, and rupture are currently poorly understood. A previous mRNA expression study revealed a large number of differentially expressed genes between AAA and non-aneurysmal control aortas. MicroRNAs (miRNAs, small non-coding RNAs that are post-transcriptional regulators of gene expression, could provide a mechanism for the differential expression of genes in AAA. Methods To determine differences in miRNA levels between AAA (n = 5 and control (n = 5 infrarenal aortic tissues, a microarray study was carried out. Results were adjusted using Benjamini-Hochberg correction (adjusted p  Results A microarray study identified eight miRNAs with significantly different expression levels between AAA and controls (adjusted p  Conclusions Our genome-wide approach revealed several differentially expressed miRNAs in human AAA tissue suggesting that miRNAs play a role in AAA pathogenesis.

  4. The potential role of DNA methylation in abdominal aortic aneurysms.

    Science.gov (United States)

    Ryer, Evan J; Ronning, Kaitryn E; Erdman, Robert; Schworer, Charles M; Elmore, James R; Peeler, Thomas C; Nevius, Christopher D; Lillvis, John H; Garvin, Robert P; Franklin, David P; Kuivaniemi, Helena; Tromp, Gerard

    2015-05-18

    Abdominal aortic aneurysm (AAA) is a complex disorder that has a significant impact on the aging population. While both genetic and environmental risk factors have been implicated in AAA formation, the precise genetic markers involved and the factors influencing their expression remain an area of ongoing investigation. DNA methylation has been previously used to study gene silencing in other inflammatory disorders and since AAA has an extensive inflammatory component, we sought to examine the genome-wide DNA methylation profiles in mononuclear blood cells of AAA cases and matched non-AAA controls. To this end, we collected blood samples and isolated mononuclear cells for DNA and RNA extraction from four all male groups: AAA smokers (n = 11), AAA non-smokers (n = 9), control smokers (n = 10) and control non-smokers (n = 11). Methylation data were obtained using the Illumina 450k Human Methylation Bead Chip and analyzed using the R language and multiple Bioconductor packages. Principal component analysis and linear analysis of CpG island subsets identified four regions with significant differences in methylation with respect to AAA: kelch-like family member 35 (KLHL35), calponin 2 (CNN2), serpin peptidase inhibitor clade B (ovalbumin) member 9 (SERPINB9), and adenylate cyclase 10 pseudogene 1 (ADCY10P1). Follow-up studies included RT-PCR and immunostaining for CNN2 and SERPINB9. These findings are novel and suggest DNA methylation may play a role in AAA pathobiology.

  5. Statement on Human Cloning

    Science.gov (United States)

    ... as our understanding of this technology advances. Support Stem Cell Research (including Research Cloning) AAAS supports stem cell research, including the use of nuclear transplantation techniques (also ...

  6. Supporting the emergence of female student entrepreneurs

    DEFF Research Database (Denmark)

    Geert Jensen, Birgitte; Kruse, Merethe

    2011-01-01

    years (60%), while it drops to 35% on the 5th and last year. Among graduates from AAA, the gender distribution remains skewed, since more than twice as many men as women start their own architect or design firm.1 Q: Ark is a project which promotes entrepreneurship among female students at AAA. Q: Ark......60% of students at Aarhus School of Architecture (AAA) are women. Yet there are far more male than female students who harbor a desire to become independent. Overall as much as 48% of all students at AAA want to start their own business. Significantly, however, the interest is greatest on second...

  7. Analysis of multiple genetic polymorphisms in aggressive-growing and slow-growing abdominal aortic aneurysms.

    Science.gov (United States)

    Duellman, Tyler; Warren, Christopher L; Matsumura, Jon; Yang, Jay

    2014-09-01

    The natural history of abdominal aortic aneurysms (AAAs) suggests that some remain slow in growth rate whereas many develop a more accelerated growth rate and reach a threshold for intervention. We hypothesized that different mechanisms are responsible for AAAs that remain slow growing and never become actionable vs the aggressive AAAs that require intervention and may be reflected by distinct associations with genetic polymorphisms. AAA growth rate was determined from serial imaging data in 168 control and 141 AAA patients with ultrasound or computed tomography imaging studies covering ∼5 years. Genetic polymorphisms all previously reported as showing a significant correlation with AAA with functional effects on the expression or function were determined by analysis of the genomic DNA, including angiotensin 1 receptor (rs5186), interleukin-10 (IL-10; rs1800896), methyl-tetrahydrofolate reductase (rs1801133), low-density lipoprotein receptor-related protein 1 (LRP1; rs1466535), angiotensin-converting enzyme (rs1799752), and several matrix metalloproteinase 9 (MMP-9) single nucleotide polymorphisms. Of the AAA patients, 81 were classified as slow AAA growth rate (3.25 mm/y, those presenting with a rupture, or those with maximal aortic diameter >5.5 cm [male] or >5.0 cm [female]). Discriminating confounds between the groups were identified by logistic regression. Analyses identified MMP-9 p-2502 single nucleotide polymorphism (odds ratio [OR], 0.54; 95% confidence interval [CI], 0.31-0.94; P = .029) as a significant confound discriminating between control vs slow-growth AAA, MMP-9 D165N (OR, 0.49; 95% CI, 0.26-0.95; P = .035) and LRP1 (OR, 4.99; 95% CI, 1.13-22.1; P = .034) between control vs aggressive-growth AAAs, and methyltetrahydrofolate reductase (OR, 2.99; 95% CI, 1.01-8.86; P = .048), MMP-9 p-2502 (OR, 2.19; 95% CI, 1.05-4.58; P = .037), and LRP1 (OR, 4.96; 95% CI, 1.03-23.9; P = .046) as the statistically significant confounds distinguishing slow

  8. Chlamydia pneumoniae Antibodies and C-Reactive Protein Levels in Patients with Abdominal Aortic Aneurysms

    Directory of Open Access Journals (Sweden)

    M. A. Sharif

    2013-01-01

    Full Text Available Introduction. The study aim was to assess the relationship between the presence of antibodies to Chlamydia pneumoniae and abdominal aortic aneurysm (AAA incidence. Patients and Methods. Consecutive AAA patients and AAA-free controls were recruited prospectively. Serum samples from both groups were examined to determine Immunoglobulin (Ig A and IgG titres against Chlamydia pneumoniae by ELISA and C-reactive protein (CRP concentrations. Results were expressed as mean (SD or median (IQR and compared using χ2 and Mann-Whitney U tests. A P value of <0.05 was considered statistically significant. Results. Each study group (AAA/nAAA comprised 250 patients. 196 (78.7% AAA patients had positive IgA antichlamydial antibody titres, compared to 181 (72.4% in the control group (P=0.008, OR 2.0, 95% CI 1.2–3.5. However, positive IgG antibody titres were similar (191 versus 203; P=0.222, OR 0.7, 95% CI 0.4–1.3. Average CRP concentrations were higher in AAA individuals. IgA or IgG antibody titres were not related to CRP concentrations. Conclusions. These results demonstrated that the frequent incidence of Chlamydia pneumoniae antibodies within the general population makes it difficult to relate its presence to AAA development, despite the high IgA antibody titres. In addition, raised CRP concentrations in AAA patients are not related to the presence of antichlamydial antibodies.

  9. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available e ... gb|AAA24600.1| DNA primase ... Length = 97 ... Query: 4 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCP...FHNEKTPSFTVNGEKQFYHCFG 63 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG Sbjct: 1 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG 60 ...

  10. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available e ... gb|AAA24600.1| DNA primase ... Length = 97 ... Query: 4 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCP...FHNEKTPSFTVNGEKQFYHCFG 63 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG Sbjct: 1 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG 60 ...

  11. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available e ... gb|AAA24600.1| DNA primase ... Length = 97 ... Query: 4 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCP...FHNEKTPSFTVNGEKQFYHCFG 63 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG Sbjct: 1 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG 60 ...

  12. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available e ... gb|AAA24600.1| DNA primase ... Length = 97 ... Query: 4 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCP...FHNEKTPSFTVNGEKQFYHCFG 63 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG Sbjct: 1 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG 60 ...

  13. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available e ... gb|AAA24600.1| DNA primase ... Length = 97 ... Query: 4 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCP...FHNEKTPSFTVNGEKQFYHCFG 63 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG Sbjct: 1 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG 60 ...

  14. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available e ... gb|AAA24600.1| DNA primase ... Length = 97 ... Query: 4 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCP...FHNEKTPSFTVNGEKQFYHCFG 63 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG Sbjct: 1 ... RIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFG 60 ...

  15. Comparison of Conscious Sedation and Asleep-Awake-Asleep Techniques for Awake Craniotomy.

    Science.gov (United States)

    Dilmen, Ozlem Korkmaz; Akcil, Eren Fatma; Oguz, Abdulvahap; Vehid, Hayriye; Tunali, Yusuf

    2017-01-01

    Since awake craniotomy (AC) has become a standard of care for supratentorial tumour resection, especially in the motor and language cortex, determining the most appropriate anaesthetic protocol is very important. The aim of this retrospective study is to compare the effectiveness of conscious sedation (CS) to "awake-asleep-awake" (AAA) techniques for supratentorial tumour resection. Forty-two patients undergoing CS and 22 patients undergoing AAA were included in the study. The primary endpoint was to compare the CS and AAA techniques with respect to intraoperative pain and agitation in patients undergoing supratentorial tumour resection. The secondary endpoint was comparison of the other intraoperative complications. This study results show that the incidence of intraoperative agitation and seizure were lower in the AAA group than in the CS group. Intraoperative blood pressures were significantly higher in the CS group than in the AAA group during the pinning and incision, but the level of blood pressures did not need antihypertensive treatment. Otherwise, blood pressures were significantly higher in the AAA group than in the CS group during the neurological examination and the severity of hypertension needed statistically significant more antihypertensive treatment in the AAA group. As a result of hypertension, the amount of intraoperative bleeding was higher in the AAA group than in the CS group. In conclusion, the AAA technique may provide better results with respect to agitation and seizure, but intraoperative hypertension needed a vigilant follow-up especially in the wake-up period. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Sex differences in abdominal aortic aneurysm: the role of sex hormones.

    Science.gov (United States)

    Makrygiannis, Georgios; Courtois, Audrey; Drion, Pierre; Defraigne, Jean-Olivier; Kuivaniemi, Helena; Sakalihasan, Natzi

    2014-11-01

    Abdominal aortic aneurysm (AAA) is a complex multifactorial disease with genetic and environmental components. AAA is more common in men, whereas women have a greater risk of rupture and more frequently have concomitant thoracic aortic aneurysms. Moreover, women are diagnosed with AAA about 10 years later and seem to be protected by female sex hormones. In this MEDLINE-based review of literature, we examined human and animal in vivo and in vitro studies to further deepen our understanding of the sexual dimorphism of AAA. We focus on the role of sex hormones during the formation and growth of AAA. Endogenous estrogens and exogenous 17β-estradiol were found to exert favorable actions protecting from AAA in animal models, whereas exogenous hormone replacement therapy in humans had inconclusive results. Androgens, known to have detrimental effects in the vasculature, in sufficient levels maintain the integrity of the aortic wall through their anabolic actions and act differentially in men and women, whereas lower levels of testosterone have been associated with AAA in humans. In conclusion, sex differences remain an important area of AAA research, but further studies especially in humans are needed. Furthermore, differential molecular mechanisms of sex hormones constitute a potential therapeutic target for AAA. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Groundwater Monitoring Program. Volume 2

    Science.gov (United States)

    1992-09-18

    Trichloroethene Copper Lead Organosulfur Compounds Mercury I ,4-Dithiane Zinc I ,4-Oxithiane Benzothiazole Cations Dimethyldisulfide Calcium p...0.083 Isodrin KK8 0.051 MM8A 0.056 Organosulfur Compounds GC/FPD 1,4-Dithiane AAA8 1.34 PP8A 3.34 1,4-Oxathiane AAAS 2.38 PP8A 1.35 4...Designation JAi Organosulfur Compounds (continued) Bensothiazole AAA8 5 PP8A 114 Dimethyl disulfide AAA8 0.55 PP8A 1.16 Phosphonates GC/FPD

  18. Familiære abdominale aortaaneurismer

    DEFF Research Database (Denmark)

    Mejnert Jørgensen, Trine; Lindholt, Jes S.; Høgh, Annette Langager

    Formål og baggrund: Det er velkendt, at risikoen for at udvikle et abdominalt aortaaneurisme (AAA) er væsentligt forøget blandt førstegradsslægtninge til AAA-patienter, men tidligere studier er få og svært sammenlignelige, ligesom man ikke har kunnet belyse, om familiære tilfælde af AAA fremtræder...... mere aggressivt end ikke-familiære. Man ved således meget lidt om væksthastighed, prognose for ruptur, alder ved diagnose og operation og risiko for AAA-relaterede dødsfald for denne gruppe. Projektet vil forsøge at besvare følgende: Hvor stor er forekomsten af AAA blandt førstegradsslægtninge til AAA......-patienter på landsplan og er familiære tilfælde af AAA mere aggressive i form af lavere gennemsnitsalder ved diagnose og operation, hurtigere vækstrate, større rupturrisiko og højere forekomst af AAA-relaterede dødsfald end ikke-familiære AAA? Design: Projektet er et retrospektivt case-kontrolstudie, hvor man...

  19. Abdominalt aortaaneurisme i Viborg Amt. Mortaliteten før og efter etableringen af egen karkirurgisk betjening

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Henneberg, E W; Fasting, H

    1995-01-01

    %) reached operation, 13 survived (33%) and six (15.4%) died postoperatively. The overall mortality was 67%, the mortality of AAA was 127/million persons over 50 years. Comparing the two periods, deaths, mortality and overall mortality due to ruptured AAA decreased by 32% after the introduction...... as many operations for AAA (104/mill/yr) were carried out after the unit opened. Acute operations increased sevenfold. In 1986-1988 42 persons experienced rupture of AAA. Twenty-six (63%) died outside hospital. Thirteen (32%) died at primary receiving hospitals. Only three patients (7%) were operated. One...

  20. Jaundice as a Rare Indication for Aortic Aneurysm Repair.

    Science.gov (United States)

    Rieß, Henrik C; Tsilimparis, Nikolaos; Behrendt, Christian A; Wipper, Sabine; Debus, Eike S; Larena-Avellaneda, Axel

    2015-10-01

    Compression of adjacent anatomic structures by an abdominal aortic aneurysm (AAA) can result in a variety of symptoms. We describe the case of an 88-year-old Caucasian woman with jaundice, elevated laboratory parameters for extrahepatic and intrahepatic cholestasis, and concomitant juxtarenal AAA compressing the liver hilum. Following exclusion of other common causes for cholestasis, the patient was considered to have a symptomatic AAA. Open abdominal aortic surgery revealed a contained rupture and was repaired. Obstructive jaundice secondary to a compromising AAA is a rare condition and to the best of our knowledge has not been reported to date. Copyright © 2015 Elsevier Inc. All rights reserved.

  1. Dicty_cDB: Contig-U04780-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _evk_891797 scauevk mixed_tissue Sebastes... 44 6.7 1 ( FD779328 ) NADG-aaa04h04.g1 Rhodnius_prolixus_EST_NA...DG_Bacte... 44 6.7 1 ( FD779285 ) NADG-aaa01g06.g1 Rhodnius_prolixus_EST_NADG_Bacte... 44 6.7 1 ( FD779019 )... NADG-aaa01g06.b1 Rhodnius_prolixus_EST_NADG_Bacte... 44 6.7 1 ( FD778352 ) NADG-aaa08d03.g1 Rhodnius_prol...ixus_EST_NADG_Bacte... 44 6.7 1 ( AC225506 ) Medicago truncatula clone mth2-118d4,

  2. Dicty_cDB: Contig-U14782-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NADH-aaa01h04.b1 Rhodnius_prolixus_EST_NADH_T.cru... 48 0.032 2 ( FD777166 ) NADH-aaa01h04.g1 Rhodnius_prolix...2 ( FD779244 ) NADG-aaa01b01.g1 Rhodnius_prolixus_EST_NADG_Bacte... 48 0.033 2 ( ...enecio aethnensis cDNA 5', mR... 48 0.037 2 ( FD779042 ) NADG-aaa01b01.b1 Rhodnius_prolixus_EST_NADG_Bacte..

  3. Dicty_cDB: Contig-U03721-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Male Pupae Nasonia ... 42 3.6 1 ( FG542739 ) NADI-aaa55c03.b1 Rhodnius_prolixus_E...501 ) G825P59FG6.T0 Acorn worm normalized gastrula pExp... 42 3.6 1 ( EX473113 ) NADI-aaa17h07.b1 Rhodnius_prolix...us_EST_NADI_5th_i... 42 3.6 1 ( EX472902 ) NADI-aaa17h07.g1 Rhodnius_prolixu...4972 ) NADL-aaa18a05.b1 Rhodnius_prolixus_EST_NADL_RpcDN... 30 9.6 2 ( BX321879 ) Zebrafish DNA sequence fro

  4. Abdominal aortic aneurysms do not develop more aggressively among patients with a positive family history of the disease

    DEFF Research Database (Denmark)

    Mejnert Jørgensen, Trine; Wemmelund, Holger; Green, Anders

    Title: Abdominal aortic aneurysms no not develop more aggressively among patients with a positive family history of the disease Authors: Trine M. M. Joergensen, Holger Wemmelund, Anders Green, Jes Lindholt, Kim Houlind. Introduction: It is well known, that a family history of abdominal aortic...... among patients with a positive family history of the disease....... with information on family history of AAA, diameter of AAA throughout follow-up, surgery, ruptures, comorbidity, smoking, and use of medication. Methods: Patients with and without a family history of AAA were compared regarding mean age at diagnosis and surgery, diameter of AAA at diagnosis, risk of surgery...

  5. Coronary artery bypass grafting following simultaneous treatment of abdominal aortic aneurysm and peripheral arterial disease.

    Science.gov (United States)

    Temizkan, Veysel; Ugur, Murat; Alp, Ibrahim; Ucak, Alper; Yedekci, Erturk; Yilmaz, Ahmet Turan

    2014-01-01

    Atherosclerosis might affect all arterial segments of the vascular system, thus peripheral arterial disease (PAD) accompanying coronary artery disease (CAD) is not uncommon. In addition to this coexistence, abdominal aortic aneurysm (AAA) is frequently associated with CAD. Although treatment strategies of CAD and PAD or CAD and AAA has been reported previously, treatment of these three pathologies has not been reported. The management of a therapeutic strategy is important for avoiding perioperative mortality and morbidity in CAD associated with AAA and PAD. We are reporting our simultaneous treatment strategy of three pathologies with endovascular AAA repair, stent implantation into the superficial femoral artery (SFA) and coronary artery bypass grafting (CABG).

  6. Usefulness of one-stage coronary artery bypass grafting on the beating heart and abdominal aortic aneurysm repair.

    Science.gov (United States)

    Morimoto, Keisuke; Taniguchi, Iwao; Miyasaka, Shigeto; Aoki, Tetsuya; Kato, Ippei; Yamaga, Takeshi

    2004-02-01

    Abdominal aortic aneurysm (AAA) is commonly associated with coronary artery disease (CAD). Simultaneous coronary artery bypass grafting (CABG) with cardiopulmonary bypass (CPB) under cardiac arrest and AAA repair may be considerably invasive. Recently CABG under the beating heart without CPB has been reported as a less invasive method. We report the combined operation of CABG on a beating heart and AAA repair for AAA patients with CAD, and compare it with a separate operation. A retrospective review of the records of consecutive patients who underwent elective combined procedure or single operation for CABG on a beating heart and/or repair of the AAA between May 1999 and October 2001 was carried out. Ten patients underwent combined procedures. A single operation, CABG on a beating heart or repair of AAA, were performed in 27 or 19 patients. There were no significant differences with regard to intraoperative blood loss, transfusion and postoperative intubation time among the three groups. There was no operative mortality for any of the three groups. All cases were discharged without severe complications and with patent coronary bypass grafts. There was a decrease in mean total hospital costs for the combined operation group compared with the CABG group plus AAA repair group (3.34 million versus 5.87 million yen). Combined CABG on a beating heart and AAA repair on a one-step approach appears to be a safe and useful therapeutic strategy for AAA patients with CAD.

  7. Successful endovascular aneurysm repair for abdominal aortic aneurysm in a patient with severe coronary artery disease undergoing off-pump coronary artery bypass grafting.

    Science.gov (United States)

    Kim, Sun Min; Cho, Jae Yeong; Kim, Ju Han; Park, Keun-Ho; Sim, Doo Sun; Hong, Young Joon; Ahn, Youngkeun; Jeong, Myung Ho

    2014-04-01

    It is well known that patients with abdominal aortic aneurysm (AAA) often have concomitant coronary artery disease (CAD). In cases of AAA with severe CAD requiring coronary artery bypass grafting (CABG), two therapeutic strategies regarding the timing of CABG can be considered: staged or simultaneous operations. However, the ideal treatment of patients with large AAA and critical CAD remains controversial. We experienced a case of successful endovascular aneurysm repair after off-pump CABG in a 70-year-old patient who had a huge AAA and critical CAD.

  8. Enhancing human-animal relationships through veterinary medical instruction in animal-assisted therapy and animal-assisted activities.

    Science.gov (United States)

    Schaffer, Caroline Brunsman

    2008-01-01

    Instruction in animal-assisted therapy (AAT) and animal-assisted activities (AAAs) teaches veterinary medical students to confidently and assertively maximize the benefits and minimize the risks of this union of animals and people. Instruction in AAT/AAA also addresses requirements by the American Veterinary Medical Association Council on Education that accredited schools/colleges of veterinary medicine include in their standard curriculum the topics of the human-animal bond, behavior, and the contributions of the veterinarian to the overall public and professional health care teams. Entry-level veterinarians should be prepared to: (1) assure that animals who provide AAT/AAA are healthy enough to visit nursing homes, hospitals, or other institutions; (2) promote behavior testing that selects animals who will feel safe, comfortable, and connected; (3) advise facilities regarding infection control and ways to provide a safe environment where the animals, their handlers, and the people being visited will not be injured or become ill; and (4) advocate for their patients and show compassion for their clients when animals are determined to be inappropriate participants in AAT/AAA programs. This article presents AAT/AAA terminology, ways in which veterinarians can advocate for AAT/AAA, the advantages of being involved in AAT/AAA, a model AAT/AAA practicum from Tuskegee University's School of Veterinary Medicine (TUSVM), and examples of co-curricular activities in AAT/AAA by TUSVM's student volunteers.

  9. Estratigrafía del Valle de Luracatao (Valle Calchaquí, Noroeste Argentino): nueva propuesta

    OpenAIRE

    Patricio Augusto Payrola Bosio; Cecilia del Papa; Fernando Hongn; Jaime Powell

    2010-01-01

    Durante el Cretácico Inferior-Eoceno se desarrolló la cuenca de rift del Grupo Salta en el noroeste argentino, con un relleno constituido por depósitos sinrift del Subgrupo Pirgua y postrift de los Subgrupos Balbuena y Santa Bárbara. Posteriormente y sobreimpuesta a la primera, se generó una extensa cuenca de antepaís. En el valle Calchaquí, el Grupo Payogastilla representa el relleno sinorogénico andino (cuenca de antepaís) y guarda el registro de los episodios de deformación y de inversión ...

  10. Grupos wallpaper e sua relação com cohomologia de grupos

    OpenAIRE

    Martins, Rafaella de Souza [UNESP

    2014-01-01

    O objetivo principal deste trabalho e estudar a relação entre cohomologia de grupos e o problema de classificar grupos wallpaper, que são grupos de simetrias de certas figuras do plano chamadas padrões wallpaper. Há, a menos de equivalência, exatamente 17 grupos wallpaper, que classificamos usando teoria dos grupos e algebra linear. Dado um grupo wallpaper G, temos associado inicialmente a G um subgrupo abeliano normal T (subgrupo das translações) chamado reticulado, um grupo G0 = G=T chamado...

  11. Miopatías inflamatorias idiopáticas : Caracterización clínica, de laboratorio y patológica de una serie de 35 pacientes.

    OpenAIRE

    Sahuquillo Hernández, Patricia

    2012-01-01

    Estudio descriptivo y retrospectivo de una serie de 35 pacientes con miopatía inflamatoria idiopática, que a partir de la recogida de variables clínicas, de laboratorio y patológicas, se propone los siguientes objetivos: caracterizar a este grupo de enfermedades, clasificar a los pacientes en subgrupos en función de criterios histopatológicos y caracterizar los distintos subgrupos analizando qué variables permiten diferenciar mejor cada categoría. Estudi descriptiu y retrospectiu de una se...

  12. A comparison of modelling techniques for computing wall stress in abdominal aortic aneurysms

    Directory of Open Access Journals (Sweden)

    McGloughlin Timothy M

    2007-10-01

    Full Text Available Abstract Background Aneurysms, in particular abdominal aortic aneurysms (AAA, form a significant portion of cardiovascular related deaths. There is much debate as to the most suitable tool for rupture prediction and interventional surgery of AAAs, and currently maximum diameter is used clinically as the determining factor for surgical intervention. Stress analysis techniques, such as finite element analysis (FEA to compute the wall stress in patient-specific AAAs, have been regarded by some authors to be more clinically important than the use of a "one-size-fits-all" maximum diameter criterion, since some small AAAs have been shown to have higher wall stress than larger AAAs and have been known to rupture. Methods A patient-specific AAA was selected from our AAA database and 3D reconstruction was performed. The AAA was then modelled in this study using three different approaches, namely, AAA(SIMP, AAA(MOD and AAA(COMP, with each model examined using linear and non-linear material properties. All models were analysed using the finite element method for wall stress distributions. Results Wall stress results show marked differences in peak wall stress results between the three methods. Peak wall stress was shown to reduce when more realistic parameters were utilised. It was also noted that wall stress was shown to reduce by 59% when modelled using the most accurate non-linear complex approach, compared to the same model without intraluminal thrombus. Conclusion The results here show that using more realistic parameters affect resulting wall stress. The use of simplified computational modelling methods can lead to inaccurate stress distributions. Care should be taken when examining stress results found using simplified techniques, in particular, if the wall stress results are to have clinical importance.

  13. Combined abdominal aortic aneurysm repair and coronary artery bypass: presentation of 13 cases and review of the literature.

    Science.gov (United States)

    Wolff, Thomas; Baykut, Doan; Zerkowski, Hans-Reinhand; Stierli, Peter; Gürke, Lorenz

    2006-01-01

    Coronary artery disease remains the major cause of perioperative mortality after abdominal aortic aneurysm (AAA) repair. The beneficial effect of coronary artery bypass (CAB) before AAA repair in patients with severe coronary artery disease has been proven. The coexistence of a very large or symptomatic AAA and coronary artery disease remains a therapeutic challenge since there is the risk of AAA rupture in the interval between CAB and AAA repair. Combined CAB and aortic aneurysm repair has been suggested for these cases, and results on several series of patients have been published. However, the exact indication for the combined operation remains to be clarified. We present a series of 13 patients who underwent CAB on cardiopulmonary bypass and aortic aneurysm repair as a one-stage procedure. The indication was a large AAA in seven patients and a symptomatic AAA in six patients. In four patients, the aortic reconstruction was performed without the use of cardiopulmonary bypass; in nine patients, the aortic reconstruction was performed under partial cardiopulmonary bypass. Thirty-day mortality was 15%. Major morbidity was 31%. All major complications were due to excessive bleeding and occurred in patients who had AAA repair performed with partial cardiopulmonary bypass, suggesting that prolonged bypass time represents a major source of morbidity. A detailed review of the literature is presented. From the evidence available we suggest that the combined procedure can be recommended only for patients with very high rupture risk, such as in symptomatic AAA. In all other cases, the staged approach--CAB followed by AAA repair 2-4 weeks later--is preferable. During the combined procedure, cardiopulmonary bypass support during AAA repair should be used only in patients with clear evidence of hemodynamic instability.

  14. J.J. Thompson and the discovery of the electron

    CERN Document Server

    Davis, E A

    2002-01-01

    This historical survey of the discovery of the electron has been published to coincide with the centenary of the discovery. The text maps the life and achievements of J.J. Thomson, with particular focus on his ideas and experiments leading to the discovery. It describes Thomson''s early years and education. It then considers his career at Cambridge, first as a fellow of Trinity, later as the head of the Cavendish Laboratory and finally as Master of Trinity and national spokesman for science. The core of the book is concerned with the work undertaken at the Cavendish, culminating in the discovery of "corpuscles", later named "electrons".; In the final two chapters, the immediate aftermath and implications of the work are described. These include the creation of the subject of atomic physics as well as the broader long term developments which can be traced from vacuum valves and the transistor through to the microelectronics revolution.

  15. A philicity based analysis of adsorption of small molecules in zeolites

    Indian Academy of Sciences (India)

    Unknown

    Metropolitana-Iztapalapa, AP 55-534, México DF, 09340, México. 2Present address: Programa de Ingeniería Molecular, Instituto Mexicano del Petróleo, Eje Lázaro. Cárdenas 152, México DF, 07730, México. 3Theory of Condensed Matter Group, Cavendish Laboratory, University of Cambridge, Cambridge. CB3 0HE, UK.

  16. Nematode resistance in bananas : screening results on some wild and cultivated accessions of Musa spp

    OpenAIRE

    Quénéhervé, Patrick; Valette, C.; Topart, Patrick; Tezenas du Montcel, H.; Salmon, F.

    2009-01-01

    Bananas cultivated for export all belong to Cavendish cultivars and are all recognized as very susceptible to nematodes, particularly to the burrowing nematode Radopholus similis and the lesion nematode Pratylenchus coffeae. Even if there have been many changes in the management of banana nematodes in large commercial banana plantations, chemical control still remains most often the last resort method to manage the nematodes, although the number of registered products is definitely declining....

  17. Agrarian reform in the Philippine banana chain

    OpenAIRE

    De Los Reyes, Joy Hasmin; Pelupessy, Wim

    2009-01-01

    The Comprehensive Agrarian Reform Program (CARP) of 1986 had been the most far reaching postwar institutional change in rural Philippines. To evaluate the dynamic impact of CARP in the banana sector, we have compared the development of smallholders in both the domestic market and export chains. For exports the reform introduced contract agriculture between cooperatives of small Cavendish banana growers and export firms. Small farmers of banana cultivars like Lakatan supply the crop individual...

  18. The discovery of the structure of DNA

    Science.gov (United States)

    Squires, G. L.

    2003-04-01

    On 25 April 1953, Nature published a letter by Francis Crick and James Watson, at the Cavendish Laboratory, Cambridge, proposing a structure for DNA. This letter marked the beginning of a revolution in biology. Besides Crick and Watson, two other scientists, Rosalind Franklin and Maurice Wilkins, played key roles in the discovery. After sketching the early careers of the four scientists, the present article gives an account of the physics and chemistry involved in the discovery, and the events leading up to it.

  19. Comparative Phosphoproteomics Reveals an Important Role of MKK2 in Banana (Musa spp.) Cold Signal Network

    Science.gov (United States)

    Gao, Jie; Zhang, Sheng; He, Wei-Di; Shao, Xiu-Hong; Li, Chun-Yu; Wei, Yue-Rong; Deng, Gui-Ming; Kuang, Rui-Bin; Hu, Chun-Hua; Yi, Gan-Jun; Yang, Qiao-Song

    2017-01-01

    Low temperature is one of the key environmental stresses, which greatly affects global banana production. However, little is known about the global phosphoproteomes in Musa spp. and their regulatory roles in response to cold stress. In this study, we conducted a comparative phosphoproteomic profiling of cold-sensitive Cavendish Banana and relatively cold tolerant Dajiao under cold stress. Phosphopeptide abundances of five phosphoproteins involved in MKK2 interaction network, including MKK2, HY5, CaSR, STN7 and kinesin-like protein, show a remarkable difference between Cavendish Banana and Dajiao in response to cold stress. Western blotting of MKK2 protein and its T31 phosphorylated peptide verified the phosphoproteomic results of increased T31 phosphopeptide abundance with decreased MKK2 abundance in Daojiao for a time course of cold stress. Meanwhile increased expression of MKK2 with no detectable T31 phosphorylation was found in Cavendish Banana. These results suggest that the MKK2 pathway in Dajiao, along with other cold-specific phosphoproteins, appears to be associated with the molecular mechanisms of high tolerance to cold stress in Dajiao. The results also provide new evidence that the signaling pathway of cellular MKK2 phosphorylation plays an important role in abiotic stress tolerance that likely serves as a universal plant cold tolerance mechanism. PMID:28106078

  20. Comparative Phosphoproteomics Reveals an Important Role of MKK2 in Banana (Musa spp.) Cold Signal Network.

    Science.gov (United States)

    Gao, Jie; Zhang, Sheng; He, Wei-Di; Shao, Xiu-Hong; Li, Chun-Yu; Wei, Yue-Rong; Deng, Gui-Ming; Kuang, Rui-Bin; Hu, Chun-Hua; Yi, Gan-Jun; Yang, Qiao-Song

    2017-01-20

    Low temperature is one of the key environmental stresses, which greatly affects global banana production. However, little is known about the global phosphoproteomes in Musa spp. and their regulatory roles in response to cold stress. In this study, we conducted a comparative phosphoproteomic profiling of cold-sensitive Cavendish Banana and relatively cold tolerant Dajiao under cold stress. Phosphopeptide abundances of five phosphoproteins involved in MKK2 interaction network, including MKK2, HY5, CaSR, STN7 and kinesin-like protein, show a remarkable difference between Cavendish Banana and Dajiao in response to cold stress. Western blotting of MKK2 protein and its T31 phosphorylated peptide verified the phosphoproteomic results of increased T31 phosphopeptide abundance with decreased MKK2 abundance in Daojiao for a time course of cold stress. Meanwhile increased expression of MKK2 with no detectable T31 phosphorylation was found in Cavendish Banana. These results suggest that the MKK2 pathway in Dajiao, along with other cold-specific phosphoproteins, appears to be associated with the molecular mechanisms of high tolerance to cold stress in Dajiao. The results also provide new evidence that the signaling pathway of cellular MKK2 phosphorylation plays an important role in abiotic stress tolerance that likely serves as a universal plant cold tolerance mechanism.

  1. Complexity of rice Hsp100 gene family: lessons from rice genome ...

    Indian Academy of Sciences (India)

    Madhu Sudhan

    2007-03-29

    Mar 29, 2007 ... Nuclear genome of A. thaliana was the first one to be completely ... While the structural features of different. Arabidopsis .... DNA. Furthermore, all rice Hsp100 homologs were noted to possess AAA family conserved motif. AAA superfamily of ATPases are associated with a wide variety of cellular activities ...

  2. Cerebral net exchange of large neutral amino acids after lipopolysaccharide infusion in healthy humans

    DEFF Research Database (Denmark)

    Berg, Ronan Mg; Taudorf, Sarah; Bailey, Damian M

    2010-01-01

    Alterations in circulating large neutral amino acids (LNAAs), leading to a decrease in the plasma ratio between branched-chain and aromatic amino acids (BCAA/AAA ratio), may be involved in sepsis-associated encephalopathy. We hypothesised that a decrease in the BCAA/AAA ratio occurs along with a ...

  3. Simultaneous aortic and coronary assessment in abdominal aortic aneurysm patients by thoraco-abdominal 64-detector-row CT angiography: estimate of the impact on preoperative management: a pilot study.

    NARCIS (Netherlands)

    Budde, R.P.; Huo, F.; Cramer, M.J.; Doevendans, P.A.; Bots, M.L.; Moll, F.L.; Prokop, M.

    2010-01-01

    OBJECTIVES: To estimate the influence of information on the coronary arteries obtained from routine thoraco-abdominal CT angiography (CTA) on pre-operative clinical management in abdominal aortic aneurysm (AAA) patients. METHODS: Twenty-eight AAA patients underwent pre-operative thoraco-abdominal

  4. Developing markers for Sigatoka leaf spot disease ( Mycosphaerella ...

    African Journals Online (AJOL)

    Consequently, a total of 102 oligonucleotide OPERON primer pairs were used to screen genomic DNA from two resistant cultivars: Calcutta 4 (Musa acuminate, AA) and Manoranjitham (AAA), and two susceptible cultivars Anaikomban (AA) and Grande Naine (AAA) with only 11 (10.8%) of the primers being polymorphic.

  5. On a question of A. Balog

    OpenAIRE

    Shkredov, Ilya D.

    2015-01-01

    We give a partial answer to a conjecture of A. Balog, concerning the size of AA+A, where A is a finite subset of real numbers. Also, we prove several new results on the cardinality of A:A+A, AA+AA and A:A + A:A.

  6. Plasma cytokine levels and risks of abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Liao, Mengyang; Liu, Cong-Lin; Lv, Bing-Jie

    2015-01-01

    ), IL10, IL17A, IFN-γ, and C-reactive protein (CRP) from 476 AAA patients and 200 controls. AAA patients had lower IL6, IFN-γ, IL10, IL17A, and higher CRP than controls. IL10 correlated positively with IFN-γ, IL17A, or IL6, but not CRP in control or AAA populations. IL10 associated negatively...... with systolic blood pressure, whereas CRP associated positively with diastolic blood pressure and body mass index. CRP was an independent AAA risk factor and correlated positively with aortic diameters before and after adjustments for other risk factors. IFN-γ, IL17A, and CRP correlated positively with cross......-sectional AAA area after adjustment. IL10 correlated positively with AAA growth rate before and after adjustment. The risk of death doubled in AAA patients with CRP levels above the median. CONCLUSIONS: Reduced IFN-γ, IL10, and IL17A in AAA patients, positive correlations of IFN-γ and IL17A with cross...

  7. You...Alcohol and Driving.

    Science.gov (United States)

    American Automobile Association, Falls Church, VA. Traffic Engineering and Safety Dept.

    This pamphlet is an example of cooperation between the private sector (AAA) and the National Highway Traffic Safety Administration. AAA has adapted materials prepared by the National Public Service Research Institute under an NHTSA contract and developed a 54-page student manual. The manual takes a complete and objective look at drinking and…

  8. NCBI nr-aa BLAST: CBRC-GGAL-15-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-15-0007 ref|XP_001266876.1| intermembrane space AAA protease IAP-1 [Neosartorya fischer...i NRRL 181] gb|EAW24979.1| intermembrane space AAA protease IAP-1 [Neosartorya fischeri NRRL 181] XP_001266876.1 0.87 38% ...

  9. Bioluminescence and Magnetic Resonance Imaging of Macrophage Homing to Experimental Abdominal Aortic Aneurysms

    Directory of Open Access Journals (Sweden)

    Noriyuki Miyama

    2012-03-01

    Full Text Available Macrophage infiltration is a prominent feature of abdominal aortic aneurysm (AAA progression. We used a combined imaging approach with bioluminescence (BLI and magnetic resonance imaging (MRI to study macrophage homing and accumulation in experimental AAA disease. Murine AAAs were created via intra-aortic infusion of porcine pancreatic elastase. Mice were imaged over 14 days after injection of prepared peritoneal macrophages. For BLI, macrophages were from transgenic mice expressing luciferase. For MRI, macrophages were labeled with iron oxide particles. Macrophage accumulation during aneurysm progression was observed by in situ BLI and by in vivo 7T MRI. Mice were sacrificed after imaging for histologic analysis. In situ BLI (n = 32 demonstrated high signal in the AAA by days 7 and 14, which correlated significantly with macrophage number and aortic diameter. In vivo 7T MRI (n = 13 at day 14 demonstrated T2* signal loss in the AAA and not in sham mice. Immunohistochemistry and Prussian blue staining confirmed the presence of injected macrophages in the AAA. BLI and MRI provide complementary approaches to track macrophage homing and accumulation in experimental AAAs. Similar dual imaging strategies may aid the study of AAA biology and the evaluation of novel therapies.

  10. Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm

    NARCIS (Netherlands)

    Gretarsdottir, Solveig; Baas, Annette F.; Thorleifsson, Gudmar; Holm, Hilma; den Heijer, Martin; de Vries, Jean-Paul P. M.; Kranendonk, Steef E.; Zeebregts, Clark J. A. M.; van Sterkenburg, Steven M.; Geelkerken, Robert H.; van Rij, Andre M.; Williams, Michael J. A.; Boll, Albert P. M.; Kostic, Jelena P.; Jonasdottir, Adalbjorg; Jonasdottir, Aslaug; Walters, G. Bragi; Masson, Gisli; Sulem, Patrick; Saemundsdottir, Jona; Mouy, Magali; Magnusson, Kristinn P.; Tromp, Gerard; Elmore, James R.; Sakalihasan, Natzi; Limet, Raymond; Defraigne, Jean-Olivier; Ferrell, Robert E.; Ronkainen, Antti; Ruigrok, Ynte M.; Wijmenga, Cisca; Grobbee, Diederick E.; Shah, Svati H.; Granger, Christopher B.; Quyyumi, Arshed A.; Vaccarino, Viola; Patel, Riyaz S.; Zafari, A. Maziar; Levey, Allan I.; Austin, Harland; Girelli, Domenico; Pignatti, Pier Franco; Olivieri, Oliviero; Martinelli, Nicola; Malerba, Giovanni; Trabetti, Elisabetta; Becker, Lewis C.; Becker, Diane M.; Reilly, Muredach P.; Rader, Daniel J.; Mueller, Thomas; Dieplinger, Benjamin; Haltmayer, Meinhard; Urbonavicius, Sigitas; Lindblad, Bengt; Gottsater, Anders; Gaetani, Eleonora; Pola, Roberto; Wells, Philip; Rodger, Marc; Forgie, Melissa; Langlois, Nicole; Corral, Javier; Vicente, Vicente; Fontcuberta, Jordi; Espana, Francisco; Grarup, Niels; Jorgensen, Torben; Witte, Daniel R.; Hansen, Torben; Pedersen, Oluf; Aben, Katja K.; de Graaf, Jacqueline; Holewijn, Suzanne; Folkersen, Lasse; Franco-Cereceda, Anders; Eriksson, Per; Collier, David A.; Stefansson, Hreinn; Steinthorsdottir, Valgerdur; Rafnar, Thorunn; Valdimarsson, Einar M.; Magnadottir, Hulda B.; Sveinbjornsdottir, Sigurlaug; Olafsson, Isleifur; Magnusson, Magnus Karl; Palmason, Robert; Haraldsdottir, Vilhelmina; Andersen, Karl; Onundarson, Pall T.; Thorgeirsson, Gudmundur; Kiemeney, Lambertus A.; Powell, Janet T.; Carey, David J.; Kuivaniemi, Helena; Lindholt, Jes S.; Jones, Gregory T.; Kong, Augustine; Blankensteijn, Jan D.; Matthiasson, Stefan E.; Thorsteinsdottir, Unnur; Stefansson, Kari

    We performed a genome-wide association study on 1,292 individuals with abdominal aortic aneurysms (AAAs) and 30,503 controls from Iceland and The Netherlands, with a follow-up of top markers in up to 3,267 individuals with AAAs and 7,451 controls. The A allele of rs7025486 on 9q33 was found to

  11. Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Gretarsdottir, Solveig; Baas, Annette F; Thorleifsson, Gudmar

    2010-01-01

    We performed a genome-wide association study on 1,292 individuals with abdominal aortic aneurysms (AAAs) and 30,503 controls from Iceland and The Netherlands, with a follow-up of top markers in up to 3,267 individuals with AAAs and 7,451 controls. The A allele of rs7025486 on 9q33 was found to as...

  12. NCBI nr-aa BLAST: CBRC-TGUT-25-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-25-0007 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 1e-67 68% ...

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-1980 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1980 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 1e-140 67% ...

  14. NCBI nr-aa BLAST: CBRC-DRER-03-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-03-0053 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 3e-92 57% ...

  15. NCBI nr-aa BLAST: CBRC-DRER-08-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-08-0047 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 1e-107 54% ...

  16. NCBI nr-aa BLAST: CBRC-FRUB-02-0652 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0652 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 1e-109 55% ...

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-0606 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0606 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 1e-160 67% ...

  18. NCBI nr-aa BLAST: CBRC-OLAT-09-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-09-0016 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 1e-107 51% ...

  19. NCBI nr-aa BLAST: CBRC-GACU-13-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-13-0022 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 1e-111 52% ...

  20. NCBI nr-aa BLAST: CBRC-GGAL-22-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-22-0004 sp|P43141|ADB4C_MELGA Beta-4C adrenergic receptor (Beta-4C adreno...ceptor) (Beta-4C adrenoreceptor) gb|AAA62151.1| beta-4C-adrenergic receptor gb|AAA62150.1| adrenergic beta-4c receptor P43141 0.0 92% ...

  1. 2 original article non-attenuation of highly pathogenic avian ...

    African Journals Online (AJOL)

    Dr Oboro VO

    H forward 5'-CCT CCA GAR TAT GCM TAY AAA ATT GTC-3'. H reverse 5'-TAC CAA CCG TCT ACC ATK CCY-3'. M forward 5'-AGA TGA GTC TTC TAA CCG AGG TCG-3'. M reverse 5'-TGC AAA AAC ATC TTC AAG TCT CTG-3'. TABLE 2: PRE-EXPERIMENTATION VIRUS ISOLATES CHARACTERISTICS. Passage. Ability.

  2. Simultaneous repair of abdominal aortic aneurysm and resection of unexpected, associated abdominal malignancies.

    Science.gov (United States)

    Illuminati, Giulio; Calio', Francesco G; D'Urso, Antonio; Lorusso, Riccardo; Ceccanei, Gianluca; Vietri, Francesco

    2004-12-15

    The management of unexpected intra-abdominal malignancy, discovered at laparotomy for elective treatment of an abdominal aortic aneurysm (AAA), is controversial. It is still unclear whether both conditions should be treated simultaneously or a staged approach is to be preferred. To contribute in improving treatment guidelines, we retrospectively reviewed the records of patients undergoing laparotomy for elective AAA repair. From January 1994 to March 2003, 253 patients underwent elective, trans-peritoneal repair of an AAA. In four patients (1.6%), an associated, unexpected neoplasm was detected at abdominal exploration, consisting of one renal, one gastric, one ileal carcinoid, and one ascending colon tumor. All of them were treated at the same operation, after aortic repair and careful isolation of the prosthetic graft. The whole series' operative mortality was 3.6%. None of the patients simultaneously treated for AAA and tumor resection died in the postoperative period. No graft-related infections were observed. Simultaneous treatment of AAA and tumor did not prolong significantly the mean length of stay in the hospital, compared to standard treatment of AAA alone. Except for malignancies of organs requiring major surgical resections, simultaneous AAA repair and resection of an associated, unexpected abdominal neoplasm can be safely performed, in most of the patients, sparing the need for a second procedure. Endovascular grafting of the AAA can be a valuable tool in simplifying simultaneous treatment, or in staging the procedures with a very short delay.

  3. NCBI nr-aa BLAST: CBRC-FRUB-02-0129 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0129 ref|NP_059058.1| cholinergic receptor, muscarinic 5 [Rattus norve...gicus] sp|P08911|ACM5_RAT Muscarinic acetylcholine receptor M5 gb|AAA40658.1| muscarinic acetylcholine receptor gb|AAA41572.1| muscar

  4. Synthesis of optically active β- or γ-alkyl-substituted alcohols through copper-catalyzed asymmetric allylic alkylation with organolithium reagents.

    Science.gov (United States)

    Guduguntla, Sureshbabu; Fañanás-Mastral, Martín; Feringa, Ben L

    2013-09-06

    An efficient one-pot synthesis of optically active β-alkyl-substituted alcohols through a tandem copper-catalyzed asymmetric allylic alkylation (AAA) with organolithium reagents and reductive ozonolysis is presented. Furthermore, hydroboration-oxidation following the Cu-catalyzed AAA leads to the corresponding homochiral γ-alkyl-substituted alcohols.

  5. NCBI nr-aa BLAST: CBRC-ACAR-01-0732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0732 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-113 64% ...

  6. NCBI nr-aa BLAST: CBRC-TBEL-01-0817 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-0817 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-134 68% ...

  7. NCBI nr-aa BLAST: CBRC-EEUR-01-0272 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-0272 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-141 72% ...

  8. Enhanced expression and activation of pro-inflammatory transcription factors distinguish aneurysmal from atherosclerotic aorta: IL-6- and IL-8-dominated inflammatory responses prevail in the human aneurysm

    NARCIS (Netherlands)

    Lindeman, J.H.N.; Abdul-Hussien, H.; Schaapherder, A.F.M.; Bockel, J.H. van; Thüsen, J.H. vonder; Roelen, D.L.; Kleemann, R.

    2008-01-01

    Inflammation plays a key role in the pathogenesis of an AAA (abdominal aortic aneurysm); however, the nature of the inflammatory factors and cellular response(s) involved in AAA growth is controversial. In the present study, we set out to determine the aortic levels of inflammatory cytokines in

  9. NCBI nr-aa BLAST: CBRC-CPOR-01-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-0033 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 9e-64 80% ...

  10. NCBI nr-aa BLAST: CBRC-OANA-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0052 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-114 63% ...

  11. NCBI nr-aa BLAST: CBRC-OCUN-01-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0050 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-164 81% ...

  12. NCBI nr-aa BLAST: CBRC-CFAM-37-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-37-0005 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-152 76% ...

  13. NCBI nr-aa BLAST: CBRC-OANA-01-1436 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1436 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-115 59% ...

  14. NCBI nr-aa BLAST: CBRC-RNOR-09-0076 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-09-0076 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-127 69% ...

  15. NCBI nr-aa BLAST: CBRC-MMUS-01-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-01-0026 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-127 70% ...

  16. NCBI nr-aa BLAST: CBRC-BTAU-01-2915 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2915 sp|P21109|CXCR1_RABIT High affinity interleukin-8 receptor A (IL-...8R A) (CXCR-1) (CD181 antigen) gb|AAA31375.1| interleukin 8 receptor gb|AAA31376.1| interleukin 8 receptor P21109 1e-137 72% ...

  17. Gclust Server: 127886 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(8) 450 ATPase associated with various cellular activities, AAA_5 1 1.00e-99 0.0 0.0 0.0 6.67 0.0 0.0 Show...annotation ATPase associated with various cellular activities, AAA_5 Number of Sequences 1 Homologs 1 Clustering

  18. Gclust Server: 9916 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(1) 372 ATPase associated with various cellular activities, AAA_3 11 1.00e-50 0.0 0.0 4.0 46.67 6.45 0.0...annotation ATPase associated with various cellular activities, AAA_3 Number of Sequences 11 Homologs 11 Clustering

  19. Gclust Server: 11448 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(55) 364 ATPase associated with various cellular activities, AAA_5 9 1.00e-50 0.0 0.0 8.0 0.0 6.45 0.0 Show...annotation ATPase associated with various cellular activities, AAA_5 Number of Sequences 9 Homologs 9 Clustering

  20. Impact of inherited genetic variants associated with lipid profile, hypertension, and coronary artery disease on the risk of intracranial and abdominal aortic aneurysms.

    Science.gov (United States)

    van 't Hof, Femke N G; Ruigrok, Ynte M; Baas, Annette F; Kiemeney, Lambertus A L M; Vermeulen, Sita H; Uitterlinden, André G; Hofman, Albert; Rivadeneira, Fernando; Rinkel, Gabriël J E; de Bakker, Paul I W

    2013-06-01

    Epidemiological studies show that an unfavorable lipid profile and coronary artery disease (CAD) are risk traits for abdominal aortic aneurysms (AAAs) but not for intracranial aneurysms (IAs), and that hypertension is a main risk trait for IAs but not for AAAs. To evaluate these observations, we investigated single-nucleotide polymorphisms associated with serum lipid levels, hypertension, and CAD and tested their contribution to AAA and IA risk. We defined sets of single-nucleotide polymorphisms previously reported to be associated with serum lipid levels, CAD, and blood pressure. From previously collected genome-wide data, we extracted genotypes for these single-nucleotide polymorphism sets in 709 IA cases and 2692 controls and 807 AAA cases and 1905 controls (all of Dutch origin). We computed genetic scores for each individual by summing the observed number of risk alleles weighted by their previously published effect size. Using logistic regression, we tested the genetic scores for association with IAs and AAAs and found significant associations for genetic scores of total cholesterol (P=3.6×10⁻⁶), low-density lipoprotein-cholesterol (P=5.7×10⁻⁷), and CAD (P=0.0014) with AAAs and for the blood pressure score with IAs (P=0.0030). We demonstrate that genetic risk profiles of lipid factors and CAD are associated with AAAs but not with IAs, and the genetic risk profile of blood pressure is associated with IAs but not with AAAs. These findings are consistent with epidemiological observations.

  1. No Tryptophan, Tyrosine and Phenylalanine Abnormalities in Children with Attention-Deficit/Hyperactivity Disorder

    NARCIS (Netherlands)

    Bergwerff, C.E.; Luman, M.; Blom, H.J.; Oosterlaan, J.

    2016-01-01

    Background The aim of the current study was to explore the role of aromatic amino acids (AAAs) in blood in relation to attention-deficit/hyperactivity disorder (ADHD). Given their impact on the synthesis of serotonin and dopamine, decreased concentrations of the AAAs tryptophan, tyrosine and

  2. Interleukin-6 receptor pathways in abdominal aortic aneurysm

    NARCIS (Netherlands)

    S.C. Harrison (Seamus); A.J.P. Smith; G.T. Jones (Gregory); D.I. Swerdlow (Daniel); R. Rampuri (Riaz); N. Bown; L. Folkersen (Lasse); A.F. Baas (Annette); G.J. de Borst (Gert); J.D. Blankensteijn (Jan); J.F. Price (Jackie F.); Y. van der Graaf (Yolanda); S. McLachlan (Stela); O. Agu (Obi); A. Hofman (Albert); A.G. Uitterlinden (André); A. Franco-Cereceda (Anders); Y.M. Ruigrok (Ynte); F.N. Van'T Hof (F.); J.T. Powell (Janet); A.M. van Rij (Andre); J.P. Casas (Juan); P. Eriksson (Per); M.V. Holmes (Michael); F.W. Asselbergs (Folkert); A. Hingorani (Aroon); S.E. Humphries (Steve)

    2013-01-01

    textabstractMethodsWe conducted a systematic review and meta-analysis of studies reporting circulating IL-6 in AAA, and new investigations of the association between a common non-synonymous functional variant (Asp358Ala) in the IL-6R gene (IL6R) and AAA, followed the analysis of the variant both in

  3. Efficient screening procedure for black sigatoka disease of banana ...

    African Journals Online (AJOL)

    Three East African highland genotypes (AAA-EA), one plantain genotype (ABB), two dessert (AAB and AAA) and one hybrid genotype (AAAA) were tested. Inoculum of M. fijiensis was adjusted to 15 mg ml-1 fragmented mycelium and applied to the abaxial surfaces of the first two open leaves. Plants were evaluated for 6 ...

  4. Mass or high-risk screening for abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Henneberg, E W; Fasting, H

    1997-01-01

    Abdominal aortic aneurysm (AAA) is known to be associated with various diseases, especially hypertension, acute myocardial infarction (AMI), chronic obstructive airway disease (COAD), and intermittent claudication. These associations have led to a debate about whether screening of older men for AAA...

  5. High heritability of liability to abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Mejnert Jørgensen, Trine; Christensen, Kaare; Lindholt, Jes Sanddal

    2016-01-01

    OBJECTIVE: First degree relatives of patients with abdominal aortic aneurysm (AAA) have an increased risk of developing AAA; however, despite intensive investigation, the specific genetic factors involved in the development of the disease are still largely unknown. In twin studies the influence...

  6. The composition of collagen in the aneurysm wall of men and women

    NARCIS (Netherlands)

    Villard, C.; Eriksson, P.; Hanemaaijer, R.; Lindeman, J.H.; Hultgren, R.

    2017-01-01

    Background. Loss of vessel wall integrity by degradation is essential for the development of abdominal aortic aneurysm (AAA) and ultimately its rupture. The observed greater rupture rate in women with AAA might be related to gender differences in the biomechanical properties of the aneurysm wall.

  7. Animal Models Used to Explore Abdominal Aortic Aneurysms

    DEFF Research Database (Denmark)

    Lysgaard Poulsen, J; Stubbe, J; Lindholt, J S

    2016-01-01

    OBJECTIVE: Experimental animal models have been used to investigate the formation, development, and progression of abdominal aortic aneurysms (AAAs) for decades. New models are constantly being developed to imitate the mechanisms of human AAAs and to identify treatments that are less risky than t...

  8. S&P: meie kohus oli USA riigireitingut alandada / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2011-01-01

    Standard & Poor´s langetas USA reitingut tasemelt AAA tasemeni AA+. Agentuuri esindaja sõnul oli reitingu alandamine nende kohustus, sest nende arvates oli USA senine reiting liiga kõrge. Hiina nõuab, et USA hakkaks oma võlaprobleemiga tegelema. AAA reiting on nüüd vaid 15 riigil või territooriumil maailmas

  9. Risk factors in abdominal aortic aneurysm and in Polish population aortoiliac occlusive disease and differences between them

    Science.gov (United States)

    Mikołajczyk-Stecyna, Joanna; Korcz, Aleksandra; Gabriel, Marcin; Pawlaczyk, Katarzyna; Oszkinis, Grzegorz; Słomski, Ryszard

    2013-01-01

    Abdominal aortic aneurysm (AAA) and aortoiliac occlusive disease (AIOD) are multifactorial vascular disorders caused by complex genetic and environmental factors. The purpose of this study was to define risk factors of AAA and AIOD in the Polish population and indicate differences between diseases. PMID:24346221

  10. NCBI nr-aa BLAST: CBRC-ACAR-01-0922 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0922 ref|NP_990821.1| rhodopsin [Gallus gallus] sp|P28683|OPSG_CHICK Green-sensitive opsin (Gre...en cone photoreceptor pigment) gb|AAA48786.1| green sensitive cone opsin gb|AAA49036.1| PRA1 NP_990821.1 0.0 92% ...

  11. NCBI nr-aa BLAST: CBRC-GGAL-26-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-26-0008 ref|NP_990821.1| rhodopsin [Gallus gallus] sp|P28683|OPSG_CHICK Green-sensitive opsin (Gre...en cone photoreceptor pigment) gb|AAA48786.1| green sensitive cone opsin gb|AAA49036.1| PRA1 NP_990821.1 0.0 100% ...

  12. Genetic variants associated with type 2 diabetes and adiposity and risk of intracranial and abdominal aortic aneurysms

    NARCIS (Netherlands)

    Hof, F.N. van 't; Vaucher, J.; Holmes, M.V.; Wilde, A. de; Baas, A.F.; Blankensteijn, J.D.; Hofman, A.; Kiemeney, L.A.L.M.; Rivadeneira, F.; Uitterlinden, A.G.; Vermeulen, S.H.; Rinkel, G.J.; Bakker, P.I. de; Ruigrok, Y.M.

    2017-01-01

    Epidemiological studies show that type 2 diabetes (T2D) is inversely associated with intracranial aneurysms (IA) and abdominal aortic aneurysms (AAA). Although adiposity has not been considered a risk factor for IA, there have been inconsistent reports relating adiposity to AAA risk. We assessed

  13. NCBI nr-aa BLAST: CBRC-TGUT-29-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-29-0011 ref|NP_990821.1| rhodopsin [Gallus gallus] sp|P28683|OPSG_CHICK Green-sensitive opsin (Gre...en cone photoreceptor pigment) gb|AAA48786.1| green sensitive cone opsin gb|AAA49036.1| PRA1 NP_990821.1 0.0 95% ...

  14. Impact of serological methodology on assessment of the link between Chlamydia pneumoniae and vascular diseases.

    NARCIS (Netherlands)

    Maraha, B.; Heijer, M. den; Kluytmans, J.A.J.W.; Peeters, M.

    2004-01-01

    We assessed the impact of five serologic tests on the link between Chlamydia pneumoniae and abdominal aortic aneurysms (AAA). The results of the tests were inconsistent. Agreement among the five tests was generally poor. Detection of the link between C. pneumoniae and AAA depends on the serologic

  15. A.A.A.会計原則の計算構造

    OpenAIRE

    岡田, 裕正

    1996-01-01

    This paper compares the accounting structure in the AAA's accoun-ting principle in 1941,AAA's accounting standards in 1948 and 1957. This paper clarifies that these accounting principle or standards have different accounting structure, because of different definitions of revenue/expence, cost/asset and income.

  16. Nationwide Study on the Risk of Abdominal Aortic Aneurysms in Patients With Psoriasis

    DEFF Research Database (Denmark)

    Khalid, Usman; Egeberg, Alexander; Ahlehoff, Ole

    2016-01-01

    OBJECTIVE: Abdominal aortic aneurysm (AAA) is a complex multifactorial disease associated with a high morbidity and mortality. Increased inflammation including T-helper 17 cell-mediated effects has been implicated in AAA pathogenesis. Psoriasis is considered to be a T-helper 17-driven chronic inf...

  17. Angiotensin-converting enzyme inhibitors and angiotensin II receptor blockers in patients with abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Kristensen, Karl Emil; Torp-Pedersen, Christian; Gislason, Gunnar Hilmar

    2015-01-01

    OBJECTIVE: The renin-angiotensin system is thought to play a pivotal role in the pathogenesis of abdominal aortic aneurysms (AAAs). However, effects of angiotensin-converting enzyme inhibitors (ACEIs) and angiotensin II type 1 receptor blockers (ARBs) on human AAAs remain unclear. We therefore ex...

  18. Allergic Lung Inflammation Aggravates Angiotensin II-Induced Abdominal Aortic Aneurysms in Mice

    DEFF Research Database (Denmark)

    Liu, Cong-Lin; Wang, Yi; Liao, Mengyang

    2016-01-01

    OBJECTIVE: Asthma and abdominal aortic aneurysms (AAA) both involve inflammation. Patients with asthma have an increased risk of developing AAA or experiencing aortic rupture. This study tests the development of one disease on the progression of the other. APPROACH AND RESULTS: Ovalbumin sensitiz...

  19. Impaired results of a randomised double blinded clinical trial of propranolol versus placebo on the expansion rate of small abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Henneberg, E W; Juul, Søren

    1999-01-01

    To study the propranolol treatment of small abdominal aortic aneurysms (AAA) concerning intention to treat, side effects, and inhibition of expansion.......To study the propranolol treatment of small abdominal aortic aneurysms (AAA) concerning intention to treat, side effects, and inhibition of expansion....

  20. Insulin-like growth factor I - a novel biomarker of abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Lindholt, J S; Martin-Ventura, J L; Urbonavicius, S

    2011-01-01

    The study aimed to test the potential role of insulin-like growth factor I (IGF-I) and IGF-II as biomarkers for abdominal aortic aneurysm (AAA).......The study aimed to test the potential role of insulin-like growth factor I (IGF-I) and IGF-II as biomarkers for abdominal aortic aneurysm (AAA)....

  1. Serum-elastin-peptides as a predictor of expansion of small abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Heickendorff, Lene; Henneberg, E W

    1997-01-01

    To optimise the indication and time for operation for abdominal aortic aneurysm (AAA), we analysed whether or not serum-elastin-peptides (SEP) could be a potential predictor for expansion.......To optimise the indication and time for operation for abdominal aortic aneurysm (AAA), we analysed whether or not serum-elastin-peptides (SEP) could be a potential predictor for expansion....

  2. Haemning af små abdominale aortaaneurismers ekspansion med roxithromycin. Resultater fra et randomiseret klinisk kontrolleret forsøg

    DEFF Research Database (Denmark)

    Vammen, Sten; Lindholt, Jes Sanddal; Østergaard, Lars J

    2002-01-01

    Macrolide treatment has been reported to reduce the risk of recurrent ischaemic heart disease. The influence of a macrolide on the expansion rate of small abdominal aortic aneurysms (AAA) is unknown at present. The aim of this study was to investigate the effect of roxithromycin on the expansion...... rate of small AAA....

  3. Therapeutic Prospect of Adipose-Derived Stromal Cells for the Treatment of Abdominal Aortic Aneurysm

    NARCIS (Netherlands)

    Parvizi, Mojtaba; Harmsen, Martin C.

    2015-01-01

    Aneurysm refers to the dilation of the vessel wall for more than 50%. Abdominal aortic aneurysm (AAA) refers to the dilation and weakening of all three layers of the abdominal aorta, which mostly occur infrarenally. The population aged above 50 years is at risk of AAA development, while a familiar

  4. A variant in LDLR is associated with abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Bradley, Declan T; Hughes, Anne E; Badger, Stephen A

    2013-01-01

    Abdominal aortic aneurysm (AAA) is a common cardiovascular disease among older people and demonstrates significant heritability. In contrast to similar complex diseases, relatively few genetic associations with AAA have been confirmed. We reanalyzed our genome-wide study and carried through...

  5. Long-term benefit and cost-effectiveness analysis of screening for abdominal aortic aneurysms from a randomized controlled trial

    DEFF Research Database (Denmark)

    Lindholt, Jes S.; Sørensen, J; Søgaard, R

    2010-01-01

    The aim was to estimate long-term mortality benefits and cost-effectiveness of screening for abdominal aortic aneurysm (AAA) in men aged 64-73 years.......The aim was to estimate long-term mortality benefits and cost-effectiveness of screening for abdominal aortic aneurysm (AAA) in men aged 64-73 years....

  6. The cardiac cycle is a major contributor to variability in size measurements of abdominal aortic aneurysms by ultrasound

    DEFF Research Database (Denmark)

    Grøndal, Nikolaj Fibiger; Bramsen, Morten; Thomsen, Marie Dahl

    2012-01-01

    The objective of the study was to evaluate the impact of the cardiac cycle on ultrasound measurements of abdominal aortic aneurysm (AAA) diameters.......The objective of the study was to evaluate the impact of the cardiac cycle on ultrasound measurements of abdominal aortic aneurysm (AAA) diameters....

  7. Proteomic identification of differentially expressed proteins in aortic wall of patients with ruptured and nonruptured abdominal aortic aneurysms

    DEFF Research Database (Denmark)

    Urbonavicius, Sigitas; Lindholt, Jes S.; Vorum, Henrik

    2009-01-01

    To compare the basic proteomic composition of abdominal aortic aneurysm (AAA) wall tissue in patients with nonruptured and ruptured aneurysms.......To compare the basic proteomic composition of abdominal aortic aneurysm (AAA) wall tissue in patients with nonruptured and ruptured aneurysms....

  8. Dicty_cDB: Contig-U06299-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ostelium discoideum chromosome 2 map 6445720... 34 0.095 9 ( EY123531 ) NADL-aaa19f11.g1 Rhodnius_prolix...us_EST_NADL_RpcDN... 36 0.11 2 ( EY123780 ) NADL-aaa19f11.b1 Rhodnius_prolixus_EST_NA

  9. Dicty_cDB: Contig-U15360-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) NADH-aaa04g01.g1 Rhodnius_prolixus_EST_NADH_T.cru... 44 7.9 1 ( FD777121 ) NAD...H-aaa04g01.b1 Rhodnius_prolixus_EST_NADH_T.cru... 44 7.9 1 ( EX721241 ) RaSFL 635 Rheum australe low-tempera

  10. Dicty_cDB: Contig-U16263-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Silur... 50 0.060 2 ( FD776384 ) NADH-aaa10f05.b1 Rhodnius_prolixus_EST_NADH_T....73b12.g1 Snail_EST_pSMART Biomphalaria gl... 44 0.064 2 ( FD777984 ) NADH-aaa10f05.g1 Rhodnius_prolixus_EST_

  11. Diastasis recti and abdominal aortic aneurysm.

    Science.gov (United States)

    Moesbergen, Todd; Law, Alice; Roake, Justin; Lewis, David R

    2009-01-01

    An association between abdominal aortic aneurysm (AAA) and abdominal wall hernia has been suggested, possibly reflecting a common collagen disorder. The same mechanism may also cause a greater frequency of diastasis recti among patients at risk of developing AAA. Diastasis recti could be used to identify patients at risk of AAA, with implications for AAA screening. The aim of this study was to determine whether an association between diastasis recti and AAA could be demonstrated.The preoperative computed tomographic (CT) scans of 75 male patients undergoing elective AAA repair were retrospectively examined and linea alba width recorded at supraumbilical and subumbilical levels. Measurements were compared with controls frequency matched for age.Fifty patients with AAA were observed to have supraumbilical diastasis recti on preoperative CT compared with 47 controls. Mean linea alba width was not significantly different between the two groups at either the supraumbilical (19.3 mm vs 20.7 mm, p = .45) or subumbilical (3.6 mm vs 4.3 mm, p = .43) level.The findings do not support the hypothesis that the presence of diastasis recti can serve as an indication to select male patients for screening for AAA.

  12. Estimating overdiagnosis in Screening for Abdominal Aortic Aneurysm

    DEFF Research Database (Denmark)

    Johansson, Minna; Hansson, Anders; Brodersen, J.

    2015-01-01

    Clinical context: Abdominal aortic aneurysms (AAAs) are often asymptomatic until they rupture, when the death rate is greater than 80%. If diagnosed before rupture, AAA can be treated with surgery, which has a mortality of 4-5% Diagnostic change: Sweden, the UK, and the US have initiated screenin...

  13. Noninvasive intrasac pressure measurement and the influence of type 2 and type 3 endoleaks in an animal model of abdominal aortic aneurysm.

    NARCIS (Netherlands)

    Milner, R.; Verhagen, H.J.; Prinssen, M.; Blankensteijn, J.D.

    2004-01-01

    The objective of this study was to noninvasively detect pressure changes within an excluded aneurysm sac in an animal model of abdominal aortic aneurysm (AAA) and to study the influence of type 2 and 3 endoleaks. A porcine model of AAA that allows for the creation of type 2 and 3 endoleaks was used.

  14. Collagen degradation in the abdominal aneurysm: a conspiracy of matrix metalloproteinase and cysteine collagenases.

    Science.gov (United States)

    Abdul-Hussien, Hazem; Soekhoe, Ratna G V; Weber, Ekkehard; von der Thüsen, Jan H; Kleemann, Robert; Mulder, Adri; van Bockel, J Hajo; Hanemaaijer, Roeland; Lindeman, Jan H N

    2007-03-01

    Growth and rupture of abdominal aortic aneurysms (AAAs) result from increased collagen turnover. Collagen turnover critically depends on specific collagenases that cleave the triple helical region of fibrillar collagen. As yet, the collagenases responsible for collagen degradation in AAAs have not been identified. Increased type I collagen degradation products confirmed collagen turnover in AAAs (median values: cysteine collagenases cathepsin K, L, and S as the principle collagenases in growing and ruptured AAAs. Except for modestly increased MMP-14 mRNA levels, collagenase expression was similar in growing and ruptured AAAs (anterior-lateral wall). Evaluation of posttranslational regulation of protease activity showed a threefold increase in MMP-8, a fivefold increase in cathepsins K and L, and a 30-fold increase in cathepsin S activation in growing and ruptured AAAs. The presence of the osteoclastic proton pump indicated optimal conditions for extracellular cysteine protease activity. Protease inhibitor mRNA expression was similar in AAAs and controls, but AAA protein levels of cystatin C, the principle cysteine protease inhibitor, were profoundly reduced (>80%). We found indications that this secondary deficiency relates to cystatin C degradation by (neutrophil-derived) proteases.

  15. Collagen degradation in the abdominal aneurysm: A conspiracy of matrix metalloproteinase and cysteine collagenases

    NARCIS (Netherlands)

    Abdul-Hussien, H.; Soekhoe, R.G.V.; Weber, E.; Thüsen, J.H. von der; Kleemann, R.; Mulder, A.; Hajo Van Bockel, J.; Hanemaaijer, R.; Lindeman, J.H.N.

    2007-01-01

    Growth and rupture of abdominal aortic aneurysms (AAAs) result from increased collagen turnover. Collagen turnover critically depends on specific collagenases that cleave the triple helical region of fibrillar collagen. As yet, the collagenases responsible for collagen degradation in AAAs have not

  16. Optimal intervalscreening og observation af abdominale aortaaneurismer

    DEFF Research Database (Denmark)

    Lindholt, Jes Sanddal; Vammen, Sten; Henneberg, E W

    2001-01-01

    Screening and observation of abdominal aortic aneurysms (AAA) produce psychological stress. Consequently, safe and optimal intervals of rescreening and observation must be developed.......Screening and observation of abdominal aortic aneurysms (AAA) produce psychological stress. Consequently, safe and optimal intervals of rescreening and observation must be developed....

  17. Proteomic Analysis of Intraluminal Thrombus Highlights Complement Activation in Human Abdominal Aortic Aneurysms

    DEFF Research Database (Denmark)

    Martinez-Pinna, Roxana; Madrigal-Matute, Julio; Tarin, Carlos

    2013-01-01

    To identify proteins related to intraluminal thrombus biological activities that could help to find novel pathological mechanisms and therapeutic targets for human abdominal aortic aneurysm (AAA).......To identify proteins related to intraluminal thrombus biological activities that could help to find novel pathological mechanisms and therapeutic targets for human abdominal aortic aneurysm (AAA)....

  18. NCBI nr-aa BLAST: CBRC-MMUS-16-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available nantly O-glycosylated, and a cysteine-rich transmembrane subunit, ASGP-2, which is predominantly N-glycosylated AAA85523.1 1e-128 47% ... ...CBRC-MMUS-16-0022 gb|AAA85523.1| Heterodimeric complex composed of a mucin subunit, ASGP-1, which is predomi

  19. NCBI nr-aa BLAST: CBRC-RNOR-11-0119 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available nantly O-glycosylated, and a cysteine-rich transmembrane subunit, ASGP-2, which is predominantly N-glycosylated AAA85523.1 0.0 65% ... ...CBRC-RNOR-11-0119 gb|AAA85523.1| Heterodimeric complex composed of a mucin subunit, ASGP-1, which is predomi

  20. NCBI nr-aa BLAST: CBRC-MMUS-16-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available nantly O-glycosylated, and a cysteine-rich transmembrane subunit, ASGP-2, which is predominantly N-glycosylated AAA85523.1 1e-151 48% ... ...CBRC-MMUS-16-0023 gb|AAA85523.1| Heterodimeric complex composed of a mucin subunit, ASGP-1, which is predomi