Sample records for aa redusere sannsynligheten
-
Energy Technology Data Exchange (ETDEWEB)
Ulsberg, Helge; Gaaserud, Oeystein; Loneland, Knut; Kristensen, Roar
2009-07-01
In January 2007 the inhabitants of the municipality of Steigen in Nordland county experienced a protracted power failure in the main power supply. A storm led to a breakdown on one of the two power supply lines which serve the region. The remaining power line turned out to be in such a bad condition that it did not stand up to the increased load. In November 2007 an excavator caused serious damage to the power distribution network in Oslo. The railways in the Eastern central region of Norway including Oslo came to a total halt. Critical societal functions were cut off from data communication for 10 hours. Both cases aroused considerable media interest and clearly demonstrated society's dependency of a reliable power supply. During the summer of 2007 NVE Norwegian Water Resources and Energy Directorate initiated the establishment of a joint project group, with representatives from Statnett SF (the main national grid owner and operator), the Directorate for Civil Defence and Emergency Planning and NVE. The objective was to analyse and assess the need for relevant improvement in procedures, guidance and regulations, in order to reduce the possibility of a similar incident, meaning a region without power supply over a longer period. The procedure project has a main limitation where it meets with the responsibilities of the power network suppliers. The basis for the project activities are the Energy Act and the Act on Supervision of Electricity Installations and Networks with further regulations. The project will sum up conditions and elements which are of vital importance when it comes to reduce the possibility of an extensive power failure: The correct and solid planning of the plants; The control during the construction process and after the finalization; The systematic control and implementation of maintenance and refurbishment; The updating of the plants in order to ensure delivery quality and safety level; Develop risk and vulnerability analyses for extreme situations; Use risk and vulnerability analyses for preventive and curtailing actions; Build up preparedness for worst-case situations. In the case of an extensive power failure the following measures may be decisive: The re-establishment effort must be based on a realistic time schedule; Assess fast engine-generator running versus extensive repair works; Prioritize critical end-users; Good information preparedness and active crisis communication. As a matter of form the project wishes to emphasize that end-users who are critically dependant of a continuous power supply must make provision for this themselves. As one of several results the project work has given a set of suggestions for improvement. Some suggestions have already been implemented or are in progress, while others demand further elaboration. The suggestions have been presented to sectoral organisations and the regional managers of the power supply authorities. The participation of sectoral organisations is important in several areas. The project suggests the following actions: The establishment of a supervision body between DSB and NVE in order to increase the efficiency of supervision. The establishment of a working group which will develop guidance concerning risk- and vulnerability analyses. The establishment of a working group which will develop thematic guidance on circuit protection. The establishment of a working group which will develop thematic guidance on control installations. Assess the need for production of information packages concerning law, provisions, guides and regulations. Clarify the need for competence groups on the subject circuit protection. Carry out supervision in the internal control systems of selected companies to create a basis for possible guidance and counselling. Assess the possibility of establishing an NVE project in order to get a total overview of the engine generators in possession of the power supply authorities and other generators of importance for the network. Assess the possibility of establishing a similar DSB-project in order to get an overview of available generators in the private area, as well as an overview of the need with critical societal users. Assess the need for closer supervision from the side of DSB concerning control and function testing. Increase the intensity of supervision from the public authorities involved. (EW)
-
Strategy to reduce radon exposure in Norway; Strategi for aa redusere radoneksponeringen i Norge
Energy Technology Data Exchange (ETDEWEB)
2009-06-15
Radon in indoor air is a more widespread problem in Norway than in many other countries. It can be estimated that radon in indoor air causes about. 300 lung cancer deaths annually in Norway. Norway, together with Sweden and Finland, are among the countries in the world with the highest average concentration of radon in indoor air. Geological conditions and the cool climate provides great challenges, but radon problem can be solved in a cost effective way. The risk increases with exposure and is proportional with radon concentrations in indoor air and exposure time. The risk from radon, however, no lower threshold value. Moreover, the risk is highest for those who smoke and those who have smoked previously, but non-smokers can also develop lung cancer as a result of radon exposure. In recent years it has been conducted three large, important international joint studies that confirm earlier estimates of the risk. (AG)
-
Tha, Na Gya; Wus, Thay
2017-01-01
In this article, Aa Ah Nak, the authors' methodology presents not only various reflections but also diverse contradictions about the Aa Nii language as well as language revitalization. This article explores language foundation and how the Aa Nii language revitalization is inextricably linked to the genocide and resulting historic trauma pervasive…
-
Photographic Service
1980-01-01
The AA in its final stage of construction, before it disappeared from view under concrete shielding. Antiprotons were first injected, stochastically cooled and accumulated in July 1980. From 1981 on, the AA provided antiprotons for collisions with protons, first in the ISR, then in the SPS Collider. From 1983 on, it also sent antiprotons, via the PS, to the Low-Energy Antiproton Ring (LEAR). The AA was dismantled in 1997 and shipped to Japan.
-
Constitutive behavior of as-cast AA1050, AA3104, and AA5182
van Haaften, W. M.; Magnin, B.; Kool, W. H.; Katgerman, L.
2002-07-01
Recent thermomechanical modeling to calculate the stress field in industrially direct-chill (DC) cast-aluminum slabs has been successful, but lack of material data limits the accuracy of these calculations. Therefore, the constitutive behavior of three aluminum alloys (AA1050, AA3104, and AA5182) was determined in the as-cast condition using tensile tests at low strain rates and from room temperature to solidus temperature. The parameters of two constitutive equations, the extended Ludwik equation and a combination of the Sellars-Tegart equation with a hardening law, were determined. In order to study the effect of recovery, the constitutive behavior after prestraining at higher temperatures was also investigated. To evaluate the quantified constitutive equations, tensile tests were performed simulating the deformation and cooling history experienced by the material during casting. It is concluded that both constitutive equations perform well, but the combined hardening-Sellars-Tegart (HST) equation has temperature-independent parameters, which makes it easier to implement in a DC casting model. Further, the deformation history of the ingot should be taken into account for accurate stress calculations.
-
Energy Technology Data Exchange (ETDEWEB)
Kubota, Akira [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Bainy, Afonso C.D. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Departamento de Bioquímica, CCB, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Woodin, Bruce R.; Goldstone, Jared V. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States)
2013-10-01
The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with
-
International Nuclear Information System (INIS)
Kubota, Akira; Bainy, Afonso C.D.; Woodin, Bruce R.; Goldstone, Jared V.; Stegeman, John J.
2013-01-01
The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with
-
Muhammad, Naeem; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka
2016-09-01
To investigate pathogenesis and kinetics of experimentally induced murine AA amyloidosis seeded with homologous (murine) and heterologous (bovine) AA fibrils. Experimental AA amyloidosis was induced by administration of inflammatory stimulus and preformed AA fibrils to a total of 111 female C57/Black mice. In this longitudinal study, heterologous (bovine) as well as homologous (murine) AA fibrils were injected intraperitoneally to mice in various combinations. Re-stimulation was done at 120 or 300 days post first inoculation. To analyze the intensity of amyloid depositions in mice organs, immunohistochemical techniques and image J software were used. Assessment of cytokines level in sera was done using a Mouse Th1/Th2/Th17 Cytokine CBA Kit. Incidence and severity of AA amyloidosis were quite low in mice inoculated with heterologous bovine AA fibrils than homologous murine one. Homologous AA fibrils administration at first and second inoculation caused maximum amount of amyloid depositions and severe systemic form of amyloidosis. Increase in the level of pro-inflammatory cytokine IL-6 was observed after first inoculation, while second inoculation caused a further increase in the level of anti-inflammatory cytokine IL-10. AA amyloidosis can be induced by heterologous as well as homologous AA fibrils. Severity of AA amyloidosis induced with homologous AA fibrils is higher compared to heterologous AA fibrils.
-
A.A., constructivism, and reflecting teams.
Nevels, B
1997-12-01
Numerous studies and clinical anecdotes reveal a relationship between attendance at A.A. meetings and/or degree of involvement in A.A. and maintenance of sobriety. Hypotheses as to how A.A. and/or the A.A. meeting is helpful to its members have ranged from a focus on factors common to all therapy groups, to aspects of A.A. "treatment" which are behavioral in nature. Presented here is another way of understanding A.A.'s effectiveness within the frame of more recent, constructivistic approaches to family therapy. In particular, the A.A. topic meeting is compared to the reflecting team concept of Tom Anderson.
-
Detection of AA76, a Common Form of Amyloid A Protein, as a Way of Diagnosing AA Amyloidosis.
Sato, Junji; Okuda, Yasuaki; Kuroda, Takeshi; Yamada, Toshiyuki
2016-01-01
Reactive amyloid deposits consist of amyloid A (AA) proteins, the degradation products of serum amyloid A (SAA). Since the most common species of AA is the amino terminal portion produced by cleavage between residues 76 and 77 of SAA (AA76), the presence of AA76 in tissues could be a consequence of AA amyloid deposition. This study assessed the diagnostic significance of the detection of AA76 for AA amyloidosis using two different approaches. Biopsy specimens (n=130 from 54 subjects) from gastroduodenal mucosa or abdominal fat (n=9 from 9 subjects) of patients who had already been diagnosed with or were suspected of having AA amyloidosis were used. Fixed mucosal sections were subjected to immunohistochemistry using a newly developed antibody recognizing the carboxyl terminal end of AA76 (anti-AA76). The non-fixed materials from gastroduodenal mucosa or abdominal fat were subjected to immunoblotting for detection of the size of AA76. Among the gastroduodenal specimens (n=115) from already diagnosed patients, the positive rates of Congo red staining, immunohistochemistry using anti-AA76, and immunoblotting were 68.4%, 73.0%, and 92.2%, respectively. The anti-AA76 did not stain the supposed SAA in the blood or leakage, which was stained by anti-SAA antibody. AA76 was not detected either by immunohistochemistry or by immunoblot in the materials from patients in whom AA amyloidosis had been ruled out. In the abdominal fat, the immunoblot detected AA76 in 8 materials from 8 already diagnosed patients and did not in 1 patient whose gastroduodenal mucosa was negative. In conclusion, the detection of AA76 may alter the ability to diagnose AA amyloidosis. In immunohistochemistry for fixed specimens, the new anti-AA76 antibody can improve the specificity. Immunoblot for non-fixed materials, which can considerably improve the sensitivity, should be beneficial for small materials like abdominal fat. © 2016 by the Association of Clinical Scientists, Inc.
-
Development of continuous cooling precipitation diagrams for aluminium alloys AA7150 and AA7020
Energy Technology Data Exchange (ETDEWEB)
Zhang, Y., E-mail: yong.zhang@outlook.com [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia); Milkereit, B. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Kessler, O. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); Schick, C. [University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Rometsch, P.A. [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia)
2014-01-25
Highlights: • The DSC method was used for developing continuous cooling precipitation diagrams. • The quench-induced particles were observed by SEM for alloys AA7150 and AA7020. • There were more quench-induced particles in alloy AA7150. • Quench sensitivity of Al alloys can be evaluated by using the CCP diagrams. -- Abstract: Two commercial 7xxx series aluminium alloys with different solute contents and different quench-induced precipitation behaviour have been investigated by using a specialised differential scanning calorimetry (DSC) technique to record exothermal heat outputs during continuous cooling. Together with hardness testing and microstructural analysis, this DSC method was used to develop continuous cooling precipitation (CCP) diagrams for alloys AA7150 and AA7020. The results show that the total precipitation heat for each alloy decreases with increasing cooling rate. However, the excess specific heat at a given cooling rate in alloy AA7150 is much higher than that in alloy AA7020. It is evident that there are atleast three different quench-induced reactions in different temperature regimes for alloy AA7150 cooled at various linear cooling rates, but only equilibrium MgZn{sub 2} (η-phase) and Al{sub 2}CuMg (S-phase) particles were observed by scanning electron microscopy (SEM). There are at least two main precipitation peaks that can be found for alloy AA7020, which correspond to Mg{sub 2}Si and MgZn{sub 2} (η-phase). Furthermore, a method is developed to evaluate the quench sensitivity of an alloy based on a determination of the critical cooling rate. The maximum hardness values are reached at cooling rates that are faster than or similar to the critical cooling rate.
-
Tian, Jing-Zhuo; Liang, Ai-Hua; Liu, Jing; Zhang, Bo-Li
2017-12-01
Aristolochic acids (AAs) widely exist in such plants as Aristolochia and Asarum. The renal toxicity of AAs as well as its carcinogenicity to urinary system have been widely known. In 2003 and 2004, China prohibited the use of Aristolochiae Radix, Aristolochiae Manshuriensis Caulis and Aristolochiae Fangchi Radix, and required administering other AAs-containing medicines in accordance with the regulations for prescription drugs. In this paper, we retrieved literatures on the content determination of AAs in recent 10 years in China. It suggested that the AAs content is lower in Asarum herb, especially in its roots and rhizomes, and most of which do not show detectable amount of AA-I. Some of traditional Chinese medicines show fairly small amount of detectable AA-I. The AAs content in Aristolochia herb (including Fructus Aristolochiae, kaempfer dutchmanspipe root) is relatively high; however, there are fewer literatures for studying the content determination of AAs in Chinese patent medicines. There were many factors affecting AAs content, including the parts used, origins, processing methods, extraction process. It suggested that we should pay attention to the toxicity of Chinese medicines containing AAs and use these decoction pieces and traditional Chinese medicines cautiously. In addition, basic studies for the origins, processing methods and extraction process of Chinese patent medicines containing AAs, as well as supervision and detection of AAs content in traditional Chinese medicinal materials, decoction pieces and Chinese patent medicines shall be strengthened for reducing medication risk and guaranteeing clinical medication safety. Copyright© by the Chinese Pharmaceutical Association.
-
CERN PhotoLab
1979-01-01
The AA at an early stage of construction, in the newly built AA-Hall. Cable-trays already outline the shape of the accumulator ring. To the right are huge cable-drums for the pulse-forming-network (PFN) of the injection kicker. Seeing this picture, can one imagine that only 8 months later beams were circulating in the completed accumulator ring ?
-
Laboratory Astrophysics Division of The AAS (LAD)
Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.
2012-10-01
The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.
-
Laboratory Astrophysics Division of the AAS (LAD)
Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.
2012-01-01
The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.
-
NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-04-0001 gb|AAS74960.1| 5-HT2 [Drosophila melanogaster] gb|AAS74962.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74964.1| 5-HT2 [Drosophila melanogaster] gb|AAS74966.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74970.1| 5-HT2 [Drosophila melanogaster] gb|AAS74972.1| 5-HT2 [Drosophila melanogaster]... gb|AAS74976.1| 5-HT2 [Drosophila melanogaster] gb|AAS74978.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74979.1| 5-HT2 [Drosophila melanogaster] gb|AAS74980.1| 5-HT2 [Drosophila melanogaster
-
NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-156 96% ...
-
NCBI nr-aa BLAST: CBRC-DMEL-04-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-165 100% ...
-
Lokalisering av arbeidsplasser og boliger
DEFF Research Database (Denmark)
Næss, Petter
2011-01-01
En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....
-
NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-02-0049 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela
-
NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0053 gb|AAS74380.1| 5-HT1B [Drosophila melanogaster] gb|AAS74382.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74389.1| 5-HT1B [Drosophila melanogaster] gb|AAS74402.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74403.1| 5-HT1B [Drosophila melanogaster] gb|AAS74405.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74406.1| 5-HT1B [Drosophila melanogaster] gb|AAS74411.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74412.1| 5-HT1B [Drosophila melanogaster] gb|AAS74413.1| 5-HT1B [Drosophila mela
-
NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-02-0049 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela
-
NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0053 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela
-
NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0056 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela
-
NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0057 gb|AAS74185.1| 5-HT1A [Drosophila melanogaster] gb|AAS74209.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74210.1| 5-HT1A [Drosophila melanogaster] gb|AAS74211.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74224.1| 5-HT1A [Drosophila melanogaster] gb|AAS74234.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74254.1| 5-HT1A [Drosophila melanogaster] gb|AAS74258.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74262.1| 5-HT1A [Drosophila melanogaster] gb|AAS74278.1| 5-HT1A [Drosophila mela
-
NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0056 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela
-
CERN PhotoLab
1978-01-01
Quickly improvised measurement equipment for the AA (Antiproton Accumulator) was all the tight schedule permitted, but the high motivation of the team made up for the lack of convenience. From left to right: Roy Billinge (Joint AA Project Leader, the other one was Simon van der Meer); Bruno Autin, Brian Pincott, Colin Johnson.
-
NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0057 gb|AAS74195.1| 5-HT1A [Drosophila melanogaster] gb|AAS74276.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74292.1| 5-HT1A [Drosophila melanogaster] gb|AAS74298.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74303.1| 5-HT1A [Drosophila melanogaster] gb|AAS74304.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74321.1| 5-HT1A [Drosophila melanogaster] gb|AAS74359.1| 5-HT1A [Drosophila melanogaster] AAS74195.1 1e-176 97% ...
-
2010-07-01
... (40 CFR Part 63, Subpart A) to Subpart AA A Appendix A to Subpart AA of Part 63 Protection of... Hazardous Air Pollutants From Phosphoric Acid Manufacturing Plants Pt. 63, Subpt. AA, App. A Appendix A to Subpart AA of Part 63—Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA 40 CFR...
-
Smit, EN; Koopmann, M; Boersma, ER; Muskiet, FAJ
We investigated whether supplementation with arachidonic acid (20:4 omega 6; AA), ora combination of AA and docosahexaenoic acid (22:6 omega 3; DHA) would affect human milk polyunsaturated fatty acid (PUFA) composition. Ten women were daily supplemented with 300 mg AA, eight with 300 mg AA, 110 mg
-
Baranek, Jakub; Kaznowski, Adam; Konecka, Edyta; Naimov, Samir
2015-09-01
Vegetative insecticidal proteins (Vips) secreted by some isolates of Bacillus thuringiensis show activity against insects and are regarded as insecticides against pests. A number of B. thuringiensis strains harbouring vip3A genes were isolated from different sources and identified by using a PCR based approach. The isolates with the highest insecticidal activity were indicated in screening tests, and their vip genes were cloned and sequenced. The analysis revealed two polymorphic Vip protein forms, which were classified as Vip3Aa58 and Vip3Aa59. After expression of the vip genes, the proteins were isolated and characterized. The activity of both toxins was estimated against economically important lepidopteran pests of woodlands (Dendrolimus pini), orchards (Cydia pomonella) and field crops (Spodoptera exigua). Vip3Aa58 and Vip3Aa59 were highly toxic and their potency surpassed those of many Cry proteins used in commercial bioinsecticides. Vip3Aa59 revealed similar larvicidal activity as Vip3Aa58 against S. exigua and C. pomonella. Despite 98% similarity of amino acid sequences of both proteins, Vip3Aa59 was significantly more active against D. pini. Additionally the effect of proteolytic activation of Vip58Aa and Vip3Aa59 on toxicity of D. pini and S. exigua was studied. Both Vip3Aa proteins did not show any activity against Tenebrio molitor (Coleoptera) larvae. The results suggest that the Vip3Aa58 and Vip3Aa59 toxins might be useful for controlling populations of insect pests of crops and forests. Copyright © 2015 Elsevier Inc. All rights reserved.
-
NCBI nr-aa BLAST: CBRC-DMEL-02-0054 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0054 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 0.0 100% ...
-
NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-02-0048 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 1e-163 91% ...
-
NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0057 gb|AAS74196.1| 5-HT1A [Drosophila melanogaster] gb|AAS74220.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74309.1| 5-HT1A [Drosophila melanogaster] gb|AAS74310.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74335.1| 5-HT1A [Drosophila melanogaster] AAS74196.1 1e-176 97% ...
-
NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0057 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-177 97% ...
-
International Nuclear Information System (INIS)
Na, Kyung-Hwan; Pyun, Su-Il
2008-01-01
The susceptibility to pitting corrosion of AA2024-T4, AA7075-T651 and AA7475-T761 aluminium alloys was investigated in aqueous neutral chloride solution for the purpose of comparison using electrochemical noise measurement. The experimentally measured electrochemical noises were analysed based upon the combined stochastic theory and shot-noise theory using the Weibull distribution function. From the occurrence of two linear regions on one Weibull probability plot, it was suggested that there existed two stochastic processes of uniform corrosion and pitting corrosion; pitting corrosion was distinguished from uniform corrosion in terms of the frequency of events in the stochastic analysis. Accordingly, the present analysis method allowed us to investigate pitting corrosion independently. The susceptibility to pitting corrosion was appropriately evaluated by determining pit embryo formation rate in the stochastic analysis. The susceptibility was decreased in the following order: AA2024-T4 (the naturally aged condition), AA7475-T761 (the overaged condition) and AA7075-T651 (the near-peak-aged condition)
-
Microstructural features of friction stir welded dissimilar Aluminium alloys AA2219-AA7475
Zaman Khan, Noor; Ubaid, Mohammed; Siddiquee, Arshad Noor; Khan, Zahid A.; Al-Ahmari, Abdulrahman; Chen, Xizhang; Haider Abidi, Mustufa
2018-05-01
High strength, good corrosion resistance, light weight make aluminium alloys a material of choice in many industrial sectors like aerospace, marine etc. Problems associated with welding of these alloys by fusion welding processes restricted their use in various industries. Friction stir welding (FSW), a clean solid-state joining process, easily overcomes various difficulties encountered during conventional fusion welding processes. In the present work, the effect of rotational speed (710 rpm, 900 rpm and 1120 rpm) on micro-hardness distribution and microstructure of FSWed dissimilar aluminium alloy joints were analyzed. Plates of AA7475-T761 and AA2219-O having thickness of 2.5 mm were welded by fixing AA7475 on retreating side (RS) and AA2219 on advancing side (AS). Welded joints were characterized by Vickers micro-hardness testing, scanning electron microscopy (SEM) and optical microscopy (OM). Results revealed that rotational speed significantly affects the micro-hardness due to increase in grain size, coarsening and dissolution of strengthening precipitates and re-precipitation. Higher micro-hardness values were observed in stir zone due to grain refinement and re-precipitation. Minimum micro-hardness value was observed at the TMAZ/HAZ of advancing side due to thermal softening.
-
National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa index provides a long climatology of global geomagnetic activity using 2 antipodal observatories at Greenwich and Melbourne- IAGA Bulletin 37,...
-
Directory of Open Access Journals (Sweden)
Chetan Patil
2016-07-01
Full Text Available This paper reports hardness testing conducted on welded butt joints by FSW and TIG welding process on similar and dissimilar aluminium alloys. FSW joints were produced for similar alloys of AA7075T651 and dissimilar alloys of AA7075T651- AA6061T6. The Friction stir welds of AA7075 & AA6061 aluminium alloy were produced at different tool rotational speeds of 650,700, 800, 900, 1000 and transverse speed of 30, 35, 40 mm/min. TIG welding was conducted along the rolling direction of similar and dissimilar aluminium plates. The Brinell hardness testing techniques were employed to conduct the tests; these tests were conducted on the welds to ascertain the joint integrity before characterization to have an idea of the quality of the welds
-
Watanabe, K; Uchida, K; Chambers, J K; Tei, M; Shoji, A; Ushio, N; Nakayama, H
2015-05-01
The incidence of AA amyloidosis is high in humans with rheumatoid arthritis and several animal species, including cats and cattle with prolonged inflammation. AA amyloidosis can be experimentally induced in mice using severe inflammatory stimuli and a coinjection of AA amyloid; however, difficulties have been associated with transmitting AA amyloidosis to a different animal species, and this has been attributed to the "species barrier." The interleukin-1 receptor antagonist knockout (IL-1raKO) mouse, a rodent model of human rheumatoid arthritis, has been used in the transmission of AA amyloid. When IL-1raKO and BALB/c mice were intraperitoneally injected with mouse AA amyloid together with a subcutaneous pretreatment of 2% AgNO3, all mice from both strains that were injected with crude or purified murine AA amyloid developed AA amyloidosis. However, the amyloid index, which was determined by the intensity of AA amyloid deposition, was significantly higher in IL-1raKO mice than in BALB/c mice. When IL-1raKO and BALB/c mice were injected with crude or purified bovine AA amyloid together with the pretreatment, 83% (5/6 cases) and 38% (3/8 cases) of IL-1raKO mice and 17% (1/6 cases) and 0% (0/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. Similarly, when IL-1raKO and BALB/c mice were injected with crude or purified feline AA amyloid, 33% (2/6 cases) and 88% (7/8 cases) of IL-1raKO mice and 0% (0/6 cases) and 29% (2/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. These results indicated that IL-1raKO mice are a useful animal model for investigating AA amyloidogenesis. © The Author(s) 2014.
-
Partially melted zone cracking in AA6061 welds
International Nuclear Information System (INIS)
Prasad Rao, K.; Ramanaiah, N.; Viswanathan, N.
2008-01-01
Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043
-
Partially melted zone cracking in AA6061 welds
Energy Technology Data Exchange (ETDEWEB)
Prasad Rao, K. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai (India)], E-mail: kpr@iitm.ac.in; Ramanaiah, N. [Sri Kalahasteeswara Institute of Technology, Srikalahasti (India); Viswanathan, N. [Defence Research and Development Laboratory, Hyderabad (India)
2008-07-01
Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043.
-
The AA disappearing under concrete shielding
CERN PhotoLab
1982-01-01
When the AA started up in July 1980, the machine stood freely in its hall, providing visitors with a view through the large window in the AA Control Room. The target area, in which the high-intensity 26 GeV/c proton beam from the PS hit the production target, was heavily shielded, not only towards the outside but also towards the AA-Hall. However, electrons and pions emanating from the target with the same momentum as the antiprotons, but much more numerous, accompanied these through the injection line into the AA ring. The pions decayed with a half-time corresponding to approximately a revolution period (540 ns), whereas the electrons lost energy through synchrotron radiation and ended up on the vacuum chamber wall. Electrons and pions produced the dominant component of the radiation level in the hall and the control room. With operation times far exceeding original expectations, the AA had to be buried under concrete shielding in order to reduce the radiation level by an order of magnitude.
-
Vik, Vidar Samson
2012-01-01
Vi opplever i dag en økt hyppighet av klimakatastrofer som flom og tørke som følge av økt konsentrasjon av klimagasser i atmosfæren. Dette har ført til et behov for å redusere klimagassutslippene fra industrien på jorden. Byggebransjen, ofte kalt 40 % -bransjen, står for om lag 40 % av klimagassutslippene, og har dermed et stort potensial for reduksjon. BIM er en prosess som søker å redusere ressursbruken, og er dermed en bærekraftig prosess som har blitt tatt i bruk i stor skala i nybygg. Re...
-
Obesity is a significant susceptibility factor for idiopathic AA amyloidosis.
Blank, Norbert; Hegenbart, Ute; Dietrich, Sascha; Brune, Maik; Beimler, Jörg; Röcken, Christoph; Müller-Tidow, Carsten; Lorenz, Hanns-Martin; Schönland, Stefan O
2018-03-01
To investigate obesity as susceptibility factor in patients with idiopathic AA amyloidosis. Clinical, biochemical and genetic data were obtained from 146 patients with AA amyloidosis. Control groups comprised 40 patients with long-standing inflammatory diseases without AA amyloidosis and 56 controls without any inflammatory disease. Patients with AA amyloidosis had either familial Mediterranean fever (FMF) or long-standing rheumatic diseases as underlying inflammatory disease (n = 111, median age 46 years). However, in a significant proportion of patients with AA amyloidosis no primary disease was identified (idiopathic AA; n = 37, median age 60 years). Patients with idiopathic AA amyloidosis were more obese and older than patients with AA amyloidosis secondary to FMF or rheumatic diseases. Serum leptin levels correlated with the body mass index (BMI) in all types of AA amyloidosis. Elevated leptin levels of more than 30 µg/l were detected in 18% of FMF/rheumatic + AA amyloidosis and in 40% of patients with idiopathic AA amyloidosis (p = .018). Finally, the SAA1 polymorphism was confirmed as a susceptibility factor for AA amyloidosis irrespective of the type of the disease. Obesity, age and the SAA1 polymorphism are susceptibility factors for idiopathic AA amyloidosis. Recent advances in treatment of FMF and rheumatic disorders will decrease the incidence of AA amyloidosis due to these diseases. Idiopathic AA, however, might be an emerging problem in the ageing and increasingly obese population.
-
International Nuclear Information System (INIS)
Knospe, W.H.; Steinberg, D.; Gratwohl, A.; Speck, B.
1984-01-01
Immunologically mediated aplastic anemia (AA) in mice was induced by the i.v. injection of 10(7) lymph node cells (LNC) from H-2k identical but Mls mismatched CBA/J donor mice into previously irradiated (600 rad total body gamma) C3H/HeJ mice. Cyclosporin A (CsA), 25 mg/kg, was administered subcutaneously from day -1 to day 30. Control mice included C3H/HeJ mice which received 600 rad alone, C3H/HeJ mice which received 600 rad plus CsA as above, and C3H/HeJ mice which received 600 rad total body irradiation followed by 10(7) LNC from CBA/J donors. CsA failed to prevent lethal AA. These results suggest that the pathogenetic mechanisms operating in immunologically mediated AA differ from the mechanisms operating in rodents transplanted with allogeneically mismatched marrow or spleen cells which develop graft-versus-host disease. The results are consistent with a non-T cell-dependent mechanism causing the AA
-
The Antiproton Accumulator (AA)
1980-01-01
A section of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A large vacuum-tank, a quadrupole (QDN09*), a bending magnet (BST08), another vacuum-tank, a wide quadrupole (QFW08) and (in the background) a further bending magnet (BST08). The tanks are covered with heating tape for bake-out. The tank left of QDN09 contained the kickers for stochastic pre-cooling (see 790621, 8002234, 8002637X), the other one served mainly as vacuum chamber in the region where the beam was large. Peter Zettwoch works on QFW08. * see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984) See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
-
Dissimilar friction stir welds in AA5083-AA6082: The effect of process parameters on residual stress
International Nuclear Information System (INIS)
Steuwer, A.; Peel, M.J.; Withers, P.J.
2006-01-01
The effect of tool traverse and rotation speeds on the residual stresses are quantified for welds between non-age-hardening AA5083 and age-hardening AA6082 and compared to single alloy joints made from each of the two constituents. The residual stresses have been characterised non-destructively by neutron diffraction and synchrotron X-ray diffraction. The region around the weld line was characterised by significant tensile residual stress fields which are balanced by compressive stresses in the parent material. The rotation speed of the tool has been found to have a substantially greater influence than the transverse speed on the properties and residual stresses in the welds, particularly on the AA5083 side where the location of the peak stress moves from the stir zone to beyond the edge of the tool shoulder. The changes in residual stress are related to microstructural and hardness changes as determined in a previous study . In particular the larger stresses under the weld tool on the AA5083 side compared to the AA6082 side are related to a transient reduction in yield stress due to dissolution of the hardening precipitates during welding prior to natural aging after welding
-
Ascorbic acid (AA) metabolism in protection against radiation damage
International Nuclear Information System (INIS)
Rose, R.C.; Koch, M.J.
1986-01-01
The possibility is considered that AA protects tissues against radiation damage by scavenging free radicals that result from radiolysis of water. A physiologic buffer (pH 6.7) was incubated with 14 C-AA and 1 mM thiourea (to slow spontaneous oxidation of AA). Aliquots were assayed by HPLC and scintillation spectrometry to identify the 14 C-label. Samples exposed to Cobalt-60 radiation had a half time of AA decay of 30 minutes) indicating that AA scavenges radiation-induced free radicals and forms the ascorbate free radical (AFR). Pairs of 14 C-AFR disproportionate, with the net effect of 14 C-dehydroascorbic acid formation from 14 C-AA. Having established that AFR result from ionizing radiation in an aqueous solution, the possibility was evaluated that a tissue factor reduces AFR. Cortical tissue from the kidneys of male rats was minced, homogenized in buffer and centrifuged at 8000 xg. The supernatant was found to slow the rate of radiation-induced AA degradation by > 90% when incubated at 23 0 C in the presence of 15 μM 14 C-AA. Samples of supernatant maintained at 100 0 C for 10 minutes or precipitated with 5% PCA did not prevent radiation-induced AA degradation. AA may have a specific role in scavenging free radicals generated by ionizing radiation and thereby protect body tissues
-
Directory of Open Access Journals (Sweden)
René Eduardo de‐Luna‐Alanís
2015-01-01
Full Text Available El trabajo tuvo como objetivo evaluar la influencia de la velocidad de la soldadura y de las correcciones del arco y pulso en el proceso de Transferencia Metálica Fría sobre las propiedades mecánicas de las aleaciones AA5083 y AA6061. Se desarrolló un diseño experimental de tipo factorial multinivel, con 4 factores independientes (Corrección de Arco, Pulso, Velocidad de Soldadura y Aleación. Los parámetros fundamentales fueron: Corriente de base 250 A; Voltaje de arco 21 V y Polaridad (Direct current electrode positive, DCEP. La evaluación se realizó a través de un ensayo de tracción transversal sobre probetas planas obtenidas de los cupones soldados. Se demuestra que el modelo aplicado es adecuado, revelándose en los experimentos diferencias sustanciales en las propiedades Tensión de fluencia 29,56 %, Módulo de elasticidad 51,16 % y Trabajo específico de deformación elástica 42,30 %, el cual no posee una dependencia lineal con elresto de las propiedades anteriores.Palabras claves: transferencia metálica fría, aleación AA5083, aleación AA6061, propiedades mecánicas._______________________________________________________________________________AbstractThe work objective was to evaluatethe influence of Cold Metal Transfer process arc and pulse corrections and welding speed on the mechanical properties of AA5083 and AA6061 aluminum alloys. For it, a Factorial Multilevel experimental design whit 4 independent factor (arc correction, pulse correction, welding speed and alloy was developed. The essential welding parameters employed were: base current 250 A; arc voltage 21 V and polarity (DCEP. The evaluation was made whit a transverse traction test of plate welded coupons. The experimental model applied wasadequate and substantial differences was showed between yield tensile strength 29,56 %, elasticity module (51,16 % and specific work of elastic deformation 42,30 %, which it does not possess a lineal dependence whit the rest
-
Side effects of AAS abuse: an overview.
Turillazzi, E; Perilli, G; Di Paolo, M; Neri, M; Riezzo, I; Fineschi, V
2011-05-01
Anabolic - androgenic steroids (AAS) were originally developed to promote growth of skeletal muscle. AAS abuse is commonly associated with bodybuilders, weightlifters, and other athletes. The issue of AAS toxicity is not yet completely understood since the adverse effects outline a varied scenario with side effects reported affecting many organs and systems in humans. The true incidence of AAS related medical problems is not known, due to several drawbacks in human studies. The entity of side effects depends on the sex, the dose, the duration of treatment, whether they are taken during exercise training or under sedentary conditions, and the susceptibility of the individuals themselves to androgen exposure partly depending on genetic factors. Both the acute and the chronic effects can lead to toxicity, but generally the serious and even fatal effects depend on the time and the duration of AAS administration. A limitation of human studies is represented by the fact that information about the intake of steroids are, generally, self reported and it is hardly possible to assess the exact dosage. AAS are often used in combination with other dugs or substances, so it is difficult to separate their toxic effects from those caused by the other drugs abused. Hence experimental studies conducted on animal models are mandatory to investigate the mechanisms underlying to AAS toxicity and the organ alterations due to these substances. Finally, clinicians should be aware of the complex and varied pattern of toxicity so as to be able to perform correct diagnoses and treatments.
-
«Selvbestemt abort – et sykepleiefaglig ansvar?»
Husebø, Karen Søyland; Brynildsrud, Nina Espedal
2015-01-01
Problemstilling: «Hvorfor søker unge kvinner i Norge abort, og hva kan bidra til å redusere aborttallene?» og «Hvordan ivareta den abortsøkende kvinne på sykehus?» Hensikt: I denne oppgaven vil vi se nærmere på hvilke kvinner som tar provosert abort, og hva som gjør at nettopp disse kvinnene velger dette. Vi skal også ta for oss hvilke tiltak som kan være med på å redusere aborttallene. Til slutt vil vi se på hva som er viktig i ivaretagelsen av kvinner som kommer til sykehuset for å ta...
-
First circulating beam in the AA
CERN PhotoLab
1980-01-01
On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.56 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are too numerous to name them all, but the 3 most prominent ones are at the centre (left to right): Roy Billinge (Joint AA Project Leader, with his hand on the control box), Eifionydd Jones (white shirt), Simon van der Meer (spiritus rector and Joint AA Project Leader). The first antiprotons were injected, made to circulate and cooled soon after, on 14 July 1980.
-
(PCL/AA) hydrogel for controlled drug delivery
Indian Academy of Sciences (India)
Administrator
applications, (iii) dental applications, (iv) injectable polymers, (v) ... PCL with AA grafted PCL(PCL-g-AA) on the structure ... porosity. Structure, morphology and crystallinity of PCL/ .... X-ray diffraction patterns were recorded, in reflection,.
-
Büsing, K; Berk, A; Müller, S; Kieckhäven, S; Krüger, K; Zeyner, A
2017-10-01
In practice, the content of standardized ileal digestible AA in complex feeds for pigs is calculated on the basis of tabulated values for individual feedstuffs. It comes into question, however, whether this truly reflects an accurate content based upon the estimate made for the individual feedstuffs. The objective of this study was to compare standardized ileal digestibility (SID) of crude protein (CP) and selected AA in complex feeds for grower and finisher pigs either calculated or experimentally determined. Six diets with increasing AA levels were prepared for grower (BW from 30 to 70 kg) and finisher (BW from 70 to 120 kg) feed. Crystalline L-lys, DL-met and L-thr were added to both diets, L-trp and L-val only to the grower feed. SID of both CP and AA was calculated from feed tables and experimentally determined in six adult minipigs (MINILEWE) with ileorectal anastomosis. With increasing AA levels, experimentally determined SID of supplemented AA increased (p AA via tabulated values for individual feedstuffs, however, seems to be acceptable for practical use. Journal of Animal Physiology and Animal Nutrition © 2017 Blackwell Verlag GmbH.
-
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AA02 (Link to dictyBase) - - - Contig-U16527-1 FC-AA02Z (Li...nk to Original site) - - FC-AA02Z 458 - - - - Show FC-AA02 Library FC (Link to library) Clone ID FC-AA02 (Link to dic...linum small subunit ribosomal RNA gene, partial sequence. 149 2e-47 2 AY179984 |AY179984.1 Uncultured alveo... CP000930_2283( CP000930 |pid:none) Heliobacterium modesticaldum Ic... 33 2.3 AP009386_1894( AP009386 |pid:none) Burkholderia multi... EU955514 |pid:none) Zea mays clone 1535262 hypothetica... 50 2e-05 BA000023_1285
-
Lamination sheet of AA BST magnet
CERN PhotoLab
1979-01-01
The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.
-
National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa indices are the continuation of the series beginning in the year 1868. A full description of these indices is given in the International...
-
Lazarus, Sheryl S.; Edwards, Lynn M.; Thurlow, Martha L.; Hodgson, Jennifer R.
2014-01-01
All states have alternate assessments based on alternate achievement standards (AA-AAS) for students with the most significant cognitive disabilities. For accountability purposes, the Elementary and Secondary Education Act (ESEA) allows up to 1% of students to be counted as proficient with this assessment option. In 2011 the U.S. Department of…
-
[AA amyloidosis: a little-known complication of chronic leg ulcer].
Waton, J; Fays-Michel, S; Chandeclerc, M L; Corby, S; Cuny, J F; Barbaud, A; Schmutz, J-L
2008-02-01
AA amyloidosis, secondary to inflammatory chronic diseases like rheumatoid arthritis, is often complicated by renal failure. Chronic inflammatory dermatoses constitute rare causes of AA amyloidosis. We describe two cases of AA amyloidosis discovered after renal failure in patients presenting leg ulcers for several years. AL amyloidosis was suspected in both cases because of a history of monoclonal gammopathy in one patient and of plasmocytoma in the other. The diagnosis of AA amyloidosis was confirmed on renal histology through the detection of AA antibodies in amyloid deposits. No extrarenal amyloidosis was seen in either patient and there were no inflammatory diseases other than chronic leg ulcers. AA amyloidosis is caused by serum amyloid protein A (SAA), a reactive inflammatory protein. AA amyloidosis is thus caused by chronic inflammatory diseases, but only rarely by cutaneous inflammatory diseases. To our knowledge, the literature contains only seven other published cases of AA amyloidosis secondary to chronic leg ulcers. A review of the literature does not indicate whether cure of ulcers has any effect on the accompanying renal failure. We imagine that AA amyloidosis secondary to leg ulcer is in fact under-diagnosed. However, since the first specific treatment for AA amyloidosis is currently being evaluated by the Food and Drug Administration, it is essential that this serious complication of chronic leg ulcers be widely recognised.
-
African Journals Online (AJOL)
Abia, AA. Vol 4, No 6 (2010) - Articles Studies on the kinetics and intraparticle diffusivities of BOD, colour and TSS reduction from palm oil mill effluent (POME) using boiler fly ash. Abstract PDF. ISSN: 1996-0786. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...
-
Schmies, Matthias; Patzer, Alexander; Schütz, Markus; Miyazaki, Mitsuhiko; Fujii, Masaaki; Dopfer, Otto
2014-05-07
Infrared photodissociation (IRPD) spectra of mass-selected cluster ions of acetanilide (N-phenylacetamide), AA(+)-Ln, with the ligands L = He (n = 1-2), Ar (n = 1-7), and N2 (n = 1-10) are recorded in the hydride stretch (amide A, νNH, νCH) and fingerprint (amide I-III) ranges of AA(+) in its (2)A'' ground electronic state. Cold AA(+)-Ln clusters are generated in an electron impact ion source, which predominantly produces the most stable isomer of a given cluster ion. Systematic vibrational frequency shifts of the N-H stretch fundamentals (νNH) provide detailed information about the sequential microsolvation process of AA(+) in a nonpolar (L = He and Ar) and quadrupolar (L = N2) solvent. In the most stable AA(+)-Ln clusters, the first ligand forms a hydrogen bond (H-bond) with the N-H proton of trans-AA(+) (t-AA(+)), whereas further ligands bind weakly to the aromatic ring (π-stacking). There is no experimental evidence for complexes with the less stable cis-AA(+) isomer. Quantum chemical calculations at the M06-2X/aug-cc-pVTZ level confirm the cluster growth sequence derived from the IR spectra. The calculated binding energies of De(H) = 720 and 1227 cm(-1) for H-bonded and De(π) = 585 and 715 cm(-1) for π-bonded Ar and N2 ligands in t-AA(+)-L are consistent with the observed photofragmentation branching ratios of AA(+)-Ln. Comparison between charged and neutral AA((+))-L dimers indicates that ionization switches the preferred ion-ligand binding motif from π-stacking to H-bonding. Electron removal from the HOMO of AA(+) delocalized over both the aromatic ring and the amide group significantly strengthens the C[double bond, length as m-dash]O bond and weakens the N-H bond of the amide group.
-
Characteristics of AA amyloidosis patients in San Francisco.
Lejmi, Hiba; Jen, Kuang-Yu; Olson, Jean L; James, Sam H; Sam, Ramin
2016-04-01
AA amyloidosis due to subcutaneous injection of drugs of abuse has been described in the USA, but all the existing literature is from more than 20 years ago. There is more recent literature from Europe. We have observed a high incidence of AA amyloidosis in the county hospital in San Francisco. Here, we describe 24 patients who had kidney biopsy-proven AA amyloidosis from our hospital from 1998 to 2013. All the patients were thought to have AA amyloidosis from skin popping of illicit drugs after having exhausted the intravenous route. These patients with biopsy-proven AA amyloidosis were analysed further. All patients were found to have hepatitis C infection, hypertension was not common, most had advanced kidney failure, and acidosis was common as was tubulointerstitial involvement on the kidney biopsy. Other organ involvement included hepatomegaly and splenomegaly in a number of patients; direct myocardial involvement was not seen, but pulmonary hypertension, history of deep vein thrombosis and pulmonary embolism were common. The prognosis of these patients was poor. The mortality rate approached 50% 1 year after biopsy, and most of the patient needed dialysis shortly after diagnosis. Cessation of drug use seemed beneficial but rarely achievable. AA amyloidosis from skin popping is common in San Francisco. Most patients with renal involvement end up on dialysis, and mortality rates are exceedingly high. © 2015 Asian Pacific Society of Nephrology.
-
The Antiproton Accumulator (AA)
1980-01-01
Section 06 - 08*) of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A vacuum-tank, two bending magnets (BST06 and BST07 in blue) with a quadrupole (QDN07, in red) in between, another vacuum-tank, a wide quadrupole (QFW08) and a further tank . The tanks are covered with heating tape for bake-out. The tank left of BST06 contained the stack core pickup for stochastic cooling (see 7906193, 7906190, 8005051), the two other tanks served mainly as vacuum chambers in the region where the beam was large. Peter Zettwoch works on BST06. *) see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984)
-
Effect of pressurized steam on AA1050 aluminium
DEFF Research Database (Denmark)
Jariyaboon, Manthana; Møller, Per; Ambat, Rajan
2012-01-01
Purpose - The purpose of this paper is to understand the effect of pressurized steam on surface changes, structures of intermetallic particles and corrosion behavior of AA1050 aluminium. Design/methodology/approach - Industrially pure aluminium (AA1050, 99.5 per cent) surfaces were exposed...... reactivities was observed due to the formation of the compact oxide layer. Originality/value - This paper reveals a detailed investigation of how pressurized steam can affect the corrosion behaviour of AA1050 aluminium and the structure of Fe-containing intermetallic particles....
-
Ashok Kumar, R.; Thansekhar, M. R.
2018-04-01
This paper deals the combinational effect of friction stir welding and friction stir processing on dissimilar AA6101-T6 and AA1350 aluminium alloys. For that, alumina particles are reinforced at interface region of AA6101-T6 and AA1350 aluminium alloys. Friction Stir Welding and Friction Stir Processing are done simultaneously for various sizes of groove. To analyze the welding quality and surface modifications, mechanical, wear and microstructural tests are carried out. Among these, smallest groove of 0.5 mm width and 1 mm depth reveals highest tensile and bending strengths and largest groove of 2 mm width and 3 mm depth gives maximum hardness and wear resistance. Taguchi technique shows that groove width is most influencing parameter. Developed second order models with interaction predict the responses with minimum error.
-
Simon van der Meer in the AA Control Room
CERN PhotoLab
1984-01-01
Simon van der Meer, spiritus rector of the Antiproton Accumulator, in the AA Control Room. Inventor of stochastic cooling, on which the AA was based, and of the magnetic horn, with which the antiprotons were focused, he also wrote most of the software with which the AA was controlled, and spent uncountable numbers of hours in this chair to tickle the AA to top performance. 8 months after this picture was taken, he received, in October 1984, the Nobel prize, together with Carlo Rubbia, the moving force behind the whole Proton-Antiproton Collider project that led to the discovery, in 1983, of the W and Z intermediate bosons.
-
Inclusive cross sections in AA collisions at high energies
International Nuclear Information System (INIS)
Braun, M.A.
1988-01-01
Inclusive cross sections in AA collisions at high energies are considered in the Glauber multiple scattering theory taking into account many-nucleon collisions. Correspondence is found between the AA amplitude and the effective action of the two-dimensional quantum field theory with exponential interaction. The tree and one-loop contributions are calculated in this formalism. The rules are derived, which relate the absorption part of the AA-collision amplitudes associated with various inclusive cross sections to the absorption parts of NN amplitudes. These rules generalize the well-known Agranowsky-Gribov-Kanchelli rules for hh and hA collisions. Formulas are written for single and double inclusive cross sections in AA collisions
-
Bake hardening of nanograin AA7075 aluminum alloy
International Nuclear Information System (INIS)
Dehghani, Kamran
2011-01-01
Highlights: ► The bake hardening behavior of AA7075 was studied and compared with its coarse-grain counterpart. ► Nanograin AA7075 exhibited 88–100% increase in bake hardenability. ► Nanograin AA7075 exhibited 36–38% increase in final yield strength after baking. ► Maximum bake hardenability and final yield stress were about 185 MPa and 719 MPa. - Abstract: In the present work, the bake hardening of nanostructured AA7075 aluminum alloy was compared with that of its coarse-grain counterpart. Surface severe plastic deformation (SSPD) was used to produce nanograin layers on both surfaces of workpieces. The nanostructured layers were characterized using scanning electron microscopy (SEM) and atomic force microscopy (AFM) techniques. The thickness of nanostructured layer, having the grains of 50–110 nm, was about 75 μm on each side of workpiece. The bake hardenability of nanograin and coarse-grain AA7075 was then compared by pre-straining to 2, 4 and 6% followed by baking at 100 °C and 200 °C for 20 min. Comparing to coarse-grain case, there was about 88–100% increase in bake hardenability and about 36–38% increase in yield strength after the bake hardening of present nanograin AA7075. Such an increase in bake hardenability and strength was achieved when the thickness of two nanograin layers was about only one-tenth of the whole thickness.
-
Mechanical and corrosion properties of AA8011 sheets and foils:
Asanović, Vanja; Dalijić, Kemal; Radonjić, Dragan
2006-01-01
The mechanical and corrosion properties of a twin-roll cast Al-Fe-Si aluminum alloy with 0.74 % Fe and 0.52 % Si (AA8011) were investigated. The influence of the thermo-mehanical processing route on the mechanical behavior of AA8011 sheets was determined. Comparisons were made with AA3003 and A199.5 sheets. The restoration of the mechanical properties was used in the analysis of the recrystallization behavior of the twin-roll cast AA8011 alloy deformed under cold-working conditions and subseq...
-
African Journals Online (AJOL)
Fred-Jaiyesimi, AA. Vol 12 (2008) - Articles Hypoglycaemic And Alpha-Amylase Inhibitory Activities Of Fermented Seeds Of Parkia Biglobosa (Jacq) Benth Abstract. ISSN: 1118-6267. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...
-
Displaying Now-Understanding: The Finnish Change-of-State Token "aa"
Koivisto, Aino
2015-01-01
This article discusses the use of the Finnish change-of-state token "aa" that has previously not been identified. The central claim is that even though "aa" indicates a cognitive shift experienced by the speaker, it does not function as a receipt of new information. Instead, the token "aa" indicates that the speaker…
-
Dynamic Response and Microstructure Evolution of AA2219-T4 and AA2219-T6 Aluminum Alloys
Olasumboye, A.; Owolabi, G.; Odeshi, A.; Zeytinci, A.; Yilmaz, N.
2018-02-01
In this study, the dynamic deformation behavior of AA2219 aluminum alloy was investigated in two different temper conditions: T4 and T6, with a view to determining the effect of heat treatment on the microstructure and flow behavior of the material under high strain rates. Split Hopkinson pressure bar experiment was used in determining the dynamic response of the alloy while a digital image correlation system was employed in visualizing and tracking the surface deformation of the specimens. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. The results obtained showed heterogeneous deformation of the alloy in the two temper conditions. It was observed that the dynamic mechanical behavior of each sample preparation was dependent on its strength properties due to aging type, which in turn controls the metamorphosis of the strengthening precipitates and the initial microstructure. At the maximum strain rate of 3500 s-1, transformed bands leading to crack nucleation was observed in the AA2219-T4 aluminum alloy while AA2219-T6 had fractured at the same strain rate. The modes of crack formation and growth in the two alloys were found to be similar: nucleation, growth and coalescence of voids. However, shear band bifurcation phenomenon was observed only in the AA2219-T6 alloy.
-
Nakayama, Yumi; Kamiie, Junichi; Watanabe, Gen; Suzuki, Kazuhiko; Murakami, Tomoaki
2017-11-01
The authors describe a spontaneous case of amyloid A (AA) amyloidosis in an adult female Japanese quail ( Coturnix japonica). The bird developed AA amyloidosis secondary to chronic peritonitis caused by a Gram-negative bacillus infection. Mild amyloid deposition was also identified in the intestinal tract of apparently healthy adult individuals, suggesting that quail may develop intestinal amyloidosis with age. Based on these observations, it was hypothesized that quail can develop AA amyloidosis following inflammatory stimulation with lipopolysaccharide (LPS). Therefore, adult quail were repeatedly injected with LPS and the development of AA amyloidosis was confirmed. The amyloid deposition in this model increased when quail amyloid was intravenously injected as an amyloid-enhancing factor. The experiments were repeated with young quail, but amyloid deposits were not observed following LPS injections. However, AA amyloidosis did develop when quail amyloid was injected in addition to LPS. These results indicated that adult quail develop AA amyloidosis after inflammatory stimulation with LPS. Furthermore, quail AA amyloidosis was shown to have transmissibility regardless of age. Interestingly, the authors found that administration of chicken amyloid fibrils also induced AA amyloidosis in young quail. This is the first report of cross-species transmission of avian AA amyloidosis.
-
AA Attendance and Abstinence for Dually Diagnosed Patients: A Meta-Analytic Review.
Scott Tonigan, J; Pearson, Matthew R; Magill, Molly; Hagler, Kylee J
2018-05-29
There is consensus that best clinical practice for dual diagnosis (DD) is integrated mental health and substance use treatment augmented with Alcoholics Anonymous (AA) attendance. This is the first quantitative review of the direction and magnitude of the association between AA attendance and alcohol abstinence for DD patients. A systematic literature search (1993-2017) identified 22 studies yielding 24 effect sizes that met our inclusion criteria (8,075 patients). Inverse-variance weighting of correlation coefficients (r) was used to aggregate sample-level findings and study aims were addressed using random and mixed effect models. Sensitivity and publication bias analyses were conducted to assess the likelihood of bias in the overall estimate of AA-related benefit. AA exposure and abstinence for DD patients were significantly and positively associated (r w =.249; 95% CI.203-.293; Tau=.097). There was also significant heterogeneity in the distribution of effect sizes, (Q(23)=90.714, pAA-related benefit did not differ between 6 (k=7) and 12 (k=12) month follow-up, (Q=.068, pAA benefit was not adversely or substantively impacted by pooling RCT and observational samples (Q=.763, pAA (Q=.023, pAA) is common and, in many cases, DD patients who attend AA will report higher rates of alcohol abstinence relative to DD patients who do not attend AA. This article is protected by copyright. All rights reserved.
-
Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo.
Jing, Yue; Wang, Gang; Xiao, Qi; Zhou, Yachun; Wei, Yingjie; Gong, Zhunan
2018-01-01
Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA) has demonstrated anticancer properties and we suspect this might be attributable to an effect on angio-genesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-L-proline methyl ester (AA-PMe), has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs). First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF) present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2)-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP) transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline phosphatase assay. VEGFR2 expression in whole embryos following AA-PMe treatment was also determined. We found AA-PMe decreased cell viability and inhibited migration and tube formation in a dose-dependent manner in HUVECs. Similarly, AA-PMe disrupted the formation of intersegmental vessels, the dorsal aorta, and the posterior cardinal vein in zebrafish embryos. Both in vitro and in vivo AA-PMe surpassed AA in its ability to block angiogenesis by suppressing VEGF-induced phosphorylation of VEGFR2 and disrupting downstream extracellular regulated protein kinase and AKT signaling. For the first time
-
Controlled release of bioactive PDGF-AA from a hydrogel/nanoparticle composite.
Elliott Donaghue, Irja; Shoichet, Molly S
2015-10-01
Polymer excipients, such as low molar mass poly(ethylene glycol) (PEG), have shown contradictory effects on protein stability when co-encapsulated in polymeric nanoparticles. To gain further insight into these effects, platelet-derived growth factor (PDGF-AA) was encapsulated in polymeric nanoparticles with vs. without PEG. PDGF-AA is a particularly compelling protein, as it has been demonstrated to promote cell survival and induce the oligodendrocyte differentiation of neural stem/progenitor cells (NSPCs) both in vitro and in vivo. Here we show, for the first time, the controlled release of bioactive PDGF-AA from an injectable nanoparticle/hydrogel drug delivery system (DDS). PDGF-AA was encapsulated, with high efficiency, in poly(lactide-co-glycolide) nanoparticles, and its release from the drug delivery system was followed over 21 d. Interestingly, the co-encapsulation of low molecular weight poly(ethylene glycol) increased the PDGF-AA loading but, unexpectedly, accelerated the aggregation of PDGF-AA, resulting in reduced activity and detection by enzyme-linked immunosorbent assay (ELISA). In the absence of PEG, released PDGF-AA remained bioactive as demonstrated with NSPC oligodendrocyte differentiation, similar to positive controls, and significantly different from untreated controls. This work presents a novel delivery method for differentiation factors, such as PDGF-AA, and provides insights into the contradictory effects reported in the literature of excipients, such as PEG, on the loading and release of proteins from polymeric nanoparticles. Previously, the polymer poly(ethylene glycol) (PEG) has been used in many biomaterials applications, from surface coatings to the encapsulation of proteins. In this work, we demonstrate that, unexpectedly, low molecular weight PEG has a deleterious effect on the release of the encapsulated protein platelet-derived growth factor AA (PDGF-AA). We also demonstrate release of bioactive PDGF-AA (in the absence of PEG
-
Magnetic horn of the Antiproton Accumulator (AA)
Photographic Service
1988-01-01
In the 1960s, the invention of this "current sheet lens" has helped to greatly improve the flux of neutrino beams. It was used again at the AA, collecting antiprotons from the production target at angles too large to fit into the acceptance of the AA. It was machined from aluminium to a thickness of 1.4 mm and pulsed at 400 kA for 15 microseconds (half-sine).
-
Inhibitory effect of propolis on the development of AA amyloidosis.
Harata, Daichi; Tsuchiya, Yuya; Miyoshi, Tomoyuki; Yanai, Tokuma; Suzuki, Kazuhiko; Murakami, Tomoaki
2018-04-01
In the several types of amyloidoses, participation of oxidative stresses in the pathogenesis and the effect of antioxidants on amyloidosis have been reported. Meanwhile, the relationship between oxidative stresses and pathogenesis of amyloid A (AA) amyloidosis is still unclear. In this study, we used an antioxidant, Brazilian propolis, to investigate the inhibitory effects on AA amyloidosis. The results showed that AA deposition was inhibited by administration of propolis. Increased expression of antioxidant markers was detected in molecular biological examinations of mice treated with propolis. Although serum amyloid A (SAA) levels were strongly correlated with the immunoreactive area of AA deposits in the control group, the correlation was weaker in the propolis-treated groups. In addition, there were no changes in SAA levels between the control group and the propolis-treated groups. The results indicate that propolis, an antioxidant, may induce inhibitory effects against AA amyloidosis.
-
NCBI nr-aa BLAST: CBRC-XTRO-01-0674 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0674 ref|YP_001022362.1| putative heme O oxygenase (cytochrome aa3-controlling...) transmembrane protein [Methylibium petroleiphilum PM1] gb|ABM96127.1| putative heme O oxygenase (cytochrome aa3-controlling
-
Outcomes From AAS Hack Day at the 227th AAS Meeting
Kohler, Susanna
2016-01-01
Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts
-
Corrosion issues of powder coated AA6060 aluminium profiles
DEFF Research Database (Denmark)
Din, Rameez Ud; Valgarðsson, Smári; Jellesen, Morten Stendahl
2015-01-01
In this study detailed microstructural investigation of the reason for unexpected corrosion of powder coated aluminium alloy AA6060 windows profiles has been performed. The results from this study reveals that the failure of the window profiles was originated from the surface defects present...... on the extruded AA6060 aluminium profile after metallurgical process prior to powder coating. Surface defects are produced due to intermetallic particles in the alloy, which disturb the flow during the extrusion process. The corrosion mechanism leading to the failure of the powder coated AA6060 aluminium profiles...
-
Core–corona PSt/P(BA–AA) composite particles by two-stage emulsion polymerization
Energy Technology Data Exchange (ETDEWEB)
Xie, Delong; Ren, Xiaolin; Zhang, Xinya, E-mail: cexyzh@scut.edu.cn; Liao, Shijun [South China University of Technology, School of Chemistry and Chemical Engineering (China)
2016-03-15
Raspberry-shaped composite particles with polystyrene (PSt) as core and poly(n-butyl acrylate-co-acrylic acid) (P(BA–AA)) as corona were synthesized via emulsion polymerization. The random copolymer, P(BA–AA), was pre-prepared and used as a polymeric surfactant, its emulsifying properties adjusted by changing the mass ratio of BA and AA. The morphology of the resulting core–corona composite particles, P(St/P(BA–AA)), could be regulated and controlled by varying the concentrations of P(BA–AA) or the mass ratio of BA:AA in P(BA–AA). The experimental results indicate that 3.0–6.0 wt% of P(BA–AA) is required to obtain stable composite emulsions, and P(BA–AA) with a mass ratio of BA:AA = 1:2 is able to generate distinct core–corona structures. A mechanism of composite particle formation is proposed based on the high affinity between the PSt core and the hydrophobic segments of P(BA–A). The regular morphology of the colloidal film is expected to facilitate potential application of core–corona particles in the field of light scattering. Furthermore, the diversity of core–corona particles can be expanded by replacing P(BA–AA) corona particles with other amphiphilic particles.
-
Energy Technology Data Exchange (ETDEWEB)
Verstraete, K., E-mail: kevin.verstraete@u-psud.fr [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Helbert, A.L. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Brisset, F. [Université Paris-Sud, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Benoit, A.; Paillard, P. [Institut des Matériaux Jean Rouxel (IMN), UMR 6502, Polytech’Nantes, Nantes Cedex (France); Baudin, T. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France)
2015-07-29
AA6061 alloy is a widely used material in the automotive and aerospace industries, but is prone to hot cracking, which limits its weldability. To prevent this phenomenon, the AA6061/AA5754 composite was formed using a severe plastic deformation technique, Cross Accumulative Roll Bonding (CARB), at an elevated temperature (350 °C) to ensure good bonding between layers. This technique was efficient to maintain a small grain size, even under the process temperature conditions, and consequently, preserve good mechanical properties. The composite had better mechanical properties than the initial aluminium alloys. Microstructure and texture remained stable after two cycles and yield stress tended towards an equal value in the rolling and the transverse directions. After two cycles, the main component was the {001}〈110〉 rotated Cube, which was maintained for up to 10 cycles. Diffusion was more effective as the strain increased. Finally, a tungsten inert gas (TIG) welding process was performed on the composite and confirmed resistance to hot cracking.
-
Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo
Directory of Open Access Journals (Sweden)
Jing Y
2018-04-01
Full Text Available Yue Jing,1,2,* Gang Wang,1,* Qi Xiao,1 Yachun Zhou,1 Yingjie Wei,3 Zhunan Gong1 1Center for New Drug Research and Development, College of Life Science, Nanjing Normal University, Nanjing, China; 2Central Laboratory of Stomatology, Nanjing Stomatological Hospital, Medical School of Nanjing University, Nanjing, China; 3Key Laboratory of Oral Drug Delivery System of Chinese Materia Medica of State Administration of Traditional Chinese Medicine, Jiangsu Branch of China Academy of Chinese Medical Science, Nanjing, China *These authors contributed equally to this work Abstract: Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA has demonstrated anticancer properties and we suspect this might be attributable to an effect on angiogenesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl-L-proline methyl ester (AA-PMe, has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. Methods: In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs. First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline
-
Role and mechanism of AT1-AA in the pathogenesis of HELLP syndrome.
Bu, Shurui; Wang, Yuxian; Sun, Shuqing; Zheng, Yanqian; Jin, Zhu; Zhi, Jianming
2018-01-10
HELLP syndrome remains a leading cause of maternal and neonatal mortality and morbidity worldwide, which symptoms include hemolysis, elevated liver enzymes and low platelet count. The objective of this study was to determine whether HELLP is associated with AT1-AA. The positive rate and titer of AT1-AA in plasma from pregnant women were determined, and the correlation of AT1-AA titer with the grade of HELLP was analyzed. A HELLP rat model established by intravenous injection of AT1-AA. Our experimental results show the AT1-AA titer and positive rate were significantly higher in HELLP group, and AT1-AA titer were positively correlated with the level of TNF-α and ET-1 in plasma and the grade of HELLP syndrome. The results of animal experiments showed that the typical features of HELLP in the pregnant rats after AT1-AA injection. The levels of TNF-α and ET-1 in plasma and liver tissue were significantly increased in AT1-AA-treated rats compared with control rats. The HELLP syndrome induced by AT1-AA was attenuated markedly after administration of losartan. These data support the hypothesis that one the potential pathway that AT1-AA induce damage to capillary endothelial cells and liver during pregnancy is through activation of TNF-α and ET-1.
-
Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease
Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi
2008-01-01
AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were different from those of the liver with regard to molecular weight and shape and had greater transmissibility. The infectious activity of fecal AA amyloid fibrils was reduced or abolished by the protein denaturants 6 M guanidine·HCl and formic acid or by AA immunodepletion. Thus, we propose that feces are a vehicle of transmission that may accelerate AA amyloidosis in captive cheetah populations. These results provide a pathogenesis for AA amyloidosis and suggest possible measures for rescuing cheetahs from extinction. PMID:18474855
-
Large magnetoresistance in (AA')2FeReO6 double perovskites
International Nuclear Information System (INIS)
Teresa, J.M. de; Serrate, D.; Blasco, J.; Ibarra, M.R.; Morellon, L.
2005-01-01
We review the main structural, magnetic and magnetotransport properties of the intriguing (AA') 2 FeReO 6 magnetic double perovskites. As the average cation size decreases, the crystallographic structure at room temperature evolves from cubic [(AA') 2 =Ba 2 , Ba 1.5 Sr 0.5 , BaSr, Ba 0.5 Sr 1.5 ] to tetragonal [(AA') 2 =Sr 2 ] and monoclinic [(AA') 2 =Ca 0.5 Sr 1.5 , CaSr, Ca 1.5 Sr 0.5 , Ca 2 ]. The Curie temperature increases anomalously from ∼303K for Ba 2 to ∼522K for Ca 2 in sharp contrast with the observed behaviour in the isostructural compounds (AA') 2 FeMoO 6 . Other anomalous features in the (AA') 2 FeReO 6 series are: the large magnetic anisotropy, the large magnetoelastic coupling and the semiconducting behaviour of the monoclinic compounds. The monoclinic compounds undergo a structural/magnetic transition at T S below 125K. Three different magnetoresistance mechanisms have been identified: the intergrain negative magnetoresistance effect, which is present across the whole series of compounds, and in the case of the monoclinic compounds below T S a negative magnetoresistance effect associated to the melting of the low-temperature phase and a positive magnetoresistance effect only present in (AA') 2 =Ca 2 below T∼50K
-
The Drentsche Aa valley system
International Nuclear Information System (INIS)
Gans, W. de.
1981-01-01
This thesis is composed of five papers concerned with Late Quaternary geology and geomorphology of the Aa valley system. The correlation and chronostratigraphic position of the layers have been established by radiocarbon dating. (Auth.)
-
AaERF1 positively regulates the resistance to Botrytis cinerea in Artemisia annua.
Directory of Open Access Journals (Sweden)
Xu Lu
Full Text Available Plants are sessile organisms, and they can not move away under abiotic or biotic stresses. Thus plants have evolved a set of genes that response to adverse environment to modulate gene expression. In this study, we characterized and functionally studied an ERF transcription factor from Artemisia annua, AaERF1, which plays an important role in biotic stress responses. The AaERF1 promoter had been cloned and GUS staining results of AaERF1 promoter-GUS transgenic A. annua showed that AaERF1 is expressed ubiquitiously in all organs. Several putative cis-acting elements such as W-box, TGA-box and Py-rich element, which are involved in defense responsiveness, are present in the promoter. The expression of AaERF1 can be induced vigorously by methyl jasmonate as well as by ethephon and wounding, implying that AaERF1 may activate some of the defense genes via the jasmonic acid and ethylene signaling pathways of A. annua. The results of electrophoretic mobility shift assay (EMSA and yeast one-hybrid experiments showed that AaERF1 was able to bind to the GCC box cis-acting element in vitro and in yeast. Ectopic expression of AaERF1 could enhance the expression levels of the defense marker genes PLANT DEFENSIN1.2 (PDF1.2 and BASIC CHITINASE (ChiB, and increase the resistance to Botrytis cinerea in the 35S::AaERF1 transgenic Arabidopsis. The down-regulated expression level of AaERF1 evidently reduced the resistance to B. cinerea in A. annua. The overall results showed that AaERF1 positively regulated the resistance to B. cinerea in A. annua.
-
AA amyloidosis complicating the hereditary periodic fever syndromes.
Lane, Thirusha; Loeffler, Jutta M; Rowczenio, Dorota M; Gilbertson, Janet A; Bybee, Alison; Russell, Tonia L; Gillmore, Julian D; Wechalekar, Ashutosh D; Hawkins, Philip N; Lachmann, Helen J
2013-04-01
AA amyloidosis is a life-threatening complication of the hereditary periodic fever syndromes (HPFS), which are otherwise often compatible with normal life expectancy. This study was undertaken to determine the characteristics, presentation, natural history, and response to treatment in 46 patients who had been referred for evaluation at the UK National Amyloidosis Centre. Disease activity was monitored by serial measurement of serum amyloid A. Renal function was assessed by measurement of serum creatinine and albumin levels, the estimated glomerular filtration rate, and proteinuria from 24-hour urine collections. The amyloid load was measured by serum amyloid P scintigraphy. Twenty-four patients had familial Mediterranean fever, 12 patients had tumor necrosis factor receptor-associated periodic syndrome, 6 patients had cryopyrin-associated periodic syndromes, and 4 patients had mevalonate kinase deficiency. The median age at onset of HPFS was 5 years; median age at presentation with AA amyloidosis was 38 years. Diagnosis of an HPFS had not been considered prior to presentation with AA amyloidosis in 23 patients (50%). Eleven patients (24%) had end-stage renal failure (ESRF) at presentation; of these, 3 had received transplants prior to referral. A further 13 patients developed ESRF over the followup period, with 10 undergoing renal transplantation. The median time to progression to ESRF from onset of AA amyloidosis was 3.3 years (interquartile range [IQR] 2-8), with a median time to transplant of 4 years (IQR 3-6). Eleven patients (24%) died. The median survival in the entire cohort was 19 years from diagnosis of AA amyloidosis. Of the 37 patients who were treated successfully, or in whom at least partial suppression of the underlying HPFS was achieved, 17 (46%) showed amyloid regression, 14 (38%) showed a stable amyloid load, and 2 (5%) showed increased amyloid deposition over the followup period. AA amyloidosis remains a challenging and serious late complication
-
Failure analysis of fusion clad alloy system AA3003/AA6xxx sheet under bending
Energy Technology Data Exchange (ETDEWEB)
Shi, Y., E-mail: shiyh@mcmaster.ca [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Jin, H. [Novelis Global Technology Center, P.O. Box 8400, Kingston, Ontario, Canada K7L 5L9 (Canada); Wu, P.D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Lloyd, D.J. [Aluminum Materials Consultants, 106 Nicholsons Point Road, Bath, Ontario, Canada K0H 1G0 (Canada); Embury, D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada)
2014-07-29
An ingot of AA6xxx Al–Si–Mg–Cu alloy clad with AA3003 Al–Mn alloy was co-cast by Fusion technology. Bending tests and numerical modeling were performed to investigate the potential for sub-surface cracking for this laminate system. To simulate particle-induced crack initiation and growth, both random and stringer particles have been selected to mimic the particle distribution in the tested samples. The morphology of cracking in the model was similar to that observed in clad sheet tested in the Cantilever bend test. The crack initiated in the core close to the clad-core interface where the strain in the core is highest, between particles or near particles and propagates along local shear bands in the core, while the clad layer experiences extreme thinning before failure.
-
An Analysis of the Rise and Fall of the AA-MAS Policy
Lazarus, Sheryl S.; Thurlow, Martha L.; Ysseldyke, James E.; Edwards, Lynn M.
2015-01-01
In 2005, to address concerns about students who might fall in the "gap" between the regular assessment and the alternate assessment based on alternate achievement standards (AA-AAS), the U.S. Department of Education announced that states could develop alternate assessments based on modified achievement standards (AA-MAS). This article…
-
International Nuclear Information System (INIS)
Shojaeefard, Mohammad Hasan; Behnagh, Reza Abdi; Akbari, Mostafa; Givi, Mohammad Kazem Besharati; Farhani, Foad
2013-01-01
Highlights: ► Defect-free friction stir welds have been produced for AA5083-O/AA7075-O. ► Back-propagation was sufficient for predicting hardness and tensile strength. ► A hybrid multi-objective algorithm is proposed to deal with this MOP. ► Multi-objective particle swarm optimization was used to find the Pareto solutions. ► TOPSIS is used to rank the given alternatives of the Pareto solutions. -- Abstract: Friction Stir Welding (FSW) has been successfully used to weld similar and dissimilar cast and wrought aluminium alloys, especially for aircraft aluminium alloys, that generally present with low weldability by the traditional fusion welding process. This paper focuses on the microstructural and mechanical properties of the Friction Stir Welding (FSW) of AA7075-O to AA5083-O aluminium alloys. Weld microstructures, hardness and tensile properties were evaluated in as-welded condition. Tensile tests indicated that mechanical properties of the joint were better than in the base metals. An Artificial Neural Network (ANN) model was developed to simulate the correlation between the Friction Stir Welding parameters and mechanical properties. Performance of the ANN model was excellent and the model was employed to predict the ultimate tensile strength and hardness of butt joint of AA7075–AA5083 as functions of weld and rotational speeds. The multi-objective particle swarm optimization was used to obtain the Pareto-optimal set. Finally, the Technique for Order Preference by Similarity to the Ideal Solution (TOPSIS) was applied to determine the best compromised solution.
-
INAA and flame AAS of various vegetable reference materials
International Nuclear Information System (INIS)
Djingova, R.; Arpadjan, S.; Kuleff, I.
1991-01-01
INAA and flame AAS have been used for the analysis of a large number of vegetable reference materials. Out of all determined elements (28 by INAA and 11 by AAS) nine are common for both methods (Ca, Cd, Co, Cu, Fe, Mg, Mn, Na, Zn) and for these the possibilities of the two methods have been compared. (orig.)
-
PDGF-AA-induced filamentous mitochondria benefit dermal papilla cells in cellular migration.
Mifude, C; Kaseda, K
2015-06-01
Human dermal papilla cells (HDPCs) play essential roles in hair follicular morphogenesis and postnatal hair growth cycles. Previous reports demonstrated that platelet-derived growth factor-AA (PDGF-AA) enhanced the formation of dermal condensates in hair follicular development. Additionally, PDGF-AA induces/maintains the anagen phase of the hair cycle. It is likely that mitochondrial morphology and functions are tightly coupled with maintenance of these energy-demanding activities. However, little is known about the mitochondrial regulation in HDPCs. Thus, we investigated the PDGF-involved mitochondrial regulation in HDPCs. The mitochondrial morphologies of HDPCs were examined in the presence or absence of PDGF-AA under a fluorescent microscope. ATP production and cellular motility were investigated. The relationship between mitochondrial morphology and the cellular functions was discussed. We observed that primary HDPCs contained mitochondria with filamentous and/or rounded morphologies. Both types of mitochondria showed similar membrane potentials. Interestingly, in the presence of PDGF-AA, but not PDGF-BB, the balance between the two morphologies shifted towards the filamentous form. Concomitantly, both mitochondrial enzymatic activity and total cellular ATP level were augmented by PDGF-AA. These two parameters were closely correlated, suggesting the mitochondrial involvement in the PDGF-augmented ATP production. Moreover, PDGF-AA accelerated the migration of HDPCs in a gap-filling assay, but did not change the rate of cellular proliferation. Notably, filamentous mitochondria dominated migrating HDPCs. PDGF-AA benefits HDPCs in the process of migration, by increasing the number of filamentous mitochondria. © 2014 Society of Cosmetic Scientists and the Société Française de Cosmétologie.
-
Tamura, Hiroaki; Hasegawa, Kiminori
2009-02-01
AA amyloidosis is a life threatening clinical complication of chronic inflammatory diseases such as rheumatoid arthritis. It has been demonstrated biochemically that amyloidosis resulted from abnormal folding of proteins, which are deposited as insoluble fibrils in extracellular tissue, leading to the disruption of their normal function. In this regard, amyloidosis has been recognized as a conformation disorder. Interestingly, genetic polymorphisms of amyloid precursor protein (SAA) have been reported to associate with increased risk for AA amyloidosis. Also recent biochemical research revealed that SAA is synthesized under the influence of the proinflammatory cytokines, such as IL-6, TNF-alpha, IL-1. Additionally, it was suggested that amyloid deposits in extracellular tissue could reflect to the serum level of SAA in the reversible fashion, leading to the hypothesis that the control of the SAA synthesis could be beneficial to the treatment of amyloidosis. In this context, anti-cytokine therapies may be most effective. Especially the inhibition of IL-6 is critical to suppression of SAA production, so treatment with a humanized monoclonal antibody against human IL-6 receptor may not only ameliorate RA disease activity but also pave the way for the treatment of AA amyloidosis.
-
Yield and flow properties of aluminum alloy AA 8001
International Nuclear Information System (INIS)
Lyons, J.S.; Johnson, H.W.; Han, E.G.
1995-01-01
Aluminum alloy AA 8001 is being used at the Westinghouse Savannah River Company (WSRC) for nuclear reactor fuel and target components. The objective of this research was to determine parameters for predictive models of the compressive flow properties of AA 8001. Seventy-five true strain-rate, hot compression tests were performed. New, quantitative information about the yield and flow behavior of aluminum alloy AA 8001 was determined. Parameters were determined to use in a hyperbolic sine constitutive law so that the yield stress, the peak stress, and the peak strain can be predicted from the temperature-compensated strain-rate, Z. It was found that the onset of strain softening was more strongly dependent on Z than the onset of yielding was
-
Absorption spectra of AA-stacked graphite
International Nuclear Information System (INIS)
Chiu, C W; Lee, S H; Chen, S C; Lin, M F; Shyu, F L
2010-01-01
AA-stacked graphite shows strong anisotropy in geometric structures and velocity matrix elements. However, the absorption spectra are isotropic for the polarization vector on the graphene plane. The spectra exhibit one prominent plateau at middle energy and one shoulder structure at lower energy. These structures directly reflect the unique geometric and band structures and provide sufficient information for experimental fitting of the intralayer and interlayer atomic interactions. On the other hand, monolayer graphene shows a sharp absorption peak but no shoulder structure; AA-stacked bilayer graphene has two absorption peaks at middle energy and abruptly vanishes at lower energy. Furthermore, the isotropic features are expected to exist in other graphene-related systems. The calculated results and the predicted atomic interactions could be verified by optical measurements.
-
Association between AA-NAT gene polymorphism and reproductive performance in sheep
Ding-ping,Bai; Cheng-jiang,Yu; Yu-lin,Chen
2012-01-01
Arylalkylamine N-acetyltransferase (AA-NAT) is critical enzyme in Melatonin (MLT) biosynthesis for MLT regulating the animal seasonal breeding. In this study, DNA sequencing methods were applied to detect the polymorphisms of the AA-NAT gene in 179 Chinese sheep belonging to two non-seasonal reproduction breeds and two seasonal reproduction breeds. One mutation at exon 3 (NM_001009461:c.486A > G) was firstly described at the sheep AA-NAT locus. Hence, we described the SmaI PCR-RFLP m...
-
Systemic AA amyloidosis in the red fox (Vulpes vulpes).
Rising, Anna; Cederlund, Ella; Palmberg, Carina; Uhlhorn, Henrik; Gaunitz, Stefan; Nordling, Kerstin; Ågren, Erik; Ihse, Elisabet; Westermark, Gunilla T; Tjernberg, Lars; Jörnvall, Hans; Johansson, Jan; Westermark, Per
2017-11-01
Amyloid A (AA) amyloidosis occurs spontaneously in many mammals and birds, but the prevalence varies considerably among different species, and even among subgroups of the same species. The Blue fox and the Gray fox seem to be resistant to the development of AA amyloidosis, while Island foxes have a high prevalence of the disease. Herein, we report on the identification of AA amyloidosis in the Red fox (Vulpes vulpes). Edman degradation and tandem MS analysis of proteolyzed amyloid protein revealed that the amyloid partly was composed of full-length SAA. Its amino acid sequence was determined and found to consist of 111 amino acid residues. Based on inter-species sequence comparisons we found four residue exchanges (Ser31, Lys63, Leu71, Lys72) between the Red and Blue fox SAAs. Lys63 seems unique to the Red fox SAA. We found no obvious explanation to how these exchanges might correlate with the reported differences in SAA amyloidogenicity. Furthermore, in contrast to fibrils from many other mammalian species, the isolated amyloid fibrils from Red fox did not seed AA amyloidosis in a mouse model. © 2017 The Protein Society.
-
Chang'aa Drinking in Kibera Slum: The Harmful Effects of ...
African Journals Online (AJOL)
Chang'aa Drinking in Kibera Slum: The Harmful Effects of Contemporary Changes in the Production and Consumption of Traditional Spirits. ... African Journal of Drug and Alcohol Studies ... This article examines the harmful effects of drinking chang'aa, an illegal spirit produced locally, in Kibera slum in Nairobi, Kenya.
-
Changes in depression mediate the effects of AA attendance on alcohol use outcomes.
Wilcox, Claire E; Tonigan, J Scott
2018-01-01
Depression may contribute to increased drinking in individuals with alcohol use disorder. Although Alcoholics Anonymous (AA) attendance predicts drinking reductions, there is conflicting information regarding the intermediary role played by reductions in depression. We explored whether AA attendance reduces depressive symptoms, the degree to which improvement in depression results in reductions in drinking, and in which subgroups these effects occur. 253 early AA affiliates (63% male) were recruited and assessed at baseline 3, 6, 9, 12, 18, and 24 months. Depression was measured using the Beck Depression Inventory (BDI) and was administered at baseline 3, 6, 12, 18, and 24 months. AA attendance and alcohol use outcomes were obtained with the Form 90. Mediation analyses were performed at early (3, 6, and 9 months) and late (12, 18, and 24 months) follow-up to investigate the degree to which reductions in depression mediated the effect of AA attendance on drinking, controlling for concurrent drinking. In addition, a series of moderated mediation analyses were performed using baseline depression severity as a moderator. At early follow-up, reductions in depression (6 months) mediated the effects of AA attendance (3 months) on later drinking (drinks per drinking day) (9 months) (b = -0.02, boot CI [-0.055, -0.0004]), controlling for drinking at 6 months. Baseline depression severity did not moderate the degree to which BDI mediated the effects of AA attendance on alcohol use (ps > .05). These findings provide further evidence that depression reduction is a mechanism by which AA attendance leads to reductions in alcohol use. Improving depression may help reduce alcohol use in individuals with AUD, and AA attendance may be an effective way to achieve that goal.
-
Preparation and Characteristics of Corn Straw-Co-AMPS-Co-AA Superabsorbent Hydrogel
Directory of Open Access Journals (Sweden)
Wei-Min Cheng
2015-11-01
Full Text Available In this study, the corn straw after removing the lignin was grafted with 2-acrylamido-2-methylpropanesulfonic acid (AMPS to prepare sulfonated cellulose. The grafting copolymerization between the sulfonated cellulose and acrylic acid (AA was performed using potassium persulfate and N,N′-methylenebisacrylamide as the initiator and crosslinking agent, respectively, to prepare corn straw-co-AMPS-co-AA hydrogels. The structure and properties of the resulting hydrogels were characterized by Fourier transform infrared spectroscopy, X-ray diffraction, scanning electron microscopy, thermogravimetric analysis, and dynamic rheometry. The effects of initiator, crosslinker, monomer neutralization degree, and temperature on the swelling ratio of the hydrogels were studied. The water retention, salt resistance, and recyclability of the corn straw-co-AMPS-co-AA hydrogels were also investigated. The optimum water absorptivity of the corn straw hydrogels was obtained at a polymerization temperature of 50 °C with 1.2% crosslinker, 1:7 ratio of the pretreated corn straw and AA, 2% initiator, and 50% neutralized AA.
-
Directory of Open Access Journals (Sweden)
Hülya KAÇAR DURMUŞ
2003-01-01
Full Text Available Mechanical properties of some aluminum alloys can be changed with precipitation hardening. This intermetallic precipitates are incoherent with the main structure and increased mechanical properties. Cooling rates after solid solution process effects properties after precipitation. In applications, however this is not taken into consideration. In this study, AA 2014 and AA 2024 Aluminium Alloy specimens were hold for one hour at 495±3 0C and formed a solid solution. Specimens were quenched at this temperature with different cooling rtes . later artificial aging was applied at 150 0C and 180 0C. The hardness and microstructure variations of the specimens were investigated depending on the cooling rates and artificial aging temperatures.
-
CERN PhotoLab
1980-01-01
The very particular lattice of the AA required 2 types of dipole (bending magnets; BLG, long and narrow; BST, short and wide). The BLG had a steel length of 4.70 m, a good field width of 0.24 m, and a weight of about 70 t. Jean-Claude Brunet inspects the lower half of a BLG. For the BST magnets see 7811105 and 8006036.
-
Identifying a typology of men who use anabolic androgenic steroids (AAS).
Zahnow, Renee; McVeigh, Jim; Bates, Geoff; Hope, Vivian; Kean, Joseph; Campbell, John; Smith, Josie
2018-05-01
Despite recognition that the Anabolic Androgenic Steroid (AAS) using population is diverse, empirical studies to develop theories to conceptualise this variance in use have been limited. In this study, using cluster analysis and multinomial logistic regression, we identify typologies of people who use AAS and examine variations in motivations for AAS use across types in a sample of 611 men who use AAS. The cluster analysis identified four groups in the data with different risk profiles. These groups largely reflect the ideal types of people who use AAS proposed by Christiansen et al. (2016): Cluster 1 (You Only Live Once (YOLO) type, n = 68, 11.1%) were younger and motivated by fat loss; Cluster 2 (Well-being type, n = 236, 38.6%) were concerned with getting fit; Cluster 3 (Athlete type, n = 155, 25.4%) were motivated by muscle and strength gains; Cluster 4 (Expert type, n = 152, 24.9%) were focused on specific goals (i.e. not 'getting fit'). The results of this study demonstrate the need to make information about AAS accessible to the general population and to inform health service providers about variations in motivations and associated risk behaviours. Attention should also be given to ensuring existing harm minimisation services are equipped to disseminate information about safe intra-muscular injecting and ensuring needle disposal sites are accessible to the different types. Copyright © 2018 Elsevier B.V. All rights reserved.
-
Razzaq, A. M.; Majid, D. L. Abang Abdul; Ishak, M. R.; Uday, M. B.
2017-12-01
Aluminium-fly ash (FA) particulate reinforced composites (AA6063-FA) have been used in automotive and aerospace industries because of their low density and good mechanical properties. Three different weight fraction of FA: 2%, 4% and 6% are added to AA6063 alloy using compocasting method. The effect of FA particulates on microstructure, density and compression strength of AA6063- FA composites are investigated. Field Emission Scanning Electron Microscope (FESEM) micrographs reveal that the FA particulates are uniformly distributed in AA6063 alloy. The results also show that density, compression strength and microstructure of the AA6063-FA composites are significantly influenced by the FA amount. The increase in the weight fraction of FA will improve the microstructure and enhance the compression strength. The density of AA6063-FA composites decreases as the incorporation of FA increases.
-
Feiing og salting i Strømsås-tunnelen mars 2004: innledende analyse
Aldrin, Magne
2004-01-01
I mars 2004 blei det gjennomført forsøk med vasking og salting i Strømsåstunnelen, med sikte på å redusere konsentrasjonen av svevestøv. Samtidig blei det gjort målinger av PM10, meteorologi og trafikkvolum.
-
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto
-
Efficacy of etanercept in patients with AA amyloidosis secondary to rheumatoid arthritis.
Nakamura, T; Higashi, S; Tomoda, K; Tsukano, M; Baba, S
2007-01-01
The efficacy of biological therapies in rheumatoid arthritis (RA) is well known, but their hypothetical benefit in amyloid A (AA) amyloidosis secondary to RA still remains to be considered. We evaluated the efficacy and safety of etanercept in serum amyloid A (SAA) 1.3 allele Japanese patients with AA amyloidosis secondary to RA. Seven RA patients with histologically confirmed AA amyloidosis and renal involvement who were treated with etanercept were enrolled. They all had the SAA1.3 allele, which has been shown to be a risk factor not only for the association of AA amyloidosis but also for a poor prognosis in Japanese RA patients. Efficacy was assessed as a sustained decrease in RA inflammation and an amelioration of renal function. RA inflammation and AA amyloidosis were improved and stabilized after 43.4 +/- 16.5 weeks. At week 20 the number of tender (p = 0.017) and swollen (p = 0.017) joints, and levels of serum C-reactive protein (p = 0.018) and albumin (p = 0.045) had improved. The values for SAA, serum creatinine, calculated creatinine clearance, and proteinuria also ameliorated. No severe adverse events were observed. One patient eventually had to go on hemodialysis but her tolerance of etanercept remained stable. Etanercept can be used safely and effectively in AA amyloidosis secondary to RA with renal involvement, and is of clinical benefit in the short-term, even in patients on hemodialysis. It appears that SAA1.3 allele may be used as a clinical parameter for the introduction of etanercept in Japanese RA with AA amyloidosis.
-
Overview of the Antiproton Accumulator (AA)
1982-01-01
See photo 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
-
A Status Report on the AAS Astronomy Ambassadors Program
Fienberg, Richard Tresch; Fraknoi, Andrew; Gurton, Suzanne; Hurst, Anna; Schatz, Dennis L.
2014-06-01
The American Astronomical Society, in partnership with the Astronomical Society of the Pacific (ASP), has launched a series of professional-development workshops and a community of practice designed to improve early-career astronomers’ ability to communicate effectively with students and the public. Called AAS Astronomy Ambassadors, the program provides training and mentoring for young astronomers, from advanced undergraduates to beginning faculty; it also provides them access to resources and a network of contacts within the astronomy education and public outreach (EPO) community. Ambassadors are provided with a library of outreach activities and resource materials suitable for a range of venues and audiences. For much of this library we are using resources developed by organizations such as the ASP, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. After a period of evaluation and revision, the program’s “Menu of Outreach Opportunities for Science Education” (MOOSE) is now posted on the AAS website at http://aas.org/outreach/moose-menu-outreach-opportunities-science-education.The first two Astronomy Ambassadors workshops were held at AAS meetings in January 2013 and January 2014; each served 30 young astronomers chosen from about twice that many applicants. Web-based follow-up activities are being provided through a website at the ASP designed to keep cohorts of educators trained in their programs in touch with one another. The AAS is exploring ways to fund additional workshops at future winter meetings; suggestions are most welcome. Meanwhile, the Astronomy Ambassadors trained to date have logged more than 150 outreach events, reaching many thousands of children and adults across the U.S. and Canada.
-
The Effect of Applied Tensile Stress on Localized Corrosion in Sensitized AA5083
2015-09-01
corrosion, but if exposed to elevated temperature for prolonged periods of time the alloy becomes sensitized. Since the β phase is more anodic than the...degree of localized corrosion for sensitized AA5083 under an applied tensile stress. AA5083 is an aluminum -magnesium alloy that experiences severe...direction. 14. SUBJECT TERMS Aluminum alloy , AA5083, IGSCC, intergranular stress corrosion cracking, localized corrosion, sensitized aluminum 15
-
Dong, Dong; Mao, Yu; Huang, Cui; Jiao, Qian; Pan, Hui; Ma, Lei; Wang, Rui
2017-01-01
Rhizoma Anemarrhena , a widely used traditional Chinese medicine, has previously been shown to have neuroprotective effect. Sarsasapogenin-AA13 (AA13) is a novel synthetic derivative of Sarsasapogenin, which is extracted from Rhizoma Anemarrhena . The aim of this study is to investigate the nootropic and neurotrophic effects of AA13 and underlying mechanisms. In vitro , cell viability of rat primary astrocytes treated with AA13 and neurons cultured with conditioned medium of AA13-treated rat primary astrocytes was tested by MTT assays. In vivo , a pharmacological model of cognitive impairment induced by scopolamine was employed and spatial memory of the mice was assessed by Morris water maze. This study found that AA13 increased cell viability of primary astrocytes and AA13-treated astrocyte-conditioned medium enhanced the survival rate of primary neurons. Interestingly, AA13 markedly enhanced the level of BDNF in astrocytes. Furthermore, AA13 (6 mg/kg) improved the cognitive deficits in animal models (p<0.05) and BDNF and PSD95 levels were increased in brain. Therefore, we hypothesize that AA13 exerts nootropic and neurotrophic activities through astrocytes mediated upregulation of BDNF secretion. The results suggest that AA13 could be a potential compound for cognitive impairment after further research.
-
Vorona, Elena; Nieschlag, Eberhard
2018-02-19
Despite the fact that sports organizations and legislators have introduced various mechanisms to discourage athletes from using performance and appearance enhancing substances a high percentage of athletes admits to their unabated application. In competitive athletics, bodybuilding and in recreational sports anabolic androgenic steroids (AAS) continue to be the substances most abused. This review summarizes the side effects of AAS abuse on organs and system functions in both sexes. High doses of AAS cause a significant increase of erythrocytes und haemoglobin concentration, which may lead to thromboembolism, intracardiac thrombosis and stroke. Long-term AAS abusers have a higher incidence of arrhythmias, atherosclerosis, concentric left-ventricular myocardial hypertrophy with impaired diastolic function and also sudden cardiac death. Changes of liver function and structure, up to hepatocellular carcinoma, have been described, mainly in cases of chronic misuse of 17α-alkylated AAS. Sleeplessness, increased irritability, depressive mood status are often observed in AAS abuse. In former AAS abusers depression, anxiety and melancholy may persist for many years. Due to negative feedback in the regulation of the hypothalamic-pituitary-gonadal axis AAS can cause reversible suppression of spermatogenesis up to azoospermia. In women the changes most often caused by AAS abuse are hirsutism, irreversible deepening of voice, dysmenorrhoea, secondary amenorrhoea with anovulation and infertility. AAS abuse notwithstanding, under clinical conditions testosterone remains the most important hormone for substitution therapy of male hypogonadism.
-
76 FR 6794 - 30-Day Submission Period for Requests for ONC-Approved Accreditor (ONC-AA) Status
2011-02-08
... Accreditor (ONC-AA) Status AGENCY: Office of the National Coordinator for Health Information Technology... submission of requests for ONC-Approved Accreditor (ONC-AA) status. Authority: 42 U.S.C. 300jj-11. DATES: The... for ONC-AA status may be submitted. The 30-day period for submission of requests for ONC-AA status...
-
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our
-
Effects of chronic ethanol ingestion on arachidonic acid (AA) metabolism in rat macrophages
International Nuclear Information System (INIS)
Chanmugam, P.; Boudreau, M.; Hymel, G.; Jeffers, G.; Hwang, D.H.
1986-01-01
In a previous report, preincubation of rat platelets with ethanol resulted in dose dependent inhibition of AA metabolites whereas chronic ingestion of ethanol enhanced the synthesis of AA metabolites. Thus, the authors studied whether chronic ethanol ingestion also affects AA metabolism in MACS. Two groups of rats (10 each) were fed DeCarli/Lieber liquid diet containing 36 caloric % ethanol for 3 weeks. The control group was pair fed the same diet made isocaloric with dextrin-maltose. Resident MACS were collected by peritoneal lavage. The monolayers of MACS were incubated for 20 min with calcium ionophore (5μg/ml), and the incubation stopped with 4 vol. of ethanol. PGE 2 , LTB 4 and 5-HETE were assayed by radioimmunoassay. The results indicated that chronic ethanol ingestion did not affect the capacity of MACS to synthesize AA metabolites. There was also no difference in the levels of AA metabolites in heart and lung homogenates between the two groups
-
Coarsening of AA6013-T6 Precipitates During Sheet Warm Forming Applications
Di Ciano, M.; DiCecco, S.; Esmaeili, S.; Wells, M. A.; Worswick, M. J.
2018-03-01
The use of warm forming for AA6xxx-T6 sheet is of interest to improve its formability; however, the effect warm forming may have on the coarsening of precipitates and the mechanical strength of these sheets has not been well studied. In this research, the coarsening behavior of AA6013-T6 precipitates has been explored, in the temperature range of 200-300 °C, and time of 30 s up to 50 h. Additionally, the effect of warm deformation on coarsening behavior was explored using: (1) simulated warm forming tests in a Gleeble thermo-mechanical simulator and (2) bi-axial warm deformation tests. Using a strong obstacle model to describe the yield strength (YS) evolution of the AA6013-T6 material, and a Lifshitz, Slyozov, and Wagner (LSW) particle coarsening law to describe the change in precipitate size with time, the coarsening kinetics were modeled for this alloy. The coarsening kinetics in the range of 220-300 °C followed a trend similar to that previously found for AA6111 for the 180-220 °C range. There was strong evidence that coarsening kinetics were not altered due to warm deformation above 220 °C. For warm forming between 200 and 220 °C, the YS of the AA6013-T6 material increased slightly, which could be attributed to strain hardening during warm deformation. Finally, a non-isothermal coarsening model was used to assess the potential reduction in the YS of AA6013-T6 for practical processing conditions related to auto-body manufacturing. The model calculations showed that 90% of the original AA6013-T6 YS could be maintained, for warm forming temperatures up to 280 °C, if the heating schedule used to get the part to the warm forming temperature was limited to 1 min.
-
Long-term biases in geomagnetic K and aa indices
Love, J.J.
2011-01-01
Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0-2009.0, solar cycles 11-23. The K data show persistent biases, especially for high (low) K-activity levels at British (Australian) observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4. ?? 2011 Author(s).
-
Long-term biases in geomagnetic K and aa indices
Directory of Open Access Journals (Sweden)
J. J. Love
2011-08-01
Full Text Available Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0–2009.0, solar cycles 11–23. The K data show persistent biases, especially for high (low K-activity levels at British (Australian observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4.
-
Cella, D; Traina, S; Li, T; Johnson, K; Ho, K F; Molina, A; Shore, N D
2018-02-01
Patient-reported outcomes (PROs) are used to assess benefit-risk in drug development. The relationship between PROs and clinical outcomes is not well understood. We aim to elucidate the relationships between changes in PRO measures and clinical outcomes in metastatic castration-resistant prostate cancer (mCRPC). We investigated relationships between changes in self-reported fatigue, pain, functional well-being (FWB), physical well-being (PWB) and prostate cancer-specific symptoms with overall survival (OS) and radiographic progression-free survival (rPFS) after 6 and 12 months of treatment in COU-AA-301 (N = 1195) or COU-AA-302 (N = 1088). Eligible COU-AA-301 patients had progressed after docetaxel and had Eastern Cooperative Oncology Group performance status (ECOG PS) ≤ 2. Eligible COU-AA-302 patients had no prior chemotherapy and ECOG PS 0 or 1. Patients were treated with abiraterone acetate (1000 mg/day) plus prednisone (10 mg/day) or prednisone alone daily. Association between self-reported fatigue, pain and functional status, and OS and/or rPFS, using pooled data regardless of treatment, was assessed. Cox proportional hazard regression modeled time to death or radiographic progression. In COU-AA-301 patients, PRO improvements were associated with longer OS and longer time to radiographic progression versus worsening or stable PROs (P AA-302 patients, worsening PROs were associated with higher likelihood of radiographic progression (P ≤ 0.025) compared with improved or stable PROs. In multivariate models, worsening PWB remained associated with worse rPFS. The 12-month analysis confirmed the 6-month results. PROs are significantly associated with clinically relevant time-to-event efficacy outcomes in clinical trials and may complement and help predict traditional clinical practice methods for monitoring patients for disease progression. © The Author 2017. Published by Oxford University Press on behalf of the European Society for
-
Srinivas, B.; Cheepu, Muralimohan; Sivaprasad, K.; Muthupandi, V.
2018-03-01
The present study focuses on a sheet thickness of 4 mm using different laser power and welding rate by the laser beam welding (LBW) at a beam size180 μm. The observations on the weldments are showing that thermal conductivity of the materials plays a major role on microstructural changes. The as-welded mechanical properties were studied by correlation with its microstructures. Due to the steeper temperature gradient during the laser beam welding AA6061 was showing the greater variation compares with AA5083 side in the micro hardness studies.Also, the tensile strength of 241 MPa has been reported as highest with the welds made of laser powerat 3.5 kW and welding rate at 3.5 mmin-1.
-
Raadioteatril elu sees. Elu sees? / Mart Aas, Tõnis Leemets ; interv. Kutt Kommel
Aas, Mart
2007-01-01
Eesti Raadio raadioteatri 78. sünnipäeval esietendus Vikerraadios dokumentaalkuuldemäng "Elu sees" Aleksander Alleni (hilisema nimega Aleksander Aas) mälestuste põhjal. Theatrumi lavastuse on raadiole seadnud Mart Aas, Marius Peterson, Toomas Lõhmuste ja Tõnis Leemets
-
AAS Publishing News: Astronomical Software Citation Workshop
Kohler, Susanna
2015-07-01
Do you write code for your research? Use astronomical software? Do you wish there were a better way of citing, sharing, archiving, or discovering software for astronomy research? You're not alone! In April 2015, AAS's publishing team joined other leaders in the astronomical software community in a meeting funded by the Sloan Foundation, with the purpose of discussing these issues and potential solutions. In attendance were representatives from academic astronomy, publishing, libraries, for-profit software sharing platforms, telescope facilities, and grantmaking institutions. The goal of the group was to establish “protocols, policies, and platforms for astronomical software citation, sharing, and archiving,” in the hopes of encouraging a set of normalized standards across the field. The AAS is now collaborating with leaders at GitHub to write grant proposals for a project to develop strategies for software discoverability and citation, in astronomy and beyond. If this topic interests you, you can find more details in this document released by the group after the meeting: http://astronomy-software-index.github.io/2015-workshop/ The group hopes to move this project forward with input and support from the broader community. Please share the above document, discuss it on social media using the hashtag #astroware (so that your conversations can be found!), or send private comments to julie.steffen@aas.org.
-
1980-01-01
See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
-
The use of CR1aa for ovine in vitro embryo production
Directory of Open Access Journals (Sweden)
Yulnawati
2006-06-01
Full Text Available The aim of this study was to investigate the capacity of CR1aa as a simple medium for maturation, fertilization and culture of ovine embryo in vitro. Oocytes were collected by slicing method in Phosphate Buffer Saline (PBS supplemented with 5% Fetal Bovine Serum (FBS and 100 IU/ml penicillin streptomycin. Oocytes were matured in Tissue Culture Medium (TCM-199 as control or CR1aa as treatment medium. Both maturation medium were supplemented with 10% Fetal Bovine Serum (FBS, 10 IU/ml Follicle Stimulating Hormone (FSH, 10 IU/ml Luteinizing Hormone (LH, 1 μg/ml Estradiol and 100 IU/ml penicillin-streptomycin. Oocytes were incubated in 5% CO2 incubator, 38˚C for 24 h. Matured oocytes were fertilized in BO or CR1aa medium, supplemented with 2.5 mM caffeine benzoate and 20 mg /ml heparin. After 18 h in vitro fertilization, oocytes were cultured in TCM-199 or CR1aa medium, both supplemented with 5% FBS, 5 mg/ml insulin and 100 IU/ml penicillin streptomycin. Results showed that the highest maturation rate was found in TCM-199 medium (73.27% and significantly different (P0.05 between cleavage rate of ovine embryos in TCM-199 and CR1aa medium (39.45% vs 50.94%. In conclusion, optimum result on ovine in vitro embryo production can be achieved from a combination of TCM-199 as maturation medium and CR1aa as fertilization and culture medium.
-
NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-07-0067 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-12-0016 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0074 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TBEL-01-1883 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-1734 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-TNIG-10-0006 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-10-0006 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-1522 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FCAT-01-1020 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-GACU-18-0022 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-18-0022 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1332 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-14-0023 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
-
Lu AA21004, a novel multimodal antidepressantwith activity exerted through serotonergic targets
DEFF Research Database (Denmark)
Mork, A.; Pehrson, A.; Montezinho, L. C. P.
2012-01-01
Background: Lu AA21004 is a multimodal antidepressant that functions as a 5-HT3 and 5-HT7 receptor antagonist, 5-HT1B receptor partial agonist, 5-HT1A receptor agonist and inhibitor of the 5-HT transporter in vitro. Here we investigated preclinical effects of Lu AA21004 1) on target occupancies, 2...... (5-HT), noradrenaline (NA), dopamine (DA), acetylcholine (ACh), histamine (Hist)] were measured by microdialysis. Antidepressant potential was assessed in the forced swim test using Flinders Sensitive Line (FSL) rats. Moreover, effects of Lu AA21004 on acquisition, consolidation and recall...
-
AA, vacuum tank for stochastic precooling
CERN PhotoLab
1979-01-01
The vaccum tank in which the fast stochastic precooling kicker was installed. It is clad with heating jackets for bake-out to 200 deg C, indispensable for reaching the operational vacuum of 7E-11 Torr. Alain Poncet, responsible for AA vacuum, is looking on. See also 7910268, 8002234.
-
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new
-
Vip3Aa induces apoptosis in cultured Spodoptera frugiperda (Sf9) cells.
Jiang, Kun; Mei, Si-Qi; Wang, Ting-Ting; Pan, Jin-Hua; Chen, Yue-Hua; Cai, Jun
2016-09-15
The vegetative insecticidal proteins (Vip) secreted by many Bacillus thuringiensis strains during their vegetative growth stage are regarded as second generation insecticidal proteins, as they share no sequence or structural homology with known crystal insecticidal proteins (Cry) and have a broad insecticidal spectrum. Compared with insecticidal crystal proteins (ICPs), the insecticidal mechanisms of Vips have been little studied. Here we investigated the mechanism responsible for Vip3Aa toxicity in cultured insect cells. Using, flow cytometry analyzes, TUNEL staining and DNA fragmentation assays, we show that Vip3Aa can induce apoptosis in Spodoptera frugiperda (Sf9) cells and cause cells to arrest at the G2/M phase. We also show that Vip3Aa can disrupt mitochondrial membrane potential (ΔΨm), leading to the activation of Sf-caspase-1, suggesting that a mitochondrial mediated and caspase dependent pathway may be involved in Vip3Aa-induced apoptosis in Sf9 cells. Copyright © 2016 Elsevier Ltd. All rights reserved.
-
Rectification induced in N2AA-doped armchair graphene nanoribbon device
International Nuclear Information System (INIS)
Chen, Tong; Wang, Ling-Ling; Luo, Kai-Wu; Xu, Liang; Li, Xiao-Fei
2014-01-01
By using non-equilibrium Green function formalism in combination with density functional theory, we investigated the electronic transport properties of armchair graphene nanoribbon devices in which one lead is undoped and the other is N 2 AA -doped with two quasi-adjacent substitutional nitrogen atoms incorporating pairs of neighboring carbon atoms in the same sublattice A. Two kinds of N 2 AA -doped style are considered, for N dopants substitute the center or the edge carbon atoms. Our results show that the rectification behavior with a large rectifying ratio can be found in these devices and the rectifying characteristics can be modulated by changing the width of graphene nanoribbons or the position of the N 2 AA dopant. The mechanisms are revealed to explain the rectifying behaviors.
-
Cell volume regulation in hemoglobin CC and AA erythrocytes
International Nuclear Information System (INIS)
Berkowitz, L.R.; Orringer, E.P.
1987-01-01
Swelling hemoglobin CC erythrocytes stimulates a ouabain-insensitive K flux that restores original cell volume. Studies were performed with the K analog, 86 Rb. This volume regulatory pathway was characterized for its anion dependence, sensitivity to loop diuretics, and requirement for Na. The swelling-induced K flux was eliminated if intracellular chloride was replaced by nitrate and both swelling-activated K influx and efflux were partially inhibited by 1 mM furosemide or bumetanide. K influx in swollen hemoglobin CC cells was not diminished when Na in the incubation medium was replaced with choline, indicating Na independence of the swelling-induced flux. Identical experiments with hemoglobin AA cells also demonstrated a swelling-induced increase in K flux, but the magnitude and duration of this increase were considerably less than that seen with hemoglobin CC cells. The increased K flux in hemoglobin AA cells was likewise sensitive to anion replacement and to loop diuretics and did not require the presence of Na. These data indicate that a volume-activated K pathway with similar transport characteristics exists in both hemoglobin CC and AA red cells
-
Somatic effects of AAS abuse: A 30-years follow-up study of male former power sports athletes.
Lindqvist Bagge, A S; Rosén, T; Fahlke, C; Ehrnborg, C; Eriksson, B O; Moberg, T; Thiblin, I
2017-09-01
The aim of the present study was to investigate the association between somatic health and former abuse of AAS in former elite male athletes 30 years after the end of their active sports career. Retrospective follow-up study. N=996 former elite male athletes were sent a questionnaire concerning sociodemographic variables, previous and past sport activity and lifetime prevalence of seeking professional help for health problems. N=683 (68.6%) answered the questionnaire. The lifetime prevalence of AAS-abuse was 21% (n=143), while 79% (n=540) did not admit having ever used AAS. Former AAS-abuse was associated with tendon ruptures (p=0.01), depression (p=0.001), anxiety (p=0.01) and lower prevalence of prostate hypertrophy (p=0.01) and decreased libido (p=0.01). Former advanced AAS-abusers had higher anxiety (p=0.004) compared to the former less advanced AAS-abusers. Moreover, former advanced AAS-abusers, compared to AAS-naïves, reported more psychiatric problems (p=0.002), depression (p=0.003) and anxiety (p=0.00). A former AAS-abuse seems to be associated with some somatic and mental health problem, although a former less advanced AAS-abuse is related to lower incidence of prostate hypertrophy. The results raise the question whether some of these associations might be dose- and frequency dependent. These findings should however be seen as hypothesis generating and further studies are needed. Copyright © 2017 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.
-
Microstructure and hardness performance of AA6061 aluminium composite using friction stir processing
Marini, C. D.; Fatchurrohman, N.
2018-04-01
Rice husk ash (RHA) is an industrial waste that has become a potential reinforced material for aluminium matrix composite (AMCs) due to low cost and abundantly available resources. Friction stir processing (FSP) has been introduced as a method to modify surface properties of the metal and alloy including theirs composite as well. The present work reports the production and characterization of AA6061 and AA6061/5 vol% RHA using FSP using parameters rotation speed 1000 rpm and traversed speed 25 mm/min. The microstructure was studied using optical microscopy (OM). A homogenous dispersion of RHA particles was obtained in the composite. No agglomeration or segregation was observed. The produced composite exhibited a fine grain structure. An improvement in hardness profile was observed as AA6061/5 vol% RHA improves in hardness compared to FSPed of AA6061 without reinforcement.
-
Energy Technology Data Exchange (ETDEWEB)
Knospe, W.H.; Steinberg, D.; Speck, B.
1983-07-01
Immunologically mediated aplastic anemia (AA) was experimentally induced in mice by injecting 10(7) lymph node cells (LNC) from donor mice of one inbred strain to another H-2k identical but Mls mismatched strain previously given 600 rad total body gamma irradiation (TBI). AA developed after 2 weeks to 6 months in selected strain combinations used and usually 60 to 90% of the mice died. Clinical signs of graft-versus-host disease did not occur and splenic atrophy rather than splenomegaly was the rule. Histologically these mice had a lesion of the hematopoietic microenvironment characterized by sinusoidal injury and stromal necrosis. Others have demonstrated injury to hematopoietic stem cells. C3H/He LNC induced AA whereas C3H/HeJ LNC failed to induce AA. The C3H/HeJ strain carries a macrophage defect and these results suggest that a macrophage-like cell may be a mediator of immunological injury in this experimental model. Although all strain combinations evaluated were H-2k identical and Mls mismatched, certain Mls combinations resulted in AA and identical Mls mismatched but different strains did not. Both strong (Mlsd) and weak (Mlsc) stimulating LNC induce AA but simple Mls differences do not explain the AA as similar Mls combinations but different strain combinations fail to induce AA.
-
Yang, Minghui; Wu, Bingdang; Li, Qiuhao; Xiong, Xiaofeng; Zhang, Haoran; Tian, Yu; Xie, Jiawen; Huang, Ping; Tan, Suo; Wang, Guodong; Zhang, Li; Zhang, Shujuan
2018-03-01
Biodegradability and toxicity are two important indexes in considering the feasibility of a chemical process for environmental remediation. The acetylacetone (AA) mediated photochemical process has been proven as an efficient approach for dye decolorization. Both AA and its photochemical degradation products had a high bioavailability. However, the biocompatibility and ecotoxicology of the UV/AA treated solutions are unclear yet. In the present work, we evaluated the biocompatibility and toxicity of the UV/AA treated solutions at both biochemical and organismal levels. The biodegradability of the treated solution was evaluated with the ratio of 5-d biological oxygen demand (BOD 5 ) to chemical oxygen demand (COD) and a 28-d activated sludge assay (Zahn-Wellens tests). The UV/AA process significantly improved the biodegradability of the tested dye solutions. Toxicity was assessed with responses of microorganisms (microbes in activated sludge and Daphnia magna) and plants (bok choy, rice seed, and Arabidopsis thaliana) to the treated solutions, which showed that the toxicity of the UV/AA treated solutions was lower or comparable to that of the UV/H 2 O 2 counterparts. The results are helpful for us to determine whether the UV/AA process is applicable to certain wastewaters and how the UV/AA process could be effectively combined into a sequential chemical-biological water treatment. Copyright © 2017 Elsevier Ltd. All rights reserved.
-
Dual roles for CoAA and its counterbalancing isoform CoAM in human kidney cell tumorigenesis
Kang, Yun Kyoung; Schiff, Rachel; Ko, Lan; Wang, Tao; Tsai, Sophia Y.; Tsai, Ming-Jer; W. O’Malley, Bert
2008-01-01
Co-Activator Activator (CoAA) has been reported to be a coactivator that regulates steroid receptor-mediated transcription and alternative RNA splicing. Herein we show that CoAA is a dual-function coregulator that inhibits G1/S transition in human kidney cells and suppresses anchorage independent growth and xenograft tumor formation. Suppression occurs in part by downregulating c-myc and its downstream effectors ccnd1 and skp2, and causing accumulation of p27/Kip1 protein. In this cellular setting, CoAA directly represses the proto-oncogene, c-myc by recruiting HDAC3 protein and decreasing both the acetylation of histone H3 and the presence of RNA polymerase II on the c-myc promoter. Interestingly, a splicing isoform of CoAA, Coactivator Modulator (CoAM), antagonizes CoAA-induced G1/S transition and growth inhibition by negatively regulating the mRNA levels of the endogenous CoAA isoform. In addition, we found that expression of CoAA protein is significantly decreased in human renal cell carcinoma as compared to normal kidney. Our study presents evidence that CoAA is a potential tumor suppressor in renal carcinoma and that CoAM is a counterbalancing splice-isoform. This is so far the only example of a nuclear receptor coregulator involved in suppression of kidney cancer, and suggests potentially significant new roles for coregulators in renal cancer biology. PMID:18829545
-
International Nuclear Information System (INIS)
Sagai Francis Britto, A.; Raj, R. Edwin; Mabel, M. Carolin
2017-01-01
Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.
-
Energy Technology Data Exchange (ETDEWEB)
Sagai Francis Britto, A. [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Raj, R. Edwin, E-mail: redwinraj@gmail.com [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Mabel, M. Carolin [Department of Electrical and Electronics Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India)
2017-04-24
Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.
-
AA, sandwich line with magnetic horn
CERN PhotoLab
1980-01-01
Continuation from 8010293: Finally, the sandwich line with the horn is placed on the ground, for the horn to be inspected and, if needed, exchanged for a new one. The whole procedure was trained with several members of the AA team, for quick and safe handling, and to share the radiation dose amongst them.
-
AA, mating of BST magnet halves
CERN PhotoLab
1980-01-01
The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.
-
Dynamic Response of AA2519 Aluminum Alloy under High Strain Rates
Olasumboye, Adewale Taiwo
Like others in the AA2000 series, AA2519 is a heat-treatable Al-Cu alloy. Its excellent ballistic properties and stress corrosion cracking resistance, combined with other properties, qualify it as a prime candidate for armored vehicle and aircraft applications. However, available data on its high strain-rate response remains limited. In this study, AA2519 aluminum alloy was investigated in three different temper conditions: T4, T6, and T8, to determine the effects of heat treatment on the microstructure and dynamic deformation behavior of the material at high strain rates ranging within 1000 ≤ epsilon ≤ 4000 s-1. Split Hopkinson pressure bar integrated with digital image correlation system was used for mechanical response characterization. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. Results showed heterogeneous deformation in the three temper conditions. It was observed that dynamic behavior in each condition was dependent on strength properties due to the aging type controlling the strengthening precipitates produced and initial microstructure. At 1500 s -1, AA2519-T6 exhibited peak dynamic yield strength and flow stress of 509 and 667 MPa respectively, which are comparable with what were observed in T8 condition at higher rate of 3500 s-1 but AA2519-T4 showed the least strength and flow stress properties. Early stress collapse, dynamic strain aging, and higher susceptibility to shear band formation and fracture were observed in the T6 condition within the selected range of high strain rates. The alloy's general mode of damage evolution was by dispersoid particle nucleation, shearing and cracking.
-
Bernardi, Oderlei; Bernardi, Daniel; Horikoshi, Renato J; Okuma, Daniela M; Miraldo, Leonardo L; Fatoretto, Julio; Medeiros, Fernanda Cl; Burd, Tony; Omoto, Celso
2016-09-01
Spodoptera frugiperda is one the main target pests of maize events expressing Vip3Aa20 protein from Bacillus thuringiensis (Bt) in Brazil. In this study, we selected a resistant strain of S. frugiperda on Bt maize expressing Vip3Aa20 protein and characterized the inheritance and fitness costs of the resistance. The resistance ratio of the Vip3Aa20-resistant strain of S. frugiperda was >3200-fold. Neonates of the Vip3Aa20-resistant strain were able to survive and emerge as fertile adults on Vip3Aa20 maize, while larvae from susceptible and heterozygous strains did not survive. The inheritance of Vip3Aa20 resistance was autosomal recessive and monogenic. Life history studies to investigate fitness cost revealed an 11% reduction in the survival rate until adult stage and a ∼50% lower reproductive rate of the Vip3Aa20-resistant strain compared with susceptible and heterozygous strains. This is the first characterization of S. frugiperda resistance to Vip3Aa protein. Our results provide useful information for resistance management programs designed to prevent or delay resistance evolution to Vip3Aa proteins in S. frugiperda. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
-
Jing, Yue; Wang, Gang; Ge, Ying; Xu, Minjie; Tang, Shuainan; Gong, Zhunan
2016-01-01
Asiatic acid (AA; 2α,3β,23-trihydroxyurs-12-ene-28-oic acid) is widely used for medicinal purposes in many Asian countries due to its various bioactivities. A series of AA derivatives has been synthesized in attempts to improve its therapeutic potencies. Herein we investigated the anti-tumor activities of N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-l-proline methyl ester (AA-PMe), a novel AA derivative. AA-PMe exhibited a stronger anti-cancer activity than its parent compound AA. AA-PMe inhibited the proliferation of SGC7901 and HGC27 human gastric cancer cells in a dose-dependent manner but had no significant toxicity in human gastric mucosa epithelial cells (GES-1). AA-PMe induced cell cycle arrest in G0/G1 phase and blocked G1-S transition, which correlated well with marked decreases in levels of cyclin D1, cyclin-dependent kinase CKD4, and phosphorylated retinoblastoma protein, and increase in cyclin-dependent kinase inhibitor P15. Further, AA-PMe induced apoptosis of human gastric cancer cells by affecting Bcl-2, Bax, c-Myc, and caspase-3. Moreover, AA-PMe suppressed the migration and invasion of human gastric cancer cells (SGC7901 and HGC27) cells by downregulating the expression of MMP-2 and MMP-9. Overall, this study investigated the potential anti-cancer activities of AA-PMe including inducing apoptosis and suppressing proliferation, migration and invasion of gastric cancer cells, as well as the underlying mechanisms, suggesting that AA-PMe is a promising anti-cancer drug candidate in gastric cancer therapy.
-
Hu, Weining; Zhang, Yang; Wang, Li; Lau, Chi Wai; Xu, Jian; Luo, Jiang-Yun; Gou, Lingshan; Yao, Xiaoqiang; Chen, Zhen-Yu; Ma, Ronald Ching Wan; Tian, Xiao Yu; Huang, Yu
2016-03-01
Bone morphogenic protein 4 (BMP4) is an important mediator of endothelial dysfunction in cardio-metabolic diseases, whereas platelet-derived growth factors (PDGFs) are major angiogenic and proinflammatory mediator, although the functional link between these 2 factors is unknown. The present study investigated whether PDGF mediates BMP4-induced endothelial dysfunction in diabetes mellitus. We generated Ad-Bmp4 to overexpress Bmp4 and Ad-Pdgfa-shRNA to knockdown Pdgfa in mice through tail intravenous injection. SMAD4-shRNA lentivirus, SMAD1-shRNA, and SMAD5 shRNA adenovirus were used for knockdown in human and mouse endothelial cells. We found that PDGF-AA impaired endothelium-dependent vasodilation in aortas and mesenteric resistance arteries. BMP4 upregulated PDGF-AA in human and mouse endothelial cells, which was abolished by BMP4 antagonist noggin or knockdown of SMAD1/5 or SMAD4. BMP4-impared relaxation in mouse aorta was also ameliorated by PDGF-AA neutralizing antibody. Tail injection of Ad-Pdgfa-shRNA ameliorates endothelial dysfunction induced by Bmp4 overexpression (Ad-Bmp4) in vivo. Serum PDGF-AA was elevated in both diabetic patients and diabetic db/db mice compared with nondiabetic controls. Pdgfa-shRNA or Bmp4-shRNA adenovirus reduced serum PDGF-AA concentration in db/db mice. PDGF-AA neutralizing antibody or tail injection with Pdgfa-shRNA adenovirus improved endothelial function in aortas and mesenteric resistance arteries from db/db mice. The effect of PDGF-AA on endothelial function in mouse aorta was also inhibited by Ad-Pdgfra-shRNA to inhibit PDGFRα. The present study provides novel evidences to show that PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms. Inhibition of PGDF-AA ameliorates vascular dysfunction in diabetic mice. © 2016 American Heart Association, Inc.
-
Co-deposition of basement membrane components during the induction of murine splenic AA amyloid
DEFF Research Database (Denmark)
Lyon, A W; Narindrasorasak, S; Young, I D
1991-01-01
Past studies have demonstrated that during murine AA amyloid induction there is co-deposition of the AA amyloid peptide and the basement membrane form of heparan sulfate proteoglycan. The synthesis and accumulation of heparan sulfate proteoglycan does not usually occur in the absence of other...... basement membrane components, such as type IV collagen, laminin, and fibronectin. Using immunohistochemical techniques, the present experiments have demonstrated that in addition to the heparan sulfate proteoglycan, there are other basement membrane components present in splenic AA amyloid deposits...... and these are present as soon as AA amyloid deposits are detectable. The results indicate that within the time constraints imposed by the experiments, the basement membrane components, fibronectin, laminin, type IV collagen, and heparan sulfate proteoglycan are co-deposited 36 to 48 hours after the AgNO3 and amyloid...
-
Kuipers, Remko S.; Luxwolda, Martine F.; Dijck-Brouwer, D. A. Janneke; Muskiet, Frits A. J.
Erythrocyte (RBC) fatty acid compositions from populations with stable dietary habits but large variations in RBC-arachidonic (AA) and RBC-docosahexaenoic acid (DHA) provided us with insight into relationships between DHA and AA. It also enabled us to estimate the maternal RBC-DHA (mRBC-DHA) status
-
AAS Publishing News: Preparing Your Manuscript Just Got Easier
Kohler, Susanna
2016-03-01
Watermarking using the command watermark{DRAFT, v2}.Are you an astronomer considering submitting a paper to an AAS journal (i.e., AJ, ApJ, ApJ Letters, or ApJ Supplements)? If so, this post is for you! Read on to find out about the exciting new things you can do with the AASs newest LaTeX class file, available for download now.Why the Update?AAS publishing has maintained a consistent class file for LaTeX manuscript preparation for the past decade. But academic publishing is changing rapidly in todays era of electronic journals! Since its journals went fully electronic, the AAS has been continuously adding new publishing capabilities based on the recommendations of the Journals Task Force and the needs and requests of AAS authors. The AASs manuscript preparation tools are now being updated accordingly.Whats New in AASTex 6.0?There are many exciting new features and capabilities in AASTex 6.0. Here are just a few:Tracking options for author revisions include added{text}, deleted{text}, replaced{old}{new}, and explain{text}.Based on emulateapjDo you use the popular class file emulateapj to prepare your manuscripts? AASTex 6.0 is based on emulateapj, rather than on the older AASTex 5.2 (though 5.2 is still supported). This means that it is easy to produce a double-columned, single-spaced, and astro-ph-ready manuscript. Since two thirds of the AAS journals authors use emulateapj, this transition was designed to make manuscript preparation and sharing an easier and more seamless process.Tools for collaborationsDo you work in a large collaboration? AASTex now includes new tools to make preparing a manuscript within a collaboration easier. Drafts can now be watermarked to differentiate between versions. New markup for large author lists streamlines the display so that readers can access article information immediately, yet they can still access the full author list and affiliations at the end of the paper. And author revision markup allows members of a collaboration to
-
Overall view of AA in Bld. 193
1980-01-01
See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
-
First circulating beam in the AA
CERN PhotoLab
1980-01-01
On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.5 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are to numerous to name them all. Heribert Koziol, apparently asleep, is answering the call from an impatient director. See also 8007094.
-
Technical feasibility study for a solar energy system at Amsterdam Airport Schiphol (AAS)
Janssen, P.N.J.W.; Myrzik, J.M.A.; Kling, W.L.; Reinders, L.
2010-01-01
This work arises within the framework of the introduction of renewable energies at Amsterdam Airport Schiphol (AAS) and the focus is on the technical feasibility of a solar energy system (SES) on ground level. The flight safety must always be guaranteed if solar panels are implemented on AAS. The
-
The adhesion performance of epoxy coating on AA6063 treated in Ti/Zr/V based solution
International Nuclear Information System (INIS)
Zhu, Wen; Li, Wenfang; Mu, Songlin; Yang, Yunyu; Zuo, Xi
2016-01-01
Highlights: • A non-chrome titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating is prepared on AA6063 at room temperature. • The Ti/Zr/V conversion coating is produced on AA6063 within 50 s. • The adhesion strength between epoxy coating and AA6063 is improved significantly after the Ti/Zr/V conversion treatment. - Abstract: An environment-friendly titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating was prepared on aluminum alloy 6063 (AA6063). The epoxy powder coatings were applied on the AA6063 samples with/without Ti/Zr/V conversion coatings via electrostatic spraying. The morphology and composition of the conversion coating were studied by scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS), respectively. The surface free energy components of AA6063 samples were measured by a static contact angle measuring device with Owens method. The adhesion properties of the epoxy coating on AA6063 treated with different conversion times were evaluated using a pull-off tester. The Ti/Zr/V conversion coating was mainly composed of metal oxide (TiO 2 , ZrO 2 , V 2 O 5 , Al 2 O 3 , etc.), metal fluoride (ZrF 4 , AlF 3 , etc.) and metal organic complex. The formation time of this conversion coating was reduced to 50 s. After such surface treatment, the samples' surface roughness was increased and the contact angle with water was decreased. Both the surface free energy and the work of adhesion were increased. The adhesion strength between the epoxy coating and AA6063 was enhanced significantly.
-
Jing, Yue; Wang, Gang; Ge, Ying; Xu, Minjie; Tang, Shuainan; Gong, Zhunan
2016-01-01
Asiatic acid (AA; 2α,3β,23-trihydroxyurs-12-ene-28-oic acid) is widely used for medicinal purposes in many Asian countries due to its various bioactivities. A series of AA derivatives has been synthesized in attempts to improve its therapeutic potencies. Herein we investigated the anti-tumor activities of N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-l-proline methyl ester (AA-PMe), a novel AA derivative. AA-PMe exhibited a stronger anti-cancer activity than its parent compound AA. AA-PMe inhibited the proliferation of SGC7901 and HGC27 human gastric cancer cells in a dose-dependent manner but had no significant toxicity in human gastric mucosa epithelial cells (GES-1). AA-PMe induced cell cycle arrest in G0/G1 phase and blocked G1-S transition, which correlated well with marked decreases in levels of cyclin D1, cyclin-dependent kinase CKD4, and phosphorylated retinoblastoma protein, and increase in cyclin-dependent kinase inhibitor P15. Further, AA-PMe induced apoptosis of human gastric cancer cells by affecting Bcl-2, Bax, c-Myc, and caspase-3. Moreover, AA-PMe suppressed the migration and invasion of human gastric cancer cells (SGC7901 and HGC27) cells by downregulating the expression of MMP-2 and MMP-9. Overall, this study investigated the potential anti-cancer activities of AA-PMe including inducing apoptosis and suppressing proliferation, migration and invasion of gastric cancer cells, as well as the underlying mechanisms, suggesting that AA-PMe is a promising anti-cancer drug candidate in gastric cancer therapy. PMID:27073325
-
[Exposure degree of important non-target arthropods to Cry2Aa in Bt rice fields].
Zhang, Qing-Ling; Li, Yun-He; Hua, Hong-Xia; Yang, Chang-Ju; Wu, Hong-Jin; Peng, Yu-Fa
2013-06-01
Based on the principle of "risk = hazard x exposure", the selected representative nontarget organisms in the assessment of the potential effects of insect-resistant genetically modified (GM) crops on non-target arthropods in laboratory are generally the arthropod species highly exposed to the insecticidal proteins expressed by the GM crops in farmland ecosystem. In order to understand the exposure degree of the important arthropod species to Cry proteins in Bt rice fields, and to select the appropriate non-target arthropods in the risk assessment of insect-resistant GM crops, the enzyme-linked immunosorbent assay (ELISA) was conducted to measure the Cry2Aa protein concentration in the arthropods collected from the cry2Aa rice fields at different rice growth stages. The results showed that there was a significant difference in the Cry2Aa content protein concentration in different arthropod species. Some species did not contain Cry2Aa protein, while some species contained larger amounts of Cry2Aa protein. Relative to the arthropods colleted after rice anthesis, the arthropods colleted in rice anthesis contained relative higher concentrations of Cry2Aa protein, especially for the predacious arthropods. No Cry proteins were detected in parasitic arthropods. This study provided references for the laboratory assessment of the effects of GM rice on nontarget arthropods.
-
AR, HEA and AAS in Rural Development Projects--Benchmarking towards the Best Processes.
Westermarck, Harri
In most countries, agricultural research (AR), institutions of higher education in agriculture (HEA), and agricultural advisory services (AAS) function as separate agencies. So far, in most countries, AR, HEA, and AAS have not had a common vision for rural development. In Finland, domination of agricultural production in Finland has led to a lack…
-
Kanoh, Miki; Inai, Kei; Shinohara, Tokuko; Tomimatsu, Hirofumi; Nakanishi, Toshio
2017-12-01
Recent studies showed that a low ratio between the levels of eicosapentaenoic acid and those of arachidonic acid (EPA/AA) is associated with higher incidence of coronary artery disease and poor prognosis of heart failure, arrhythmia, and cardiac sudden death. However, the clinical implications of EPA/AA in adult patients with congenital heart disease remain unclear. We aimed to assess the prognostic value of EPA/AA regarding cardiac events in adult patients with congenital heart disease. We measured the serum levels of eicosapentaenoic acid and arachidonic acid in 130 adult patients (median age, 31 years) stratified into two groups according to their EPA/AA (low, ≤0.22; high, >0.22). We prospectively analyzed the association between EPA/AA and incidence of cardiac events during a mean observation period of 15 months, expressed in terms of hazard ratio (HR) with 95% confidence interval (95% CI). In the subgroup of patients with biventricular circulation (2VC) (n = 76), we analyzed the same clinical endpoints. In our study population, EPA/AA was not associated with the incidence of arrhythmic events (HR, 1.52; 95% CI, 0.82-2.85; p = 0.19), but low EPA/AA was a predictor of heart failure hospitalization (HR, 2.83; 95% CI, 1.35-6.30; p AA of ≤0.25 was associated with a significantly higher risk of arrhythmic events (HR, 2.55; 95% CI, 1.11-6.41; p = 0.03) and heart failure hospitalization (HR, 5.20; 95% CI, 1.78-18.1; p AA represents a useful predictor of cardiac events in adult patients with congenital heart disease.
-
The adhesion performance of epoxy coating on AA6063 treated in Ti/Zr/V based solution
Energy Technology Data Exchange (ETDEWEB)
Zhu, Wen; Li, Wenfang, E-mail: mewfli@scut.edu.cn; Mu, Songlin; Yang, Yunyu; Zuo, Xi
2016-10-30
Highlights: • A non-chrome titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating is prepared on AA6063 at room temperature. • The Ti/Zr/V conversion coating is produced on AA6063 within 50 s. • The adhesion strength between epoxy coating and AA6063 is improved significantly after the Ti/Zr/V conversion treatment. - Abstract: An environment-friendly titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating was prepared on aluminum alloy 6063 (AA6063). The epoxy powder coatings were applied on the AA6063 samples with/without Ti/Zr/V conversion coatings via electrostatic spraying. The morphology and composition of the conversion coating were studied by scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS), respectively. The surface free energy components of AA6063 samples were measured by a static contact angle measuring device with Owens method. The adhesion properties of the epoxy coating on AA6063 treated with different conversion times were evaluated using a pull-off tester. The Ti/Zr/V conversion coating was mainly composed of metal oxide (TiO{sub 2}, ZrO{sub 2}, V{sub 2}O{sub 5}, Al{sub 2}O{sub 3}, etc.), metal fluoride (ZrF{sub 4}, AlF{sub 3}, etc.) and metal organic complex. The formation time of this conversion coating was reduced to 50 s. After such surface treatment, the samples' surface roughness was increased and the contact angle with water was decreased. Both the surface free energy and the work of adhesion were increased. The adhesion strength between the epoxy coating and AA6063 was enhanced significantly.
-
A Novel Tenebrio molitor Cadherin Is a Functional Receptor for Bacillus thuringiensis Cry3Aa Toxin*
Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D.; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis
2009-01-01
Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepidopteran cadherin B. thuringiensis receptors. A peptide containing the putative toxin binding region from TmCad1 bound specifically to Cry3Aa and promoted the formation of Cry3Aa toxin oligomers, proposed to be mediators of toxicity in lepidopterans. Injection of TmCad1-specific double-stranded RNA into T. molitor larvae resulted in knockdown of the TmCad1 transcript and conferred resistance to Cry3Aa toxicity. These data demonstrate the functional role of TmCad1 as a Cry3Aa receptor in T. molitor and reveal similarities between the mode of action of Cry toxins in Lepidoptera and Coleoptera. PMID:19416969
-
Experimental study on joining of AA6063 and AISI 1040 steel
Hynes, N. Rajesh Jesudoss; Raja, S.
2018-05-01
Feasibility of joining of dissimilar metals with different physical, chemical and thermal properties such as AA6063 alloy and AISI 1040 steel is worthwhile study, since it has tremendous applications in all most of all engineering domains. The mechanism of bonding is studied using scanning electron microscopy. Impact strength of AA2024/AISI joints, axial shortening distance, micro hardness distribution and joint strength are determined. Micro hardness profile shows increased hardness value at the joint interface, due to grain refinement.
-
Lane, Thirusha; Pinney, Jennifer H; Gilbertson, Janet A; Hutt, David F; Rowczenio, Dorota M; Mahmood, Shameem; Sachchithanantham, Sajitha; Fontana, Marianna; Youngstein, Taryn; Quarta, Candida C; Wechalekar, Ashutosh D; Gillmore, Julian D; Hawkins, Philip N; Lachmann, Helen J
2017-09-01
Systemic AA amyloidosis is a serious complication of chronic inflammation; however, there are relatively few published data on its incidence. We investigated the changing epidemiology of AA amyloidosis over a 25-year period at a single national referral centre. We conducted a retrospective study of all patients diagnosed with AA amyloidosis who had attended the centre between 1990 and 2014 inclusive. Six hundred and twenty-five patients were studied in three cohorts: C1: 1990-1997; C2: 1998-2006; C3: 2007-2014. Mean age at presentation increased from 46 in C1 to 56 in C3 (p AA amyloidosis over a quarter of a century, reflecting advances in therapeutics and overall management of complex chronic disease in an ageing population. AA amyloidosis of uncertain aetiology presents an emerging major problem. Newer techniques such as next-generation sequencing may aid diagnosis and effective treatment, thereby improving overall survival.
-
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the
-
Study of processes of interligand exchange between Cu(AA)2 and Y(DPM)3 in geseous phase
International Nuclear Information System (INIS)
Girichev, G.V.; Giricheva, N.I.; Belova, N.V.; Kuz'mina, N.P.; Kaul', A.R.; Gorbenko, O.Yu.
1993-01-01
Mass-spectrometric method was used to study the process, proceeding between gaseous copper acetylacetonate and yttrium dipivaloylmethanate in 150-630 deg C range. It was established that intensive ligand exchange with formation of Cu(DPM) (AA), Y(DPM) 2 (AA), Cu(DPM) 2 compounds in gaseous mixture took place between components. Thermal decomposition of copper and yttrium β-diketonates was observed with temperature growth, along with reactions of interligand exchange. Molecular forms of Y(DPM) 2 , Y(DPM)(AA), Cu(DPM) 2 and Cu(DPM)(AA) were the most thermally stable at that
-
Influence of titanium–boron additions on grain refinement of AA6082 gas tungsten arc welds
International Nuclear Information System (INIS)
Kishore Babu, N.; Talari, Mahesh Kumar; Dayou, Pan; Zheng, Sun; Jun, Wei; SivaPrasad, K.
2012-01-01
Highlights: ► Ti in the weld metal resulted in grain refinement due to growth restriction effect. ► Weld metal strength improved due to grain refinement caused by Tibor™ addition. ► Weld metal responded to post-weld ageing treatment due to dilution from base metal. ► Weld metal with AA5356 filler are stronger then AA4043 for all Tibor™ additions. -- Abstract: Grain refinement of weld metal plays a vital role in improving mechanical properties (ductility and toughness) as well as weldability. The present study has investigated the influence of Tibor™ additions on the structure and mechanical properties of AA6082 gas tungsten arc (GTA) weldments. Controlled amounts of Tibor™ grain refiner (containing Ti and B in a ratio of 5:1) were introduced into the molten pool of AA6082 by pre-deposited cast inserts (AA4043 and AA5356) under different welding conditions by GTA welding. Full penetration GTA welds were prepared using alternating current (AC). It was observed that grain size was decreased with increasing amounts of Tibor™. The grain refinement is mainly caused grain nucleation associated with constitutional undercooling during solidification. It has been shown that welds prepared with 5356 cast insert exhibited high strength and ductility when compared with other welds. The observed grain refinement was shown to result in an appreciable increase in fusion zone hardness, strength and ductility.
-
Renal AA amyloidosis in a patient with hereditary complete complement C4 deficiency
Directory of Open Access Journals (Sweden)
Imed Helal
2011-01-01
Full Text Available Hereditary complete C4 deficiency has until now been reported in 30 cases only. A disturbed clearance of immune- complexes probably predisposes these individuals to systemic lupus erythematosus, other immune- complex diseases and recurrent microbial infections. We present here a 20- year- old female with hereditary complete C4 deficiency. Renal biopsy demonstrated renal AA amyloidosis. This unique case further substantiates that deficiency of classical pathway components predisposes to the development of recurrent microbial infections and that the patients may develop AA amyloidosis. Furthermore, in clinical practice, the nephrotic syndrome occurring in a patient with hereditary complete complement C4 deficiency should lead to the suspicion of renal AA amyloidosis.
-
Therapeutic Benefits of Tocilizumab Vary in Different Organs of a Patient with AA Amyloidosis
Directory of Open Access Journals (Sweden)
Masaru Matsui
2014-01-01
Full Text Available Systemic reactive AA amyloidosis is a life-threatening complication of chronic inflammatory diseases. Anti-interleukin-6 receptor, tocilizumab (TCZ, has been shown to improve clinical symptoms of patients with AA amyloidosis, accompanied with regression of the amyloid deposition. We report a case of AA amyloidosis evaluated by histology of multiple organs before and after TCZ treatment. A woman in her 60s with rheumatoid arthritis was referred to our hospital because of cardiac and renal dysfunction. A gastric and renal biopsy revealed the deposition of AA amyloid, and echocardiography revealed concentric left ventricular hypertrophy. Her estimated glomerular filtration rate was decreased to 8.6 mL/min/1.73 m2, and B-type natriuretic peptide, C-reactive protein, and serum amyloid A protein were significantly elevated. TCZ treatments markedly decreased her serum amyloid A protein and C-reactive protein levels, but hemodialysis was required 1 year later. Endoscopic gastric rebiopsy 3 years after initiation of TCZ treatments revealed the regression of amyloid deposition and echocardiography revealed improvement of her left ventricular hypertrophy. However, a renal rebiopsy revealed that the amyloid deposition had not regressed. In conclusion, these observations suggest that the therapeutic effects of TCZ can vary among organs in patients with AA amyloidosis.
-
International Nuclear Information System (INIS)
Gitopadmojo, Isminingsih
2000-01-01
Polypropylene yams that have been subjected to irradiation induced graftco-polymerization with acrylic acid, have gained its moisture regain and dyeability, that fulfilled the requirement as textile material for garment.However, the copolymer grafted PP-AA has suffered from degradation in thestorage, which was indicated in the previous study that the strengthretention has dropped tremendously by photo-oxidation or photo-degradation.After treatments of PP-AA yams with chemical compound that was able toprevent further photo-oxidation, will be expected to improve the stability ofPP-AA in storage. In this research activity, the polypropylene (PP) yams weresubjected to irradiation induced graft co-polymerization by means ofγ-Ray Co-60 as irradiation source with acrylic acid (AA) as monomer.Various after treatments were subjected to the grafted PP-AA yams such asalkalisation process; dyeing (anionic dyes, cationic dyes and nonionic dyes);as well as processing with optical brightening agent and UV stabilizer,separately. The PP-AA yams (before and after treatment) were subjected tostorage from 1 month up to 42 months, and then being tested for theirmoisture regain, strength retention and elongation at breaks. The samplesbeing stored for 12 months were subjected to radical analysis. It isconcluded from the experiment that after treatment of grafted PP-AA by meansof those various processes were able to improve the stability of copolymergrafted PP-AA in storage. The presence of peroxide radical in the ESR(electron spin resonance) spectrum on PP-AA yams before treatment and theones after treated with alkaline and being stored for 12 months haveindicated the presence of photo oxidation or photo degradation, while thepresence of poly enyl radical in the ESR spectrum of after treated PP-AA withdyes having azo and azine compound as chromophore, as well as with UVstabilizer with carbonyl as chromophore and being stored for 12 months haveproved that its presence have protected such
-
AA, closed orbit observation pickup
1980-01-01
Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. See also 8001372, 8010042, 8010045
-
Directory of Open Access Journals (Sweden)
Lauro Saraiva Lessa
2009-01-01
Full Text Available Objetivou-se avaliar características agronômicas em híbridos diplóides (AA de bananeira. No experimento, conduzido no campo experimental da Embrapa Mandioca e Fruticultura Tropical, em blocos casualizados com quatro repetições, foram avaliados 11 híbridos diplóides (AA de bananeira (4279-06, TH03-01, 8987-01, 0323-03, 1318-01, 0116-01, 8694-20, 1304-06, 9179-03, 4223-06 e SH3263. Os dados dos caracteres agronômicos avaliados foram submetidos à análise de variância e as médias dos genótipos foram agrupadas pelo teste de Scott-Knott, a 5% de probabilidade. O genótipo SH3263 apresentou valores favoráveis ao melhoramento para número de pencas e de frutos por cacho e baixa incidência de Sigatoka-amarela na floração, além de menor número de dias da floração à colheita, maior peso da segunda penca e comprimento de fruto acima de 10 cm. O híbrido 0323-03 apresentou a maior retenção de folhas vivas na colheita do cacho e, também, a menor nota para incidência de sigatoka-amarela na colheita. A alta variabilidade encontrada com a avaliação dos híbridos permite a seleção de diplóides (AA com potencial para utilização em programas de melhoramento da cultura.The aim of the present work was to characterize horticultural characteristics in (AA banana diploid hybrids. The experiment was carried out at the experimental field of Embrapa Cassava and Tropical Fruits in randomized blocks with four replicates and 11 (AA banana diploid hybrids were evaluated: (4279-06, TH03-01, 8987-01, 0323-03, 1318-01, 0116-01, 8694-20, 1304-06, 9179-03, 4223-06 and SH3263. Data of the agronomical characteristics evaluated were submitted to the analysis of variance and the averages of the genotypes grouped by the Scott-Knott test at 5% of probability. The SH3263 genotype presented favorable values to the breeding for number of hands per bunch, number of fruits per bunch, low yellow-sigatoka incidence during flowering and also lower number of days
-
Kalkan, Göknur; Karakus, Nevin; Baş, Yalçın; Takçı, Zennure; Ozuğuz, Pınar; Ateş, Omer; Yigit, Serbulent
2013-09-25
Alopecia areata (AA) is hypothesized to be an organ-specific autoimmune disease of hair follicles mediated by T cells. As immunological and genetic factors have been implicated in the pathogenesis of AA, the purpose of the present study was to investigate possible associations between the functional Interleukin (IL)-4 gene intron 3 VNTR polymorphism and AA susceptibility and disease progression in Turkish population. The study group consisted of 116 unrelated patients with AA and 125 unrelated healthy controls. Genomic DNA was isolated and IL-4 gene 70 bp VNTR polymorphism determined by using polymerase chain reaction (PCR) with specific primers. No association was observed between AA patients and controls according to genotype distribution (p=0.051). The allele distribution of IL-4 gene intron 3 VNTR polymorphism was statistically different between AA patients and control group (p=0.026). The frequency of P1 allele in patients was significantly higher than that in the control group. When the P2P2 genotype was compared with P1P2+P1P1 genotypes, a statistically significant difference was observed between patients and controls (p=0.036). Intron 3 VNTR polymorphism in the IL-4 gene was found to be associated with AA susceptibility in Turkish population. The results suggest that IL-4 VNTR polymorphism in the intron 3 region may be a risk factor for the development of AA among Turkish population. This is the first to report that intron 3 VNTR polymorphism in the IL-4 gene is associated with AA susceptibility. © 2013.
-
Mechanical properties of aluminium–copper–lithium alloy AA2195 at cryogenic temperatures
International Nuclear Information System (INIS)
Nayan, Niraj; Narayana Murty, S.V.S.; Jha, Abhay K.; Pant, Bhanu; Sharma, S.C.; George, Koshy M.; Sastry, G.V.S.
2014-01-01
Highlights: • 4 mm thick sheet of AA2195 was imparted T87 temper. • 7% cold work to impart T87 was given by combination of cold rolling and stretching. • Mechanical properties were evaluated at RT and cryogenic temperatures. • Strength of AA2195 are superior to the conventional aluminum alloy 2219 at all temperatures. • Strength decreases with decrease in temperature whereas ductility remains unchanged. - Abstract: Tensile testing was performed on a 4 mm thick sheet of the aluminum–lithium alloy AA2195 in T87 (solution treatment + water quenching + 7% cold work + peak aging) temper which was subjected to 7% cold working by combination of cold rolling and stretching, over a temperature range from ambient to liquid hydrogen (20 K) conditions. Properties were evaluated in longitudinal as well as transverse directions to characterize anisotropy with respect to strength and ductility. Strength and ductility were compared to the conventional aluminum alloy AA2219-T87, developed for similar cryogenic applications. Decreases in test temperature led to higher strengths with little or no change in ductility. As the temperature decreases, the differences between ultimate tensile strength as well as yield strength for two different combinations of cold roll and stretch studied in the present work, narrows down and become equal at 20 K
-
Profile of renal AA amyloidosis in older and younger individuals: a single-centre experience.
Erdogmus, Siyar; Kendi Celebi, Zeynep; Akturk, Serkan; Kumru, Gizem; Duman, Neval; Ates, Kenan; Erturk, Sehsuvar; Nergizoglu, Gokhan; Kutlay, Sim; Sengul, Sule; Keven, Kenan
2018-05-18
In epidemiological studies of amyloid A (AA) amyloidosis from Turkey, the most frequently cause was familial Mediterranean fever (FMF) and it occurs generally in young age population. However, there are no sufficient data regarding aetiology, clinical presentation and prognosis of renal AA amyloidosis in advanced age patients. In this study, we aimed to investigate demographic, clinical presentation, aetiology and outcomes of adults aged 60 years or older patients with biopsy-proven renal AA amyloidosis. This is a retrospective study involving 53 patients who were diagnosed with AA amyloidosis by kidney biopsy from 2006 to 2016. In all patients, kidney biopsies were performed due to asymptomatic proteinuria, nephrotic syndrome and/or renal insufficiency. The patients were separated into two groups on the basis of age (group I: ≥60 years and group II: AA amyloidosis were as follows: FMF 16 (50%), bronchiectasis 7 (23%), chronic osteomyelitis 2 (6%), inflammatory bowel disease 2 (6%), rheumatoid arthritis 2 (6%), ankylosing spondylitis 1 (3%) and unknown aetiology 2 (6%). The underlying disorders of AA amyloidosis in group II patients were as follows: FMF 17 (81%), Behcet's disease 1 (5%) and unknown aetiology 3 (14%). No statistically significant differences were detected between two groups with regard to systolic and diastolic blood pressures, albumin, proteinuria and lipids. The combination of chronic kidney disease and nephrotic syndrome was the most common clinical presentation in group I (73%) and group II (43%) (p = .05). Compared to the group II, estimated glomerular filtration rate was significantly lower in group I at the time of kidney biopsy (p = .003). At 12-month follow-up, 61% of the group I and 33% of the group II developed end-stage kidney disease requiring dialysis, while 11% of the group I died. Our results indicated that renal AA amyloidosis is a rare disease in advanced age patients. At baseline and follow-up period, advanced age
-
Horton, K. Renee; McGill, Preston; Barkey, Mark
2011-01-01
Friction stir welding (FSW) is a solid state welding process with potential advantages for aerospace and automotive industries dealing with light alloys. Self-reacting friction stir welding (SR-FSW) is one variation of the FSW process being developed at the National Aeronautics and Space Administration (NASA) for use in the fabrication of propellant tanks. This work reports on the microstructure and microhardness of SR-FSW between two dissimilar aluminum alloys. Specifically, the study examines the cross section of the weld joint formed between an AA2014-T6 plate on the advancing side and an AA2219-T87 plate on the retreating side. The microstructural analysis shows an irregularly displaced weld seam from the advancing side past the thermo-mechanical affected zone (TMAZ) into the weld nugget region. There are sharp variations in the microhardness across the weld. These variations are described in the paper and mechanisms for their formation are discussed.
-
Churg-Strauss syndrome associated with AA amyloidosis: a case report.
Maamar, Mouna; Tazi-Mezalek, Zoubida; Harmouche, Hicham; El Hamany, Zitouna; Adnaoui, Mohammed; Aouni, Mohammed
2012-01-01
Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/µL), positive p-ANCA, microscopic haematuria and proteinuria at 2g/day. A diagnosis of Churg-Strauss syndrome was established based on five criteria of the American College of Rheumatology (ACR). Renal biopsy showed an important type AA amyloid deposit. The patient was treated with steroids with a good response of the vasculitis and amyloidosis with disappearance of the proteinuria.
-
Deng, Sheng-Qun; Cai, Qun-Di; Deng, Ming-Zhi; Huang, Qiang; Peng, Hong-Juan
2017-12-01
To improve the insecticidal efficacy of this entomopathogen Beauveria bassiana, the fungus was genetically modified to express an insect-specific scorpion neurotoxin AaIT. The virulence of the recombinant B. bassiana strain (Bb-AaIT) against Aedes albopictus adults (which occurs via penetration through the cuticle during spore germination or by conidia ingestion), and the larvae (by conidia ingestion) was measured with bioassays. The median lethal concentration (LC 50 ) of Bb-AaIT against A. albopictus larvae was 313.3-fold lower on day 4 and 11.3-fold lower on day 10 than that of the wild type (WT). Through conidia feeding or body contact, Bb-AaIT killed 50% of adult female mosquitoes at 3.9- or 1.9-fold reduced concentrations on day 4 and at 2.1- or 2.4-fold reduced concentrations on day 10. Compared with the results for the WT, the median lethal time (LT 50 ) of Bb-AaIT was reduced by 28.6% at 1 × 10 7 conidia ml -1 and 34.3% at 1 × 10 6 conidia ml -1 in the larvae bioassay by conidia ingestion, while it decreased 32.3% at 1 × 10 7 conidia ml -1 by conidia ingestion and 24.2% at 1 × 10 8 conidia ml -1 by penetrating through the cuticle in the adult bioassay. All the differences were significant. Our findings indicated that Bb-AaIT had higher virulence and faster action than the WT in killing the larval and adult mosquitoes, and therefore, it is valuable for development as a commercial mosquito pesticide.
-
Distinguishing diffuse alopecia areata (AA) from pattern hair loss (PHL) using CD3(+) T cells.
Kolivras, Athanassios; Thompson, Curtis
2016-05-01
Distinguishing between diffuse subacute alopecia areata (AA), in which the peribulbar infiltrate is absent, and pattern hair loss is challenging, particularly in cases that lack marked follicular miniaturization and a marked catagen/telogen shift. We sought to distinguish diffuse AA from pattern hair loss using CD3(+) T lymphocytes. A total of 28 cases of subacute AA and 31 cases of pattern hair loss were selected and a 4-mm punch biopsy was performed. All the specimens were processed using the "HoVert" (horizontal and vertical) technique. In all cases, hematoxylin-eosin and immunohistochemical stains for CD3, CD4, CD8, and CD20 were performed. The presence of CD3(+) lymphocytes within empty follicular fibrous tracts (stela), even without a concomitant peribulbar infiltrate, is a reliable histopathological clue in supporting a diagnosis of AA (sensitivity 0.964, specificity 1, P ≤ .001). Limited tissue for analysis remained in the clinical sample tissue blocks. The presence of CD3(+) T-cells within empty follicular fibrous tracts (stela) supports a diagnosis of AA. Copyright © 2015 American Academy of Dermatology, Inc. Published by Elsevier Inc. All rights reserved.
-
AA, closed orbit observation pickup
CERN PhotoLab
1980-01-01
Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles QFW, at maximum dispersion. See also 8001372, 8001383, 8010045
-
AA, closed orbit observation pickup
CERN PhotoLab
1980-01-01
Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles, QFW, at maximum dispersion. See also 8001372,8001383, 8010042
-
AA, closed orbit observation pickup
CERN PhotoLab
1980-01-01
Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. Werner Sax contemplates his achievement. See also 8001383, 8010042, 8010045.
-
AA, assembly of wide bending magnet
CERN PhotoLab
1980-01-01
The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.
-
Effect of pin tool design on the material flow of dissimilar AA7075-AA6061 friction stir welds
Hasan, Mohammed M.; Ishak, M.; Rejab, M. R. M.
2017-10-01
Tool design is the most influential aspect in the friction stir welding (FSW) technology. Influence of pin tool geometry on material flow pattern are studied in this work during the FSW of dissimilar AA7075 and AA6061 aluminium alloys. Three truncated pin tool profiles (threaded, threaded with single flat, and unthreaded with single flat) were used to prepare the weldments. The workpieces were joined using a custom-made clamping system under 1100 rpm of spindle speed, 300 mm/min of traverse rate and 3° of tilt angle. The metallographic analysis showed that defect-free welds can be produced using the three pin tools with significant changes in the mixing stir zone structure. The results declared that the introducing of the flat on the cone of the probe deviates the pattern of the onion rings without changing the chemical composition of the created layers. This in turn improves the hardness distribution and tensile strength of the welded joint. It was also noted that both heat affected zone (HAZ) and thermal-mechanical affected zone (TMAZ) are similar in composition to their corresponding base materials (BM).
-
NCBI nr-aa BLAST: CBRC-DYAK-08-0043 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-08-0043 ref|YP_026048.1| NADH dehydrogenase subunit 4 [Speleonectes tulum...ensis] gb|AAS00889.1| NADH dehydrogenase subunit 4 [Speleonectes tulumensis] YP_026048.1 0.41 37% ...
-
NCBI nr-aa BLAST: CBRC-DNOV-01-2150 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2150 ref|YP_073317.1| NADH dehydrogenase subunit 6 [Neomaskellia andro...pogonis] gb|AAS75443.1| NADH dehydrogenase subunit 6 [Neomaskellia andropogonis] YP_073317.1 0.86 27% ...
-
NCBI nr-aa BLAST: CBRC-BTAU-01-1417 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-1417 ref|YP_073322.1| NADH dehydrogenase subunit 2 [Neomaskellia andro...pogonis] gb|AAS75448.1| NADH dehydrogenase subunit 2 [Neomaskellia andropogonis] YP_073322.1 0.025 25% ...
-
NCBI nr-aa BLAST: CBRC-ETEL-01-1447 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-1447 ref|YP_026033.1| NADH dehydrogenase subunit 3 [Hutchinsoniella ma...cracantha] gb|AAS00874.1| NADH dehydrogenase subunit 3 [Hutchinsoniella macracantha] YP_026033.1 0.92 36% ...
-
Impact of as-cast structure on structure and properties of twin-roll cast AA8006 alloy
Energy Technology Data Exchange (ETDEWEB)
Slamova, M.; Ocenasek, V. [Vyzkumny Ustav Kovu, Panenske Brezany (Czechoslovakia); Juricek, Z.
2000-07-01
Sheet production by twin-roll casting (TRC) process is a well established practice in the aluminium industry because it offers several advantages in comparison with DC casting and hot rolling, esp. lower production and investment costs. Thin strips exhibiting a combination of good strength and high ductility are required for various applications and for this reason alloys with higher Fe and Mn content such as AA 8006 displace AA 1xxx or AA 8011 alloys. However, TRC of AA 8006 strips involves several problems, e.g. casting conditions and subsequent treatment procedures need fine tuning. The results of an investigation of the effect of casting conditions on structure and properties of AA 8006 strips are presented. The influence of casting speed, grain refiner addition, molten metal level in the tundish, tip setback and roll separating force was investigated. The impact of imperfect as-cast structure on structure and properties of thin strips in H22 and O tempers was evaluated and compared with strips from good as-cast material. (orig.)
-
Oppert, Brenda; Dowd, Scot E; Bouffard, Pascal; Li, Lewyn; Conesa, Ana; Lorenzen, Marcé D; Toutges, Michelle; Marshall, Jeremy; Huestis, Diana L; Fabrick, Jeff; Oppert, Cris; Jurat-Fuentes, Juan Luis
2012-01-01
Bacillus thuringiensis (Bt) crystal (Cry) proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence dataset for T. molitor
-
Directory of Open Access Journals (Sweden)
Brenda Oppert
Full Text Available Bacillus thuringiensis (Bt crystal (Cry proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence
-
ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GTGMKSFLEKLDEATKEFETQYKKWINDRREAIKKQRENEKLQKWNEISNIFKSDGVELNRDAQTPCIPEHLVEGFEESNESEDLSEIDQIEQVMLNPKGRLNFV* ... ch_oct10_gene_aa_db Chro.50191 >Chro.50191 hypothetical protein MSNSFLRDLKFVGVSSFL
-
NCBI nr-aa BLAST: CBRC-TTRU-01-0857 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0857 ref|YP_073322.1| NADH dehydrogenase subunit 2 [Neomaskellia andro...pogonis] gb|AAS75448.1| NADH dehydrogenase subunit 2 [Neomaskellia andropogonis] YP_073322.1 5e-04 23% ...
-
Bonner, Gloria; Williams, Sharon; Wilkie, Diana; Hart, Alysha; Burnett, Glenda; Peacock, Geraldine
2017-12-01
An initial and vital important step in recruiting participants for church-based hospice and palliative care research is the establishment of trust and credibility within the church community. Mistrust of medical research is an extremely important barrier hindering recruitment in African American (AA) communities. A church-based EOL dementia education project is currently being conducted at four large urban AA churches. Church leaders voiced mistrust concerns of previous researchers who conducted investigations in their faith-based institutions. We explored strategies to ameliorate the mistrust concerns. Specific aim: To identify trust-rebuilding elements for researchers following others who violated trust of AA church leaders. Face-to-face, in-depth interviews were conducted from a convenient sample of four established AA church leaders. Interviews were held in the informants' churches to promote candor and comfort in revealing sensitive information about trust /mistrust. Content analysis framework was used to analyze the data. Elements identified from the analysis were then used to create themes. Multidimensional overarching themes emerged from the analysis included: Experience with researchers (positive and extremely negative), violation of trust and trust building strategies. Findings suggest that researchers who wish to conduct successful studies in the AA religious institutions must implement trust rebuilding strategies that include mutual respect, collaboration and partnership building. If general moral practices continue to be violated, threat to future hospice and palliative care research within the institutions may prevail. Thus, potential benefits are thwarted for the church members, AA community, and advancement of EOL care scholarship.
-
Hot Deformation Behavior of Hot-Extruded AA7175 Through Hot Torsion Tests.
Lee, Se-Yeon; Jung, Taek-Kyun; Son, Hyeon-Woo; Kim, Sang-Wook; Son, Kwang-Tae; Choi, Ho-Joon; Oh, Sang-Ho; Lee, Ji-Woon; Hyun, Soong-Keun
2018-03-01
The hot deformation behavior of hot-extruded AA7175 was investigated with flow curves and processing maps through hot torsion tests. The flow curves and the deformed microstructures revealed that dynamic recrystallization (DRX) occurred in the hot-extruded AA7175 during hot working. The failure strain was highest at medium temperature. This was mainly influenced by the dynamic precipitation of fine rod-shaped MgZn2. The processing map determined the optimal deformation condition for the alloy during hot working.
-
Making ET AAS Determination Less Dependent on Vapourization ...
African Journals Online (AJOL)
NICO
The quantification of the analytes in ET AAS is normally attained by the measurement and integration of transient absorbance. High degree of atomization and constant vapour transportation rate for the analyte atoms in the absorption volume are considered to be crucial to grant correctness of the measurements. However ...
-
Overall view of the AA hall dominated by the 50 ton crane (Donges).
1980-01-01
A 50 ton, 32 metre span overhead travelling cranre was mounted in one of the bays of Hall 193 (AA). An identical crane was mounted on the other bay. See also photo 8004261. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
-
NCBI nr-aa BLAST: CBRC-XTRO-01-3068 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-3068 ref|NP_960250.1| AppC [Mycobacterium avium subsp. paratuberculosis... K-10] gb|AAS03633.1| AppC [Mycobacterium avium subsp. paratuberculosis K-10] NP_960250.1 2.1 28% ...
-
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over
-
Pengaruh Rapat Arus Anodizing terhadap Nilai Kekerasan pada Plat Aluminium Paduan Aa Seri 2024-t3
Fajar Nugroho
2015-01-01
Aluminum alloy AA 2024-T3 is widely applied in the aircraft industry because it has good mechanical properties such as; light weight, good conductivity and the corrosion resistance. However Aluminium 2024-T3 susceptible to wearing. One method to improve the wear resistance o f AA 2024-T3 is the anodizing process. The aims of this research to study the effect of current density and anodizing time against the hardness of aluminum alloy AA 2024-T3. The process of anodizing was carried out using ...
-
NCBI nr-aa BLAST: CBRC-CREM-01-1284 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1284 ref|NP_962383.1| SugI [Mycobacterium avium subsp. paratuberculosis... K-10] gb|AAS05999.1| SugI [Mycobacterium avium subsp. paratuberculosis K-10] NP_962383.1 2e-85 55% ...
-
NCBI nr-aa BLAST: CBRC-FCAT-01-0804 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FCAT-01-0804 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.8 24% ...
-
NCBI nr-aa BLAST: CBRC-DNOV-01-1349 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-1349 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.8 25% ...
-
NCBI nr-aa BLAST: CBRC-DNOV-01-2699 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2699 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 0.055 30% ...
-
NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-0782 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.9 26% ...
-
NCBI nr-aa BLAST: CBRC-MDOM-04-0135 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-04-0135 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 3e-04 28% ...
-
AA, inner conductor of a magnetic horn
CERN PhotoLab
1981-01-01
At the start-up of the AA and during its initial operation, magnetic horns focused the antiprotons emanating from the production target. These "current-sheet lenses" had a thin inner conductor (for minimum absorption of antiprotons), machined from aluminium to wall thicknesses of 0.7 or 1 mm. The half-sine pulses rose to 150 kA in 8 microsec. The angular acceptance was 50 mrad.
-
Wang, Z-C; Qi, J; Liu, L-M; Li, J; Xu, H-Y; Liang, B; Li, B
2017-03-01
Valsartan has been reported to have the function of treating hypertension and improving the prognosis of patients. Many studies indicated that valsartan can also increase angiotensin II, andosterone and plasma renin activity (PRA). Autoantibodies against the angiotensin II type 1 receptor (AT1-AA) have been showed to increase reactive oxygen species (ROS) and calcium (Ca2+) and result in apoptosis in vascular smooth muscle cells. In this study, we attempted to explore the effect of valsartan on AT1-AA-induced apoptosis in endothelial progenitor cells. Endothelial progenitor cells (EPCs) were cultured. The cytotoxicity was determined by MTT assay. EPCs apoptosis was determined by DAPI staining and flow cytometry. Reactive oxygen species, intracellular calcium concentration and calpain activity were measured using Fluostar Omega Spectrofluorimeter. The expression of p-ERK, p-eIF-2a, CHOP, Bcl-2 and caspase-3 were detected by Western blot. MTT assays showed valsartan significantly inhibited AT1-AA- induced decline of the viability of EPCs. DAPI staining and flow cytometry results indicated valsartan inhibited AT1-AA-induced decline of the viability of EPCs via inhibiting AT1-AA-induced apoptosis. Furthermore, the increasing of reactive oxygen species, intracellular calcium and calpain activity induced by AT1-AA in EPCs were also recovered after pre-treated with valsartan. Meanwhile, the upregulation of p-ERK, p-eIF-2a and CHOP, downregulation of Bcl-2, and activation of Caspase-3 caused by AT1-AA were reversed after pre-incubated with valsartan. Valsartan could inhibit AT1-AA-induced apoptosis through inhibiting oxidative stress mediated ER stress in EPCs.
-
Harris, Magdalena; Brathwaite, Rachel; Scott, Jenny; Gilchrist, Gail; Ciccarone, Dan; Hope, Vivian; McGowan, Catherine R
2018-04-26
Chronic skin and soft tissue infections (SSTI) among people who inject drugs (PWID) can lead to AA amyloidosis: a serious, yet neglected, multi-organ disease. We aim to synthesize findings on the epidemiology, risk factors, clinical outcomes, screening recommendations and challenges to treatment for AA amyloidosis among PWID. A systematic review was conducted in accordance with the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA). We searched the following bibliographic databases in July 2017: CINAHL Plus, Embase, Global Health, MEDLINE, PsycEXTRA, PsycINFO and SCOPUS. Studies were included if they investigated AA amyloidosis in PWID. Studies were not restricted to location, study type, year or language of publication. Study heterogeneity precluded meta-analysis; we present a narrative review of the literature. Thirty-seven papers from eight countries met inclusion criteria. A total of 781 PWID are reported on, of whom 177 had AA amyloidosis. Where disease causality is established, it is attributed to chronic inflammation caused by injecting-related SSTIs. Most (88.7%) PWID with AA amyloidosis had SSTIs. The proportion of PWID with AA amyloidosis at post-mortem ranged from 1.6% (Germany) to 22.5% (Serbia). Biopsy studies reported from 5.26% (Portugal) to 50% (Germany) of AA amyloidosis in PWID with suspected or known kidney disease. Following diagnosis, the typical trajectory for PWID with AA amyloidosis was rapid deterioration of renal function requiring haemodialysis. Treatment difficulties, end-stage renal failure and premature death from sepsis were observed. Good outcomes, including reversibility of AA amyloidosis, are attributed to rapid treatment of the underlining inflammation and injecting cessation. Notably, given the population in question, no studies were published in addiction or harm reduction journals; most (92%) appeared in specialist nephrology and medical journals. There is strong evidence of an association between skin
-
Directory of Open Access Journals (Sweden)
Hua Guo
Full Text Available Aquaporin 1 (AQP1 is a member of the transmembrane water channel family of proteins with special structural features, and two AQP1 paralogous genes (aqp1aa and aqp1ab are reported in teleosts. In the present study, the aqp1aa gene of half-smooth tongue sole (Cynoglossus semilaevis was cloned and characterized. The full-length cDNA of aqp1aa is 1411 bp with a 786 bp open reading frame encoding a 261-amino acid putative protein with a characteristic structure consisting of 6 membrane-spanning α-helical domains and two highly conserved asparagine-proline-alanine motifs. Real-time quantitative PCR revealed that aqp1aa mRNA is expressed predominantly in the testis of males and pseudo-males, while its expression is low in the ovary and lowest in doublesex and mab-3-related transcription factor 1(DMRT1 knock out fish and triploid males. In situ hybridization indicated that aqp1aa mRNA is expressed mainly in the germ cells of males and pseudo-males, especially in spermatozoa and spermatids. These results suggest that the aqp1aa may play a role in spermatogenesis of C. semilaevis.
-
Etanercept In the treatment of AA-amyloidosis in juvenile rheumatoid arthritis
Directory of Open Access Journals (Sweden)
H Mihels
2004-01-01
Full Text Available Objective. To study effect of etanercept, an antagonist of serum A amyloid production in the AA amyloidosis treatment in juvenile idiopathic arthritis (JIA. Material and methods. Etanercept was administered to all pts with AA amyloidosis admitted to Garmisch-Paterkirchen pediatric rheumatological clinic beginning with 2000. C-reactive protein (CRP, degree of proteinuria and serum creatinin were used as preliminary outcome measures. Results. 11 pts with seronegative JIA (6 boys and 5 girls were included in the study. Mean follow up duration was l,9±l.01 years. 8 children had systemic, 2 - olygoarticular and one - polyarticular disease onset. Before the study all pts had CRP level elevation (1,03-8,29 mg/dl, mean 4,53 mg/dl. 8 from 11 had marked proteinuria (364-7400 mg/24 hours, mean 1186 mg/24 hours. 2 from 11 had serum creatinin elevation. During etanercept treatment CRP level normalized in 2 and significantly decreased in 4 pts. Proteinuria decreased in 4 from 8 pts. Significant change of creatinin level was not achieved. One girl who did not have improvement during etanercept treatment showed CRP normalization and decrease of proteinuria when the drug was changed to infliximab. Conclusion. Treatment with etanercept provided improvement in almost 2/3 from 11 pts with JIA and AA amyloidosis. Etanercept may be the drug of choice in pts with normal creatinine level in the absence of proteinuria. When it fails another tumor necrosis factor antagonist such as infliximab should be used. It is necessary to extend volume and duration of the study to get more reliable data on etanercept efficacy in JIA pts with AA amyloidosis.
-
Directory of Open Access Journals (Sweden)
Jenkins Jeremy L
2001-10-01
Full Text Available Abstract Background To better understand the molecular interactions of Bt toxins with non-target insects, we have examined the real-time binding specificity and affinity of Cry1 toxins to native silkworm (Bombyx mori midgut receptors. Previous studies on B. mori receptors utilized brush border membrane vesicles or purifed receptors in blot-type assays. Results The Bombyx mori (silkworm aminopeptidase N (APN and cadherin-like receptors for Bacillus thuringiensis insecticidal Cry1Aa toxin were purified and their real-time binding affinities for Cry toxins were examined by surface plasmon resonance. Cry1Ab and Cry1Ac toxins did not bind to the immobilized native receptors, correlating with their low toxicities. Cry1Aa displayed moderate affinity for B. mori APN (75 nM, and unusually tight binding to the cadherin-like receptor (2.6 nM, which results from slow dissociation rates. The binding of a hybrid toxin (Aa/Aa/Ac was identical to Cry1Aa. Conclusions These results indicate domain II of Cry1Aa is essential for binding to native B. mori receptors and for toxicity. Moreover, the high-affinity binding of Cry1Aa to native cadherin-like receptor emphasizes the importance of this receptor class for Bt toxin research.
-
Jenkins, Jeremy L; Dean, Donald H
2001-01-01
Background To better understand the molecular interactions of Bt toxins with non-target insects, we have examined the real-time binding specificity and affinity of Cry1 toxins to native silkworm (Bombyx mori) midgut receptors. Previous studies on B. mori receptors utilized brush border membrane vesicles or purifed receptors in blot-type assays. Results The Bombyx mori (silkworm) aminopeptidase N (APN) and cadherin-like receptors for Bacillus thuringiensis insecticidal Cry1Aa toxin were purified and their real-time binding affinities for Cry toxins were examined by surface plasmon resonance. Cry1Ab and Cry1Ac toxins did not bind to the immobilized native receptors, correlating with their low toxicities. Cry1Aa displayed moderate affinity for B. mori APN (75 nM), and unusually tight binding to the cadherin-like receptor (2.6 nM), which results from slow dissociation rates. The binding of a hybrid toxin (Aa/Aa/Ac) was identical to Cry1Aa. Conclusions These results indicate domain II of Cry1Aa is essential for binding to native B. mori receptors and for toxicity. Moreover, the high-affinity binding of Cry1Aa to native cadherin-like receptor emphasizes the importance of this receptor class for Bt toxin research. PMID:11722800
-
Tei, Meina; Uchida, Kazuyuki; Chambers, James K; Watanabe, Ken-Ichi; Tamamoto, Takashi; Ohno, Koichi; Nakayama, Hiroyuki
2018-02-02
Amyloid A (AA) amyloidosis, a fatal systemic amyloid disease, occurs secondary to chronic inflammatory conditions in humans. Although persistently elevated serum amyloid A (SAA) levels are required for its pathogenesis, not all individuals with chronic inflammation necessarily develop AA amyloidosis. Furthermore, many diseases in cats are associated with the elevated production of SAA, whereas only a small number actually develop AA amyloidosis. We hypothesized that a genetic mutation in the SAA gene may strongly contribute to the pathogenesis of feline AA amyloidosis. In the present study, genomic DNA from four Japanese domestic cats (JDCs) with AA amyloidosis and from five without amyloidosis was analyzed using polymerase chain reaction (PCR) amplification and direct sequencing. We identified the novel variation combination of 45R-51A in the deduced amino acid sequences of four JDCs with amyloidosis and five without. However, there was no relationship between amino acid variations and the distribution of AA amyloid deposits, indicating that differences in SAA sequences do not contribute to the pathogenesis of AA amyloidosis. Immunohistochemical analysis using antisera against the three different parts of the feline SAA protein-i.e., the N-terminal, central, and C-terminal regions-revealed that feline AA contained the C-terminus, unlike human AA. These results indicate that the cleavage and degradation of the C-terminus are not essential for amyloid fibril formation in JDCs.
-
Directory of Open Access Journals (Sweden)
Yu Han
Full Text Available T2A-1 is a newly developed transgenic rice that expresses a synthesized cry2Aa gene driven by the maize ubiquitin promoter. T2A-1 exhibits high resistance against lepidopteran pests of rice. The brown planthopper, Nilapavarta lugens (Stål, is a main nontarget sap-sucking insect pest of rice, and Cyrtorhinus lividipennis (Reuter is the major predator of the eggs and young nymphs of planthoppers. As C. lividipennis may expose to the Cry2Aa protein via N. lugens, it is therefore essential to assess the potential effects of transgenic cry2Aa rice on this predator. In the present study, three experiments were conducted to evaluate the ecological risk of transgenic cry2Aa rice to C. lividipennis: (1 a direct feeding experiment in which C. lividipennis was fed an artificial diet containing Cry2Aa at the dose of 10-time higher than that it may encounter in the realistic field condition; (2 a tritrophic experiment in which the Cry2Aa protein was delivered to C. lividipennis indirectly through prey eggs or nymphs; (3 a realistic field experiment in which the population dynamics of C. lividipennis were investigated using vacuum-suction. Both direct exposure to elevated doses of the Cry2Aa protein and prey-mediated exposure to realistic doses of the protein did not result in significant detrimental effects on the development, survival, female ratio and body weight of C. lividipennis. No significant differences in population density and population dynamics were observed between C. lividipennis in transgenic cry2Aa and nontransgenic rice fields. It may be concluded that transgenic cry2Aa rice had no detrimental effects on C. lividipennis. This study represents the first report of an assessment continuum for the effects of transgenic cry2Aa rice on C. lividipennis.
-
Gorevic, P D; Rodrigues, M M; Krachmer, J H; Green, C; Fujihara, S; Glenner, G G
1984-08-15
Amyloid fibrils occurring in primary and myeloma-associated (AL), secondary (AA), and certain neuropathic hereditary forms of systemic amyloidosis can be distinguished biochemically or immunohistologically as being composed of immunoglobulin light chain, protein AA, or prealbumin respectively. All types of systemic and several localized forms of amyloidosis contain amyloid P component (protein AP). We studied formalin-fixed tissue from eight cases of lattice corneal dystrophy by the immunoperoxidase method using antisera to proteins AA and AP, to normal serum prealbumin and prealbumin isolated from a case of hereditary amyloidosis, and to light-chain determinants; additional cases were examined by indirect immunofluorescence of fresh-frozen material. We found weak (1:10 dilution) staining with anti-AP, but no reactivity with other antisera. Congo red staining was resistant to pretreatment of sections with potassium permanganate, a characteristic of non-AA amyloid. Two-dimensional gels of solubilized proteins from frozen tissue from two cases of lattice corneal dystrophy resembled those obtained from normal human cornea. Western blots of two cases of polymorphous amyloid degeneration and solubilized protein from normal cornea did not react with radioactive iodine-labeled anti-AA or anti-AP with purified protein AP and unfixed protein AA amyloid tissue as controls. We were unable to corroborate the presence of protein AA in the amyloid deposits of lattice corneal dystrophy. Although staining with antiserum to protein AP was demonstrable, the molecular configuration of this protein in stromal deposits remains to be defined.
-
International Nuclear Information System (INIS)
Kim, S. K.; Jo, C. J.; Kwon, B. H.; Hwang, W. S.
2000-01-01
The effects of artificial aging temperature and time were investigated on the pitting behaviors of SiCp/ AA2024 composites through measuring the changes of open circuit potential, pitting potential, and repassivation potential in a 3.5 wt% NaCl solution. And, the influence of microstructure on the pitting susceptibility was studied by measurement of TEM images. AA2024 Al alloy and 15vol%SiCp/ AA2024 composites were fabricated by vacuum hot pressing and hot extrusion with an extrusion ratio of 25 : 1. They were solutionized at 495 .deg. C for 4 hours, and aged at 130, 150, 170, and 190 .deg. C for 1, 2, 4, 8, and 16 hours. In aerated 3.5% NaCl solutions, the open circuit potential and pitting potential of both AA2024 alloy and composites were similar each other, and pitting occurred immediately at immersed condition. The pitting potential was decreased with increasing aging temperature and time. Also, the repassivation potential of SiCp/ AA2024 composites was decreased as increasing aging temperature and time. It was concluded that formation and growth of S' and S phase by artificial aging promoted the pitting susceptibility of SiCp/ AA2024 composites because these phases, easily soluble by forming galvanic couples with substrate Al alloy, served as preferential sites for nucleation of pits
-
Cold metal transfer spot plug welding of AA6061-T6-to-galvanized steel for automotive applications
International Nuclear Information System (INIS)
Cao, R.; Huang, Q.; Chen, J.H.; Wang, Pei-Chung
2014-01-01
Highlights: • Two Al-to-galvanized steel spot plug welding joints were studied by CMT method. • The optimum process variables for the two joints were gotten by orthogonal test. • Connection mechanism of the two joints were discussed. -- Abstract: In this study, cold metal transfer (CMT) spot plug joining of 1 mm thick Al AA6061-T6 to 1 mm thick galvanized steel (i.e., Q235) was studied. Welding variables were optimized for a plug weld in the center of a 25 mm overlap region with aluminum 4043 wire and 100% argon shielding gas. Microstructures and elemental distributions were characterized by scanning electron microscopy with energy dispersive X-ray spectrometer. Mechanical testing of CMT spot plug welded joints was conducted. It was found that it is feasible to join Al AA6061T6-to-galvanized steel by CMT spot plug welding method. The process variables for two joints with Al AA6061T6-to-galvanized mild steel and galvanized mild steel-to-Al AA6061T6 are optimized. The strength of CMT spot welded Al AA6061T6-to-galvanized mild steel is determined primarily by the strength and area of the brazed interface. While, the strength of the galvanized mild steel-to-Al AA6061T6 joint is mainly dependent upon the area of the weld metal
-
Harris, M; Brathwaite, R; McGowan, Catherine R; Ciccarone, D; Gilchrist, G; McCusker, M; O'Brien, K; Dunn, J; Scott, J; Hope, V
2018-05-08
Skin and soft tissue infections (SSTIs) are a leading cause of morbidity and mortality among people who inject drugs (PWID). International data indicate up to one third of PWID have experienced an SSTI within the past month. Complications include sepsis, endocarditis and amyloid A (AA) amyloidosis. AA amyloidosis is a serious sequela of chronic SSTI among PWID. Though there is a paucity of literature reporting on AA amyloidosis among PWID, what has been published suggests there is likely a causal relationship between AA amyloidosis and injecting-related SSTI. If left untreated, AA amyloidosis can lead to renal failure; premature mortality among diagnosed PWID is high. Early intervention may reverse disease. Despite the high societal and individual burden of SSTI among PWID, empirical evidence on the barriers and facilitators to injecting-related SSTI prevention and care or the feasibility and acceptability of AA amyloidosis screening and treatment referral are limited. This study aims to fill these gaps and assess the prevalence of AA amyloidosis among PWID. Care and Prevent is a UK National Institute for Health Research-funded mixed-methods study. In five phases (P1-P5), we aim to assess the evidence for AA amyloidosis among PWID (P1); assess the feasibility of AA amyloidosis screening, diagnostic and treatment referral among PWID in London (P2); investigate the barriers and facilitators to AA amyloidosis care (P3); explore SSTI protection and risk (P4); and co-create harm reduction resources with the affected community (P5). This paper describes the conceptual framework, methodological design and proposed analysis for the mixed-methods multi-phase study. We are implementing the Care and Prevent protocol in London. The systematic review component of the study has been completed and published. Care and Prevent will generate an estimate of AA amyloidosis prevalence among community recruited PWID in London, with implications for the development of screening
-
Liu, Shu-Min; Li, Jie; Zhu, Jin-Qi; Wang, Xiao-Wei; Wang, Cheng-Shu; Liu, Shu-Sheng; Chen, Xue-Xin; Li, Sheng
2016-04-01
The adoption of pest-resistant transgenic plants to reduce yield losses and decrease pesticide use has been successful. To achieve the goal of controlling both chewing and sucking pests in a given transgenic plant, we generated transgenic tobacco, Arabidopsis, and rice plants expressing the fusion protein, AaIT/GNA, in which an insecticidal scorpion venom neurotoxin (Androctonus australis toxin, AaIT) is fused to snowdrop lectin (Galanthus nivalis agglutinin, GNA). Compared with transgenic tobacco and Arabidopsis plants expressing AaIT or GNA, transgenic plants expressing AaIT/GNA exhibited increased resistance and toxicity to one chewing pest, the cotton bollworm, Helicoverpa armigera. Transgenic tobacco and rice plants expressing AaIT/GNA showed increased resistance and toxicity to two sucking pests, the whitefly, Bemisia tabaci, and the rice brown planthopper, Nilaparvata lugens, respectively. Moreover, in the field, transgenic rice plants expressing AaIT/GNA exhibited a significant improvement in grain yield when infested with N. lugens. This study shows that expressing the AaIT/GNA fusion protein in transgenic plants can be a useful approach for controlling pests, particularly sucking pests which are not susceptible to the toxin in Bt crops. © 2015 Institute of Zoology, Chinese Academy of Sciences.
-
A Multi-ringed, Modestly Inclined Protoplanetary Disk around AA Tau
Energy Technology Data Exchange (ETDEWEB)
Loomis, Ryan A.; Öberg, Karin I.; Andrews, Sean M.; MacGregor, Meredith A., E-mail: rloomis@cfa.harvard.edu [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States)
2017-05-01
AA Tau is the archetype for a class of stars with a peculiar periodic photometric variability thought to be related to a warped inner disk structure with a nearly edge-on viewing geometry. We present high resolution (∼0.″2) ALMA observations of the 0.87 and 1.3 mm dust continuum emission from the disk around AA Tau. These data reveal an evenly spaced three-ringed emission structure, with distinct peaks at 0.″34, 0.″66, and 0.″99, all viewed at a modest inclination of 59.°1 ± 0.°3 (decidedly not edge-on). In addition to this ringed substructure, we find non-axisymmetric features, including a “bridge” of emission that connects opposite sides of the innermost ring. We speculate on the nature of this “bridge” in light of accompanying observations of HCO{sup +} and {sup 13}CO ( J = 3–2) line emission. The HCO{sup +} emission is bright interior to the innermost dust ring, with a projected velocity field that appears rotated with respect to the resolved disk geometry, indicating the presence of a warp or inward radial flow. We suggest that the continuum bridge and HCO{sup +} line kinematics could originate from gap-crossing accretion streams, which may be responsible for the long-duration dimming of optical light from AA Tau.
-
A Multi-ringed, Modestly Inclined Protoplanetary Disk around AA Tau
International Nuclear Information System (INIS)
Loomis, Ryan A.; Öberg, Karin I.; Andrews, Sean M.; MacGregor, Meredith A.
2017-01-01
AA Tau is the archetype for a class of stars with a peculiar periodic photometric variability thought to be related to a warped inner disk structure with a nearly edge-on viewing geometry. We present high resolution (∼0.″2) ALMA observations of the 0.87 and 1.3 mm dust continuum emission from the disk around AA Tau. These data reveal an evenly spaced three-ringed emission structure, with distinct peaks at 0.″34, 0.″66, and 0.″99, all viewed at a modest inclination of 59.°1 ± 0.°3 (decidedly not edge-on). In addition to this ringed substructure, we find non-axisymmetric features, including a “bridge” of emission that connects opposite sides of the innermost ring. We speculate on the nature of this “bridge” in light of accompanying observations of HCO + and 13 CO ( J = 3–2) line emission. The HCO + emission is bright interior to the innermost dust ring, with a projected velocity field that appears rotated with respect to the resolved disk geometry, indicating the presence of a warp or inward radial flow. We suggest that the continuum bridge and HCO + line kinematics could originate from gap-crossing accretion streams, which may be responsible for the long-duration dimming of optical light from AA Tau.
-
Han, Bing; Wang, Tong-Dan; Shen, Shao-Ming; Yu, Yun; Mao, Chan; Yao, Zhu-Jun; Wang, Li-Shun
2015-03-18
Annonaceous acetogenins are a family of natural products with antitumor activities. Annonaceous acetogenin mimic AA005 reportedly inhibits mammalian mitochondrial NADH-ubiquinone reductase (Complex I) and induces gastric cancer cell death. However, the mechanisms underlying its cell-death-inducing activity are unclear. We used SW620 colorectal adenocarcinoma cells to study AA005 cytotoxic activity. Cell deaths were determined by Trypan blue assay and flow cytometry, and related proteins were characterized by western blot. Immunofluorescence and subcellular fractionation were used to evaluate AIF nuclear translocation. Reactive oxygen species were assessed by using redox-sensitive dye DCFDA. AA005 induces a unique type of cell death in colorectal adenocarcinoma cells, characterized by lack of caspase-3 activation or apoptotic body formation, sensitivity to poly (ADP-ribose) polymerase inhibitor Olaparib (AZD2281) but not pan-caspase inhibitor Z-VAD.fmk, and dependence on apoptosis-inducing factor (AIF). AA005 treatment also reduced expression of mitochondrial Complex I components, and leads to accumulation of intracellular reactive oxygen species (ROS) at the early stage. Blocking ROS formation significantly suppresses AA005-induced cell death in SW620 cells. Moreover, blocking activation of RIP-1 by necroptosis inhibitor necrotatin-1 inhibits AIF translocation and partially suppresses AA005-induced cell death in SW620 cells demonstrating that RIP-1 protein may be essential for cell death. AA005 may trigger the cell death via mediated by AIF through caspase-3 independent pathway. Our work provided new mechanisms for AA005-induced cancer cell death and novel clues for cancer treatment via AIF dependent cell death.
-
The Hidden Cost of Untreated Paragangliomas of the Head and Neck: Systemic Reactive (AA Amyloidosis
Directory of Open Access Journals (Sweden)
Erkan Dervisoglu
2015-01-01
Full Text Available We report a case of a 51-year-old man who was diagnosed with systemic reactive (AA amyloidosis in association with untreated glomus jugulare and glomus caroticum tumors. He refused radiotherapy and renal replacement therapy. Paragangliomas, although rare, should be considered one of the tumors that can result in AA amyloidosis.
-
Effect of precipitates on mechanical properties of AA2195
International Nuclear Information System (INIS)
Kim, Jae-Hee; Jeun, Jeong-Hoon; Chun, Hyun-Jin; Lee, Ye Rim; Yoo, Joon-Tae; Yoon, Jong-Hoon; Lee, Ho-Sung
2016-01-01
Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al_2Cu), ß′ (Al_3Zr), and T (Al_xLi_yCu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al_2Cu), ß′ (Al_3Zr), and T_1 (Al_2LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.
-
Effect of precipitates on mechanical properties of AA2195
Energy Technology Data Exchange (ETDEWEB)
Kim, Jae-Hee [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Jeun, Jeong-Hoon [Department of Materials Science and Engineering, Seoul National University, Seoul (Korea, Republic of); Chun, Hyun-Jin [Southeast University, Nanjing (China); Lee, Ye Rim [Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Yoo, Joon-Tae [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Yoon, Jong-Hoon [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Lee, Ho-Sung, E-mail: hslee@kari.re.kr [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of)
2016-06-05
Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T (Al{sub x}Li{sub y}Cu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T{sub 1} (Al{sub 2}LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.
-
The effect of welding parameters on surface quality of AA6351 aluminium alloy
International Nuclear Information System (INIS)
Yacob, S; Ariffin, N; Ali, R; Arshad, A; Wahab, M I A; Ismail, S A; Roji, NS M; Din, W B W; Zakaria, M H; Abdullah, A; Yusof, M I; Kamarulzaman, K Z; Mahyuddin, A; Hamzah, M N; Roslan, R; MAli, M A; Ahsan, Q
2015-01-01
In the present work, the effects of gas metal arc welding-cold metal transfer (GMAW-CMT) parameters on surface roughness are experimentally assessed. The purpose of this study is to develop a better understanding of the effects of welding speed, material thickness and contact tip to work distance on the surface roughness. Experiments are conducted using single pass gas metal arc welding-cold metal transfer (GMAW-CMT) welding technique to join the material. The material used in this experiment was AA6351 aluminum alloy with the thickness of 5mm and 6mm. A Mahr Marsuft XR 20 machine was used to measure the average roughness (Ra) of AA6351 joints. The main and interaction effect analysis was carried out to identify process parameters that affect the surface roughness. The results show that all the input process parameters affect the surface roughness of AA6351 joints. Additionally, the average roughness (Ra) results also show a decreasing trend with increased of welding speed. It is proven that gas metal arc welding-cold metal transfer (GMAW-CMT)welding process has been successful in term of providing weld joint of good surface quality for AA6351 based on the low value surface roughness condition obtained in this setup. The outcome of this experimental shall be valuable for future fabrication process in order to obtained high good quality weld. (paper)
-
The adhesion performance of epoxy coating on AA6063 treated in Ti/Zr/V based solution
Zhu, Wen; Li, Wenfang; Mu, Songlin; Yang, Yunyu; Zuo, Xi
2016-10-01
An environment-friendly titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating was prepared on aluminum alloy 6063 (AA6063). The epoxy powder coatings were applied on the AA6063 samples with/without Ti/Zr/V conversion coatings via electrostatic spraying. The morphology and composition of the conversion coating were studied by scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS), respectively. The surface free energy components of AA6063 samples were measured by a static contact angle measuring device with Owens method. The adhesion properties of the epoxy coating on AA6063 treated with different conversion times were evaluated using a pull-off tester. The Ti/Zr/V conversion coating was mainly composed of metal oxide (TiO2, ZrO2, V2O5, Al2O3, etc.), metal fluoride (ZrF4, AlF3, etc.) and metal organic complex. The formation time of this conversion coating was reduced to 50 s. After such surface treatment, the samples' surface roughness was increased and the contact angle with water was decreased. Both the surface free energy and the work of adhesion were increased. The adhesion strength between the epoxy coating and AA6063 was enhanced significantly.
-
Transient thermal analysis during friction stir welding between AA2014-T6 and pure copper
Gadhavi, A. R.; Ghetiya, N. D.; Patel, K. M.
2018-04-01
AA2xxx-Cu alloys showed larger applications in the defence sectors and in aerospace industries due to high strength to weight ratio and toughness. FSW in a butt joint configuration was carried out between AA2014-T6 and pure Copper placing AA2014 on AS and Cu on RS. Temperature profiles were observed by inserting K-type thermocouples in the mid-thickness at various locations of the plate. A sharp decrease in temperature profiles was observed on Copper side due to its higher thermal conductivity. A thermal numerical model was prepared in ANSYS to compare the simulated temperature profiles with the experimental temperature profiles and both the temperature profiles were found to be in good agreement.
-
Qualitative soil mineral analysis by EDXRF, XRD and AAS probes
International Nuclear Information System (INIS)
Singh, Virendra; Agrawal, H.M.
2012-01-01
Soil minerals study is vital in terms of investigating the major soil forming compounds and to find out the fate of minor and trace elements, essential for the soil–plant interaction purpose. X-ray diffraction (XRD) has been a popular technique to search out the phases for different types of samples. For the soil samples, however, employing XRD is not so straightforward due to many practical problems. In the current approach, principal component analysis (PCA) has been used to have an idea of the minerals present, in qualitative manner, in the soil under study. PCA was used on the elemental concentrations data of 17 elements, determined by the energy dispersive X-ray fluorescence (EDXRF) technique. XRD analysis of soil samples has been done also to identify the minerals of major elements. Some prior treatments, like removal of silica by polytetrafluoroethylene (PTFE) slurry and grinding with alcohol, were given to samples to overcome the peak overlapping problems and to attain fine particle size which is important to minimize micro-absorption corrections, to give reproducible peak intensities and to minimize preferred orientation. A 2θ step of 0.05°/min and a longer dwell time than normal were used to reduce interferences from background noise and to increase the counting statistics. Finally, the sequential extraction procedure for metal speciation study has been applied on soil samples. Atomic absorption spectroscopy (AAS) was used to find the concentrations of metal fractions bound to various forms. Applying all the three probes, the minerals in the soils can be studied and identified, successfully. - Highlights: ► Qualitative soil minerals analysis by EDXRF, AAS and XRD methods. ► There is a requirement of other means and methods due to inadequacy of XRD. ► Principal component analysis (PCA) provides an idea of minerals present in soil. ► Trace elements complexes can be determined by AAS probe. ► EDXRF, AAS and XRD, in combination, enable
-
Wilcox, Claire E; Pearson, Matthew R; Tonigan, J Scott
2015-06-01
Alcohol use disorder (AUD) is associated with depression. Although attendance at Alcoholics Anonymous (AA) meetings predicts reductions in drinking, results have been mixed about the salutary effects of AA on reducing depressive symptoms. In this single-group study, early AA affiliates (n = 253) were recruited, consented, and assessed at baseline, 3, 6, 9, 12, 18, and 24 months. Lagged growth models were used to investigate the predictive effect of AA attendance on depression, controlling for concurrent drinking and treatment attendance. Depression was measured using the Beck Depression Inventory (BDI) and was administered at baseline 3, 6, 12, 18, and 24 months. Additional predictors of depression tested included spiritual gains (Religious Background and Behavior questionnaire [RBB]) and completion of 12-step work (Alcoholics Anonymous Inventory [AAI]). Eighty-five percent of the original sample provided follow-up data at 24 months. Overall, depression decreased over the 24 month follow-up period. AA attendance predicted later reductions in depression (slope = -3.40, p = .01) even after controlling for concurrent drinking and formal treatment attendance. Finally, increased spiritual gains (RBB) also predicted later reductions in depression (slope = -0.10, p = .02) after controlling for concurrent drinking, treatment, and AA attendance. In summary, reductions in alcohol consumption partially explained decreases in depression in this sample of early AA affiliates, and other factors such as AA attendance and increased spiritual practices also accounted for reductions in depression beyond that explained by drinking. (PsycINFO Database Record (c) 2015 APA, all rights reserved).
-
Fabrication of AA6061-T6 Plate Type Fuel Assembly Using Electron Beam Welding Process
International Nuclear Information System (INIS)
Kim, Soosung; Seo, Kyoungseok; Lee, Donbae; Park, Jongman; Lee, Yoonsang; Lee, Chongtak
2014-01-01
AA6061-T6 aluminum alloy is easily welded by conventional GTAW (Gas Tungsten Arc Welding), LBW (Laser Beam Welding) and EBW. However, certain characteristics, such as solidification cracking, porosity, HAZ (Heat-affected Zone) degradation must be considered during welding. Because of high energy density and low heat input, especially LBW and EBW processes possess the advantage of minimizing the fusing zone and HAZ and producing deeper penetration than arc welding processes. In present study, to apply for the nuclear fuel plate fabrication and assembly, a fundamental EBW experiment using AA6061-T6 aluminum alloy specimens was conducted. Furthermore, to establish the welding process, and satisfy the requirements of the weld quality, EBW apparatus using an electron welding gun and vacuum chamber was developed, and preliminary investigations for optimizing the welding parameters of the specimens using AA6061-T6 aluminum plates were also performed. The EB weld quality of AA6061-T6 aluminum alloy for the fuel plate assembly has been also studied by the shrinkage measurement and weld inspection using computed tomography. This study was carried out to determine the suitable welding parameters and to evaluate tensile strength of AA6061-T6 aluminum alloy. In the present experiment, satisfactory electron beam welding process of the full-sized sample was being developed. Based on this fundamental study, fabrication of the plate-type fuel assembly will be provided for the future Ki-Jang research reactor project
-
DEFF Research Database (Denmark)
Schneider, Linda; Cammer, Michael; Lehman, Jonathan
2010-01-01
Cell motility and migration play pivotal roles in numerous physiological and pathophysiological processes including development and tissue repair. Cell migration is regulated through external stimuli such as platelet-derived growth factor-AA (PDGF-AA), a key regulator in directional cell migration....... Here we used micropipette analysis to show that a normal chemosensory response to PDGF-AA in fibroblasts requires the primary cilium. In vitro and in vivo wound healing assays revealed that in ORPK mouse (IFT88(Tg737Rpw)) fibroblasts, where ciliary assembly is defective, chemotaxis towards PDGF-AA...
-
Churg-Strauss syndrome associated with AA amyloidosis: a case ...
African Journals Online (AJOL)
Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/μL), positive ...
-
Contribution to comprehensive study of aluminium alloy Aa 5083 ...
African Journals Online (AJOL)
PROMOTING ACCESS TO AFRICAN RESEARCH ... Corrosion induced by elemental mercury in aqueous media of industrial Aluminium alloys AA5083 used in heat exchanger industries of natural gas liquefaction has been studied by linear sweep voltammétry on ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
-
AA, Inner Conductor of Magnetic Horn
CERN PhotoLab
1979-01-01
Antiprotons emerging at large angles from the production target (hit by an intense 26 GeV proton beam from the PS), were focused into the acceptance of the injection line of the AA by means of a "magnetic horn" (current-sheet lens). Here we see an early protype of the horn's inner conductor, machined from solid aluminium to a thickness of less than 1 mm. The 1st version had to withstand pulses of 150 kA, 15 us long, every 2.4 s. See 8801040 for a later version.
-
Effect of cryogenic cooling on corrosion of friction stir welded AA7010-T7651
DEFF Research Database (Denmark)
Jariyaboon, Manthana; Davenport, A. J.; Ambat, Rajan
2010-01-01
Purpose - The purpose of this paper is to study how cryogenic CO2 cooling during the welding process affects corrosion behaviour of friction stir welding (FSW) AA7010-T7651. Design/methodology/approach - Friction stir welded AA7010-17651 was produced with a rotation speed of 288 rpm and a travel...... speed of 58 mm/min. The liquid CO2 was sprayed onto the weld centre line immediately after the toolpiece. The microstructures of welds in different regions were observed using Field Emission Gun Scanning Electron Microscope (FEG-SEM). The effect on the corrosion susceptibility was investigated using...... a gel visualisation test and potentiodynamic polarisation measurements using a micro-electrochemical technique. Findings - The main corrosion region for both FSWs AA7010-T7651 produced with and without cryogenic CO2 cooling is in the HAZ region, which exhibited intergranular attack. Cryogenic cooling...
-
Corrosion Susceptibility of AA5083-H116 in Biologically Active Atmospheric Marine Environments
2014-03-01
Ahn, D. J. Quesnel, S. B. Jung, "Behavior of beta phase (A13Mg2) in AA 5083 during friction stir welding ," Intermetallics 35 (2013) p. 120-127. 4. R... Metallurgy and Materials Science 43A, 13 (2012) p. 4933-4939. 7. D. Mizuno, R. G. Kelly, "Galvanically Induced Intergranular Corrosion of AA5083-H131 Under...Behavior of Al-5083," Metallurgical and Materials Transactions a-Physical Metallurgy and Materials Science 42A, 2 (2011) p. 348-355. 13. R. L. Holtz, P
-
Slot-type pickup/kicker for AA stochastic cooling
CERN PhotoLab
1979-01-01
A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. See also 7906190, 7906193.
-
Detection of AA-type amyloid protein in labial salivary glands.
Sacsaquispe, Sonia-Julia; Antúnez-de Mayolo, Eleazar-Antonio; Vicetti, Rodolfo; Delgado, Wilson-Alejandro
2011-03-01
Among the diverse forms of amyloidosis, secondary type is the most frequent one. Diagnosis of amyloid deposition is based on the identification of the fibrillary protein amyloid by means of Congo Red (CR) or crystal violet (CV) stains, but these techniques do not differentiate between the different types of amyloid fibrils. The aim of this study was to identify by immunofluorescence (IF) AA amyloid a pathological fibrillar low-molecular-weight protein formed by cleavage of serum amyloid A (SAA) protein in labial salivary gland (LSG) biopsies from patients with secondary amyloidosis. 98 LSG were studied, 65 were from patients with secondary amyloidosis and 33 from subjects with chronic inflammatory diseases without evidence of this anomaly. All sections were stained with hematoxylin and eosin (H &E), CV, CR and IF using anti-AA antibodies. Positive and negative controls were used for all techniques. CV and CR demonstrated that the amyloid substance was found mainly distributed periductally (93.8%), followed by periacinar and perivascular locations (p <0.001); however, the IF demonstrated that amyloid AA substance predominates in the periacinar area (73.8%), followed by periductal and perivascular locations (p <0.001). IF has a sensitivity of 83%, 100% of specificity, 100% of predictive positive value and 75% of predictive negative value. The results of this study confirm the efficacy of the LSG biopsy as a highly reliable method for diagnosis of secondary amyloidosis.
-
Interdiffusion studies on hot rolled U-10Mo/AA1050
Energy Technology Data Exchange (ETDEWEB)
Saliba-Silva, A.M.; Martins, I.C.; Carvalho, E.U.; Durazzo, M.; Riella, H.G. [Instituto de Pesquisas Energeticas e Nucleares (CCN/IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Combustivel Nuclear], e-mail: saliba@ipen.br
2010-07-01
The U-Mo alloys are investigated with the goal of becoming nuclear material to fabricate high-density fuel elements for high performance research reactors. This enrichment level suggests that the U-Mo alloys should be between 6 to 10wt%, which can give up to 9gU/cm{sup 3} as fuel density. Nevertheless, the U-Mo alloys are very reactive with Al. Interdiffusion reaction products are formed since nuclear fission promotes chemical interaction layer during operation, leading to potential structural failure. Present studies were made with treated hot rolled diffusion couples of U-10Mo inserted in Al (AA1050). The U-10Mo/AA1050 pairs were treated in two temperature (150 degree C and 550 degree C) with three soaking times (5h, 40h and 80h). From microstructure analyses, rapid diffusion of Al happened inside U-10Mo in the first heating at 540 degree C during 15 min, reaching 8 at%Al in a range of 200 {mu}m towards U-10Mo. Longer time (5, 40, 80h) at 550 degree C maintain this level of Al-content up to 1000 {mu}m inside U-10Mo. A minor depth ({approx}1 {mu}m) near the interdiffusion contact had higher Al-content, but not sufficient to form identifiable (U,Mo)Al{sub x} structures. Probably, residual elements reduced drastically the interdiffusion phenomena between U-10Mo and AA1050, maybe due to silicon presence. (author)
-
Introducing the AAS Working Group on Astroinformatics and Astrostatistics
Ivezic, Zeljko
2014-01-01
In response to two White Papers submitted to the Astro2010 Decadal Survey (1,2), a new AAS Working Group on Astroinformatics and Astrostatistics (WGAA) has been approved by the AAS Council at the 220th Meeting, June 2012, in Anchorage. The motivation for this WG is the growing importance of the interface between astronomy and various branches of applied mathematics, computer science and the emerging field of data science. With the new data-intensive projects envisioned for the coming decade, the need for advice derived from the focused attention of a group of AAS members who work in these areas is bound to increase. The Working Group is charged with spreading awareness of rapidly advancing computational techniques, sophsticated statistical methods, and highly capble software to further the goals of astronomical and astrophysical research. The three main strategic goals adopted by the WGAA Steering Committee for the next few years are to: (i) develop, organize and maintain methodological resources (such as software tools, papers, books, and lectures); (ii) enhance human resources (such as foster the creation of career paths, establish a Speakers' Bureau, establish and maintain an archived discussion forum, enable periodic news distribution); and (iii) organize topical meetings. The WGAA Steering Committee at this time includes twelve members: Kirk Borne, George Djorgovski, Eric Feigelson, Eric Ford, Alyssa Goodman, Joe Hilbe, Zeljko Ivezic (chair), Ashish Mahabal, Aneta Siemiginowska, Alex Szalay, Rick White, and Padma Yanamandra-Fisher. I will summarize our accomplishments since July 2012. (1) Astroinformatics: A 21st Century Approach to Astronomy (Borne & 90 coauthors), (2) The Astronomical Information Sciences: A Keystone for 21st-Century Astronomy (Loredo & 72 coauthors)
-
Two distinct clinical courses of renal involvement in rheumatoid patients with AA amyloidosis.
Uda, Hiroshi; Yokota, Akira; Kobayashi, Kumiko; Miyake, Tadao; Fushimi, Hiroaki; Maeda, Akira; Saiki, Osamu
2006-08-01
We conducted a prospective study to investigate whether a correlation exists between the clinical course of renal involvement and the pathological findings of renal amyloidosis in patients with rheumatoid arthritis (RA). Patients with RA of more than 5 years' duration and who did not show renal manifestations were selected and received a duodenal biopsy for the diagnosis of amyloidosis. After the diagnosis of AA amyloidosis, patients received a renal biopsy, and patterns of amyloid deposition were examined. We followed the renal functions (serum levels of blood urea nitrogen and creatinine) of patients diagnosed with AA amyloidosis for 5 years. We diagnosed 53 patients with AA amyloidosis and monitored the renal function of 38 of them for > 5 years. The histological patterns were examined; in the 38 patients there were appreciable variations in the patterns of amyloid deposition. In 27 patients, amyloid deposits were found exclusively in the glomerulus (type 1). In the other 11 patients, however, amyloid deposits were found selectively around blood vessels and were totally absent in the glomerulus (type 2). In type 1 patients with glomerular involvement, renal function deteriorated rapidly regardless of disease state; most patients received hemodialysis. In type 2 patients with purely vascular involvement, however, renal function did not deteriorate significantly. In patients with RA and AA amyloidosis, 2 distinct clinical courses in terms of renal involvement were identified. It is suggested that renal function does not deteriorate when amyloid deposition is totally lacking in the glomerulus.
-
Albiti, Anisa H; Nsiah, Kwabena
2014-04-01
Sickle haemoglobin (HbS) is known to offer considerable protection against falciparum malaria. However, the mechanism of protection is not yet completely understood. In this study, we investigate how the presence of the sickle cell trait affects the haematological profile of AS persons with malaria, in comparison with similarly infected persons with HbAA. This study is based on the hypothesis that the sickle cell trait plays a protective role against malaria. Children from an endemic malaria transmission area in Yemen were enrolled in this study. Hematological parameters were estimated using manual methods, the percentage of parasite density on stained thin smear was calculated, haemoglobin genotypes were determined on paper electrophoresis, ferritin was measured using enzyme-linked immunosorbent assay, serum iron and TIBC were assayed using spectrophotometer, transferrin saturation index was calculated by dividing serum iron by TIBC and expressing the result as a percentage. Haematological parameters were compared in HbAA- and HbAS-infected children. Falciparum malaria parasitaemia was confirmed in the blood smears of 62 children, 44 (55.7%) of AA and 18 (37.5%) AS, so there was higher prevalence in HbAA children (P = 0.047). Parasite density was lower in HbAS- than HbAA-infected children (P = 0.003). Anaemia was prominent in malaria-infected children, with high proportions of moderate and severe forms in HbAA (P = 0.001). The mean levels of haemoglobin, packed cell volume, reticulocyte count, platelets count, lymphocytes, eosinophils, and serum iron were significantly lower while total leukocytes, immature granulocytes, monocytes, erythrocyte sedimentation rate, transferrin saturation, and serum ferritin were significantly higher in HbAA-infected children than HbAS-infected children. Infection with Plasmodium falciparum malaria caused more significant haematological alterations of HbAA children than HbAS. This study supports the observation that sickle cell trait
-
International Nuclear Information System (INIS)
Udinsky, J.R.; Frederick, C.B.
1990-01-01
Gavage dosing of rats with EA at high dose levels (100 or 200 mg/kg) has resulted in tumors at the dosing site, forestomach (FST), but no lesions of the glandular stomach (GST) or other remote tissues. Since previous in vitro studies have demonstrated that EA is very rapidly metabolized to AA and glutathione conjugates, EA and AA residues were analyzed 0-24 hr following gavage dosing of non-fasted F-344/N male rats with [1- 14 C]EA in corn oil at 10, 50, and 200 mg/kg. Analysis of total 14 C indicated that the dose solution was primarily in the FST at ≥5 min after dosing, although 14 C was detected in the GST, duodenum, and small intestine (attributed to distension of the FST and leakage from the FST to the GST). HPLC analysis of the gut contents, gut wall, liver, kidneys, lungs, and blood indicated that EA and AA could only be detected at ≥15 min in the FST and GST contents, and in the FST tissue. AA alone was detected in the GST tissue, duodenum tissue and contents, and small intestine tissue and contents. The minimum level of detection was 0.0005% of the dose. The remaining 14 C was primarily attributed to binding to the gut contents or bioincorporation of AA. The detection of EA and AA residues only in the upper gastrointestinal tract following gavage dosing is consistent with rapid detoxification of EA by hydrolysis and conjugation which prevents toxicity at sites remote form the site of dosing
-
NCBI nr-aa BLAST: CBRC-MDOM-08-0245 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-08-0245 ref|YP_045158.1| putative fimbrial usher protein [Acinetobacter s...p. ADP1] gb|AAS90700.1| AcuC [Acinetobacter sp. BD413] emb|CAG67336.1| protein AcuC; putative fimbrial usher protein [Acinetobacter sp. ADP1] YP_045158.1 0.47 32% ...
-
NCBI nr-aa BLAST: CBRC-TBEL-01-0397 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TBEL-01-0397 ref|YP_005572.1| competence factor comEC [Thermus thermophilus HB...27] gb|AAG34707.1|AF319938_2 competence factor ComEC [Thermus thermophilus] gb|AAS81945.1| competence factor comEC [Thermus thermophilus HB27] YP_005572.1 0.10 31% ...
-
Work capacity and anticipation in A.A. Ukhtomsky's concept of dominance
Pavlova, L. P.
2015-08-01
This paper presents the results of theoretical and experimental investigations of human activity and anticipation based on A.A. Ukhtomsky's concept of brain dominance - a non-equilibrium system-forming factor in living systems. Facts on the stages of dominance formation are presented in relation to the creative abilities of the human brain and the role of fatigue as a "lever" for increasing systems' work capacity on the basis of "trace exaltation". Individually, specific features of dominantogenesis are compared with variations in behavioural types. On the basis of chronotopic EEG analysis, we delineate cortical dominants that underlie individual specifics of cognitive processes. The relation is shown between anticipation and the "expansion of dominants" - the broadening of "distal perception" in time and space, as framed by A.A. Ukhtomsky.
-
Volta potential of clad AA2024 aluminium after exposure to CeCl3 solution
International Nuclear Information System (INIS)
Andreatta, F.; Druart, M.-E.; Marin, E.; Cossement, D.; Olivier, M.-G.; Fedrizzi, L.
2014-01-01
Highlights: • Alkaline etch of clad AA2024 enhances precipitation of Ce compounds. • Exposure to CeCl 3 solution decreases Volta potential of alkaline etched substrate. • Ce compounds reduce the driving force for initiation of localized attack. - Abstract: AA2024 clad with AA1050 was immersed in CeCl 3 solution to promote deposition of cerium species. The deposition occurs on the entire sample surface for the alkaline etched substrate, while it is very limited for the degreased substrate. The surface potential (Volta potential) was investigated by scanning Kelvin probe force microscopy after different immersion times in CeCl 3 solution. The preferential deposition of Ce compounds at Al–Fe intermetallic sites progressively reduces their Volta potential difference relative to the matrix in the alkaline etched substrate. This reduces the susceptibility to localized attack of the intermetallics as proven by potentiodynamic polarization measurements
-
A.A. BRUSILOV - FULL GENERAL OF RUSSIAN ARMY AND LAST COMMANDER OF RUSSIAN TSAR
Directory of Open Access Journals (Sweden)
Сергей Сергеевич Синютин
2014-12-01
Full Text Available The article analyzes the biography of Russian full general A.A. Brusilov − the hero of World War I, whose name is associated with the term “Brusilov Offensive”. The author exa-mines his views on the new situation which developed in Russia during the two revolutions of 1917, and then in the Soviet period. The author highly appreciates the theoretical preparation level of A.A. Brusilov, who got full military education in tsarist Russia; reveals the pre-sence of numerous analogous episodes in the biographies of A.A. Brusilov and A.V. Suvorov. He focuses on the similar origin of two Russian heroes, whose families belonged to the military dynasties of imperial Russia. The author concludes that the continuity of generations is very important in the issue of effective army’s functioning. This tradition was preserved in the new Soviet state.
-
Sun, Yunjun; Zhao, Qiang; Zheng, Dasheng; Ding, Xuezhi; Wang, Jingfang; Hu, Quanfang; Yuan, Zhiming; Park, Hyun-Woo; Xia, Liqiu
2014-01-01
Three structural domains of mosquitocidal Cry11Aa and Cry11Ba from Bacillus thuringiensis were exchanged to produce interdomain chimeras [BAA (11Ba/11Aa/11Aa), ABA (11Aa/11Ba/11Aa), AAB (11Aa/11Aa/11Ba), ABB (11Aa/11Ba/11Ba), BAB (11Ba/11Aa/11Ba), BBA (11Ba/11Ba/11Aa]. Chimeras BAB, BAA, BBA, and AAB formed inclusion bodies in the crystal-negative B. thuringiensis host and produced expected protein bands on SDS-PAGE gel. However, no inclusion body or target protein could be found for chimeras ABA and ABB. In bioassays using the fourth-instar larvae of Culex quinquefasciatus and Aedes aegypti, AAB had ~50 % lethal concentrations of 4.8 and 2.2 μg ml(-1), respectively; however, the rest of chimeras were not toxic. This study thus helps to understand the domain-function relationships of the Cry11Aa and Cry11Ba toxins. The toxic chimera, AAB, might be a candidate for mosquito control as its amino acid sequence is different from the two parental toxins.
-
Transgenic cotton expressing Cry10Aa toxin confers high resistance to the cotton boll weevil.
Ribeiro, Thuanne Pires; Arraes, Fabricio Barbosa Monteiro; Lourenço-Tessutti, Isabela Tristan; Silva, Marilia Santos; Lisei-de-Sá, Maria Eugênia; Lucena, Wagner Alexandre; Macedo, Leonardo Lima Pepino; Lima, Janaina Nascimento; Santos Amorim, Regina Maria; Artico, Sinara; Alves-Ferreira, Márcio; Mattar Silva, Maria Cristina; Grossi-de-Sa, Maria Fatima
2017-08-01
Genetically modified (GM) cotton plants that effectively control cotton boll weevil (CBW), which is the most destructive cotton insect pest in South America, are reported here for the first time. This work presents the successful development of a new GM cotton with high resistance to CBW conferred by Cry10Aa toxin, a protein encoded by entomopathogenic Bacillus thuringiensis (Bt) gene. The plant transformation vector harbouring cry10Aa gene driven by the cotton ubiquitination-related promoter uceA1.7 was introduced into a Brazilian cotton cultivar by biolistic transformation. Quantitative PCR (qPCR) assays revealed high transcription levels of cry10Aa in both T 0 GM cotton leaf and flower bud tissues. Southern blot and qPCR-based 2 -ΔΔCt analyses revealed that T 0 GM plants had either one or two transgene copies. Quantitative and qualitative analyses of Cry10Aa protein expression showed variable protein expression levels in both flower buds and leaves tissues of T 0 GM cotton plants, ranging from approximately 3.0 to 14.0 μg g -1 fresh tissue. CBW susceptibility bioassays, performed by feeding adults and larvae with T 0 GM cotton leaves and flower buds, respectively, demonstrated a significant entomotoxic effect and a high level of CBW mortality (up to 100%). Molecular analysis revealed that transgene stability and entomotoxic effect to CBW were maintained in T 1 generation as the Cry10Aa toxin expression levels remained high in both tissues, ranging from 4.05 to 19.57 μg g -1 fresh tissue, and the CBW mortality rate remained around 100%. In conclusion, these Cry10Aa GM cotton plants represent a great advance in the control of the devastating CBW insect pest and can substantially impact cotton agribusiness. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
-
Microstructural evolution and mechanical properties of as-cast and T6-treated AA2195 DC cast alloy
International Nuclear Information System (INIS)
Hekmat-Ardakan, A.; Elgallad, E.M.; Ajersch, F.; Chen, X.-G.
2012-01-01
The use of direct chill (DC) cast ingot plates of AA2195 alloys has been recently extended for large mold applications in the plastics and automotive industries. The microstructural evolution of the as-cast AA2195 alloy was investigated using the Factsage thermodynamic software under both equilibrium and non-equilibrium conditions, and was compared with the results from differential scanning calorimetry (DSC) analysis and microstructural observations. The as-cast microstructure exhibited the presence of Al 2 CuMg, Al 2 Cu and Al 2 CuLi intermetallic phases formed at the aluminum dendrite boundaries, which can be completely dissolved in the α-Al matrix during the solution treatment. A significant improvement in the mechanical properties of the AA2195 cast alloy after the T6 heat treatment is attributed to the formation of nano-scale θ′ (Al 2 Cu) and T1 (Al 2 CuLi) precipitates. However, the non-uniform distribution of T1 precipitates together with the large size and low density indicate that the role of θ′ precipitates in strengthening the AA2195 cast alloy is more dominant than that of the T1 precipitates, in contrast with the strengthening mechanism of the pre-deformed AA2195-T8 rolled products.
-
The AAS Taskforce on Diversity and Inclusion in Graduate Education: a Proposed White Paper
Rudolph, Alexander L.
2018-06-01
At the January 2017 AAS meeting in Texas, the AAS Council approved the creation of a Graduate Education Taskforce focusing on Diversity and Inclusion. This task force is conducting a review of practices in recruiting, admissions, and retention in PhD programs in astronomy (including astronomy programs in departments of physics and astronomy). It is also engaging the broader astronomical community and selected outside experts in diversity in STEM in a discussion of best practices in these activities, with the goal of promoting diversity (race/ethnicity, gender, LGBTQ+, disability status, etc.) and inclusion in astronomy PhD programs. Building on the Nashville Recommendations from the Inclusive Astronomy 2015 meeting, the task force is developing a set of specific recommendations with the aim of endorsement by the AAS, in parallel with a campaign to get them adopted by astronomy departments. Finally, the task force will suggest and push adoption of a set of permanent measurements to be collected by the AAS to track progress on these goals. There is a separate special session at this meeting intended to report on the task force’s progress and to solicit community input on its draft recommendations to date.This presentation will give a brief overview of the task force's charge and activities and their plans to turn their final report into a White Paper for the Decadal Survey.
-
Studies of the AA2519 Alloy Hot Rolling Process and Cladding with EN AW-1050A Alloy
Directory of Open Access Journals (Sweden)
Płonka B.
2016-03-01
Full Text Available The objective of the study was to determine the feasibility of plastic forming by hot rolling of the AA2519 aluminium alloy sheets and cladding these sheets with a layer of the EN AW-1050A alloy. Numerous hot-rolling tests were carried out on the slab ingots to define the parameters of the AA2519 alloy rolling process. It has been established that rolling of the AA2519 alloy should be carried out in the temperature range of 400-440°C. Depending on the required final thickness of the sheet metal, appropriate thickness of the EN AW-1050A alloy sheet, used as a cladding layer, was selected. As a next step, structure and mechanical properties of the resulting AA2519 alloy sheets clad with EN AW-1050A alloy was examined. The thickness of the coating layer was established at 0,3÷0,5mm. Studies covered alloy grain size and the core alloy-cladding material bond strength.
-
Directory of Open Access Journals (Sweden)
Eric Murillo-Rodríguez
2017-05-01
Full Text Available The endocannabinoid system comprises several molecular entities such as endogenous ligands [anandamide (AEA and 2-arachidonoylglycerol (2-AG], receptors (CB1 and CB2, enzymes such as [fatty acid amide hydrolase (FAHH and monoacylglycerol lipase (MAGL], as well as the anandamide membrane transporter. Although the role of this complex neurobiological system in the sleep–wake cycle modulation has been studied, the contribution of the blocker of FAAH/transient receptor potential cation channel subfamily V member 1 (TRPV1, N-arachidonoyl-serotonin (AA-5-HT in sleep has not been investigated. Thus, in the present study, varying doses of AA-5-HT (5, 10, or 20 mg/Kg, i.p. injected at the beginning of the lights-on period of rats, caused no statistical changes in sleep patterns. However, similar pharmacological treatment given to animals at the beginning of the dark period decreased wakefulness (W and increased slow wave sleep (SWS as well as rapid eye movement sleep (REMS. Power spectra analysis of states of vigilance showed that injection of AA-5-HT during the lights-off period diminished alpha spectrum across alertness in a dose-dependent fashion. In opposition, delta power spectra was enhanced as well as theta spectrum, during SWS and REMS, respectively. Moreover, the highest dose of AA-5-HT decreased wake-related contents of neurotransmitters such as dopamine (DA, norepinephrine (NE, epinephrine (EP, serotonin (5-HT whereas the levels of adenosine (AD were enhanced. In addition, the sleep-inducing properties of AA-5-HT were confirmed since this compound blocked the increase in W caused by stimulants such as cannabidiol (CBD or modafinil (MOD during the lights-on period. Additionally, administration of AA-5-HT also prevented the enhancement in contents of DA, NE, EP, 5-HT and AD after CBD of MOD injection. Lastly, the role of AA-5-HT in sleep homeostasis was tested in animals that received either CBD or MOD after total sleep deprivation (TSD. The
-
Three body abrasion of laser surface alloyed aluminium AA1200
CSIR Research Space (South Africa)
Mabhali, Luyolo AB
2012-06-01
Full Text Available Laser surface alloying of aluminium AA1200 was performed with a 4 kW Nd:YAG laser to improve the abrasion wear resistance. Aluminium surfaces reinforced with metal matrix composites and intermetallic phases were achieved. The phases present depended...
-
Pinezich, Meghan R; Russell, Lauren N; Murphy, Nicholas P; Lampe, Kyle J
2018-04-16
Biomaterial drug delivery systems (DDS) can be used to regulate growth factor release and combat the limited intrinsic regeneration capabilities of central nervous system (CNS) tissue following injury and disease. Of particular interest are systems that aid in oligodendrocyte regeneration, as oligodendrocytes generate myelin which surrounds neuronal axons and helps transmit signals throughout the CNS. Oligodendrocyte precursor cells (OPCs) are found in small numbers in the adult CNS, but are unable to effectively differentiate following CNS injury. Delivery of signaling molecules can initiate a favorable OPC response, such as proliferation or differentiation. Here, we investigate the delivery of one such molecule, platelet derived growth factor-AA (PDGF-AA), from poly(lactic-co-glycolic) acid microparticles to OPCs in a 3D polyethylene glycol-based hydrogel. The goal of this DDS was to better understand the relationship between PDGF-AA release kinetics and OPC fate. The system approximates native brain tissue stiffness, while incorporating PDGF-AA under seven different delivery scenarios. Within this DDS, supply of PDGF-AA followed by PDGF-AA withdrawal caused OPCs to upregulate gene expression of myelin basic protein (MBP) by factors of 1.6-9.2, whereas continuous supply of PDGF-AA caused OPCs to remain proliferative. At the protein expression level, we observed an upregulation in O1, a marker for mature oligodendrocytes. Together, these results show that burst release followed by withdrawal of PDGF-AA from a hydrogel DDS stimulates survival, proliferation, and differentiation of OPCs in vitro. Our results could inform the development of improved neural regeneration strategies that incorporate delivery of PDGF-AA to the injured CNS. © 2018 Wiley Periodicals, Inc. J Biomed Mater Res Part A, 2018. © 2018 Wiley Periodicals, Inc.
-
DE Lara, Ana Paula DE Souza Stori; Lorenzon, Lucas Bigolin; Vianna, Ana Muñoz; Santos, Francisco Denis Souza; Pinto, Luciano Silva; Aires Berne, Maria Elisabeth; Leite, Fábio Pereira Leivas
2016-10-01
Effective control of gastrointestinal parasites is necessary in sheep production. The development of anthelmintics resistance is causing the available chemically based anthelmintics to become less effective. Biological control strategies present an alternative to this problem. In the current study, we tested the larvicidal effects of Bacillus thuringiensis var. israelensis Cry11Aa toxin against Haemonchus contortus larvae. Bacterial suspensions [2 × 108 colony-forming units (CFU) g-1 of the feces] of B. thuringiensis var. israelensis and recombinant Escherichia coli expressing Cry11Aa toxin were added to naturally H. contortus egg-contaminated feces. The larvae were quantified, and significant reductions of 62 and 81% (P var. israelensis and recombinant E. coli expressing Cry11Aa toxin were then orally administered to lambs naturally infected with H. contortus. Twelve hours after administration, feces were collected and submitted to coprocultures. Significant larvae reductions (P var. israelensis is a promising new class of biological anthelmintics for treating sheep against H. contortus.
-
The influence of strain on annealing behaviour of heavily rolled aluminium AA1050
DEFF Research Database (Denmark)
Mishin, Oleg; Juul Jensen, Dorte; Hansen, Niels
2012-01-01
Deformation structures and annealing behaviour have been analysed in the centre layer of two AA1050 samples cold-rolled to von Mises strains of 3.6 and 6.4. During annealing at 270-300°C structural coarsening and discontinuous recrystallization occurred in both samples. In the coarsened microstru......Deformation structures and annealing behaviour have been analysed in the centre layer of two AA1050 samples cold-rolled to von Mises strains of 3.6 and 6.4. During annealing at 270-300°C structural coarsening and discontinuous recrystallization occurred in both samples. In the coarsened...
-
Slot-type pickup/kicker for AA stochastic cooling
1979-01-01
A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning, in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. View down the centre of a pickup or kicker. See also 7906189, 7906190, 7906583.
-
Directory of Open Access Journals (Sweden)
L.S.A. Camargo
2009-02-01
Full Text Available Avaliou-se o efeito do citrato em meio CR2aa suplementado com soro fetal bovino (SFB ou livre de proteínas séricas e sua associação com taurina no desenvolvimento de embriões bovinos fecundados in vitro. Embriões foram cultivados em CR2aa contendo 0, 0,5, 1,0 e 3,0mM citrato, suplementado com 10% SFB (experimento 1 ou com álcool polivinil (PVA; experimento 2. No terceiro experimento, embriões foram cultivados em meio com 0,5mM citrato, ou 7mM taurina, ou com a associação de ambos, suplementado com SFB. Os cultivos foram realizados com células do cumulus em ambiente a 38,8ºC com 5% de CO2 em ar atmosférico. Melhora no desenvolvimento embrionário foi observado no cultivo de embriões em CR2aa com 0,5 e 1,0mM citrato na ausência de SFB (P0,05 a produção de embriões ou o número de células. Citrato em meio CR2aa pode ser uma alternativa para cultivo embrionário em condições atmosféricas com 5% de CO2 em ar na ausência de proteína sérica.The effect of citrate added to CR2aa medium supplemented with fetal calf serum (FCS or serum-proteinfree and its association with taurine on the development of in vitro-fertilized bovine embryos was evaluated. Embryos were cultured with 0, 0.5, 1.0, and 3.0mM citrate, in CR2aa supplemented with 10% FCS (experiment 1, or polyvinyl alcohol (PVA; experiment 2. In experiment 3, embryos were cultured with 0.5mM citrate, 7.0mM taurine or with association of both, in medium supplemented with FCS. Embryo culture was performed with cumulus cells at 38.8ºC in 5% CO2 under air for all experiments. Positive effect on embryo development was only observed with 0.5 and 1.0mM citrate in FCS-free CR2aa (P0.05 embryo rate nor total cell number. Citrate in CR2aa medium can be an alternative for serumfree embryo culture under 5% CO2 in air, absence of serum protein.
-
International Nuclear Information System (INIS)
Wong, P.Y.K.; Spur, B.; Hirai, A.; Yoshida, S.; Tamura, Y.; Lam, B.K.
1986-01-01
Lipoxins and lipoxenes have been reported to be formed after incubation of 15-hydroperoxyeicosatetraenoic acid and 15-hydroperoxyeicosapentaenoic acid with human leukocytes and porcine leukocytes, respectively. The authors examined the ability of porcine leukocytes to metabolize [ 14 C]-AA and [ 14 C]-EPA (100 μM) to lipoxins and lipoxenes. Incubation products were separated by RP-HPLC and identified by U.V. spectrum and GC/MS. Porcine leukocytes metabolized both AA and EPA to form lipoxins and lipoxenes in addition to mono- and di-hydroxyl fatty acids. Quantitative analysis from U.V. absorbance after RP-HPLC revealed that about 0.05% of AA was converted to lipoxins A and B and 0.1% of EPA was converted to lipoxenes A and B. In addition, treatment of leukotriene A 4 and leukotriene A 5 with 15-lipoxygenase also gave rise to several isomers of lipoxin and lipoxene. Thus, lipoxins and lipoxenes would have been derived from AA and EPA after dioxygenation by 5-lipoxygenase and 15-lipoxygenase, respectively. When tested for biological activity, lipoxene A (2 μM), like lipoxin A, induced superoxide anion generation in canine neutrophils but had no effect on lysosomal enzyme release on neutrophil aggregation
-
Ultrasonic evaluation of friction stud welded AA 6063/AISI 1030 steel joints
International Nuclear Information System (INIS)
Hynes, N. Rajesh Jesudoss; Nagaraj, P.; Sujana, J. Angela Jennifa
2014-01-01
Highlights: • Friction stud welding of AA 6063 and AISI 1030 was done successfully. • Ultrasonic evaluation of interfacial properties. • EDX analysis confirms intermetallic compound (FeAl) in the interfacial region. - Abstract: Friction stud welding is a promising technique in many applications related to oil and gas industries. It is used to attach grating to offshore oil platforms in areas where arc welding is not permitted because of the risk of causing a fire or explosion. Attachment of anodes inside seawater discharge pipelines in a gas processing plant is performed by this process. This solid state joining process permits metal combinations such as welding of aluminum studs to steel which would be problematic with arc welding because of the formation of thick and brittle inter-metallic compounds. In the present work, AA 6063 is joined to AISI 1030 steel using friction stud welding machine. Properties that are of interest to manufacturing applications such as Young’s modulus, longitudinal velocity, bulk modulus and shear modulus are evaluated by means of an ultrasonic flaw detector. At the interface of the joint, there is an increase of 4.4%, 1.8%, 1.15% and 4.42% is observed for the properties Young’s modulus, longitudinal velocity, bulk modulus and shear modulus respectively. This is due to the formation of intermetallic compound and increase in hardness at the interfacial region. Energy Dispersive X-ray analysis confirms the presence of FeAl as the intermetallic compound. Scanning Electron Microscope evaluation shows the presence of an unbound zone at the center of the inner region which is due to the minimum rotational speed and low axial load experienced at that point. In the unbound zone, there is an incomplete bond between dissimilar metals and it is detrimental to joint strength. Optimum value of friction time and usage of pure aluminum interlayer during the friction stud welding process hinders the formation of unbound zone and enhances the
-
Kohler, Susanna
2016-06-01
Editors Note: Lastweek we were at the 228th AAS Meeting in San Diego, CA. Here is a final post aboutselectedevents on the last day of the meeting, written by authors fromastrobites.com, a grad-student collaborative project with which we recently announced a new partnership! Starting in July,keep an eye out for astrobites postsat AAS Nova in between Highlights(i.e., on Tuesdays and Thursdays).Were excited to be working together to bring you more recent astronomy research from AAS journals!Extrasolar Planets: Detection (by Leonardo dos Santos)Thursdays first session on exoplanets was about detecting these distant worlds, and the opening talk was given by Robert Siverd (Las Cumbres Observatory). He describes the NRES, a network of spectrographs that will look for exoplanets using the radial velocity method. One of the coolest aspects of this instrument is that it will feature an on the fly scheduling system that will perform observations as efficiently as possible. The spectrograph is still being tested, but a unit will be deployed at CTIO later this year.@lcogt contracted by @NASA_TESS for follow up of their candidates. #aas228 Jessie Christiansen (@aussiastronomer) June 16, 2016Measuring the depths of transits and eclipses in Spitzer has been problematic in the past, since the Spitzer instrument IRAC (InfraRed Array Camera) has a non-uniform response in its detectors pixels. But, as reported by James Ingalls (Spitzer Science Center, Caltech), observers are circumventing this issue by using what they call the staring mode (avoiding large pointing jumps) and an algorithm to pick sweet spot pixels. Moreover, the results from the IRAC Data Challenge are helping to better understand its behavior. Giuseppe Morello (University College London), on the other hand, explained how his research group gets rid of instrumental effects from IRAC using machine learning. This method removes systematics from exoplanet transit data no matter if the noise source is from an instrument or
-
Bumiller, Elissa
The US Navy currently uses AA5xxx aluminum alloys for structures exposed to a marine environment. These alloys demonstrate excellent corrosion resistance over other aluminum alloys (e.g., AA2xxx or AA7xxx) in this environment, filling a niche in the marine structures market when requiring a light-weight alternative to steel. However, these alloys are susceptible to localized corrosion; more specifically, intergranular corrosion (IGC) is of concern. IGC of AA5xxx alloys due to the precipitation of beta phase on the grain boundaries is a well-established phenomenon referred to as sensitization. At high degrees of sensitization, the IGC path is a continuous anodic path of beta phase particles. At lower degrees of sensitization, the beta phase coverage at the grain boundaries is not continuous. The traditional ranges of susceptibility to IGC as defined by ASTM B928 are in question due to recent studies. These studies showed that even at mid range degrees of sensitization where the beta phase is no longer continuous, IGC may still occur. Previous thoughts on IGC of these alloy systems were founded on the idea that once the grain boundary precipitate became discontinuous the susceptibility to IGC was greatly reduced. Additionally, IGC susceptibility has been defined metallurgically by compositional gradients at the grain boundaries. However, AA5xxx alloys show no compositional gradients at the grain boundaries, yet are still susceptible to IGC. The goal of this work is to establish criteria necessary for IGC to occur given no continuous beta phase path and no compositional gradient at the grain boundaries. IGC performance of the bulk alloy system AA5083 has been studied along with the primary phases present in the IGC system: alpha and beta phases using electrochemistry and modeling as the primary tools. Numerical modeling supports that at steady-state the fissure tip is likely saturated with Mg in excess of the 4% dissolved in the matrix. By combining these results
-
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.7258 >orf19.7258; Contig19-2507; 88880..89851; DDI1*; response to DNA alkyl...ation; MQLTISLDHSGDIISVDVPDSLCLEDFKAYLSAETGLEASVQVLKFNGRELVGNATLSELQIHDNDLLQLSKKQVA
-
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1278 >orf19.1278; Contig19-10104; complement(13162...4..>132028); ; conserved hypothetical protein; truncated protein IQNNKCSGCNLKLDFPVIHFKCKHSFHQKCLSTNLIATSTESS
-
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4711 >orf19.4711; Contig19-10212; complement(29836...7..>300616); ; acidic repetitive protein; truncated protein DRSDYNEEDNNDFTRKLNEIQSKESNHEDLAQSEVQEGQKDEPDSVNQ
-
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec
-
International Nuclear Information System (INIS)
Surekha, K.; Murty, B.S.; Prasad Rao, K.
2011-01-01
Highlights: → Poor corrosion resistance of AA 2219 can be improved by surface treatments. → FSP and LM leads to dissolution of second phase particles. → No literature available on comparison of corrosion behaviour after FSP and LM. → The study implies FSP is as good as LM in improving the corrosion resistance of AA 2219. -- Abstract: Dissolution of second phase particles (CuAl 2 ) present in AA 2219 aluminium improves the corrosion resistance of the alloy. Two surface treatment techniques, viz., solid state friction stir processing and fusion based laser melting lead to the reduction in CuAl 2 content and the effect of these processes on the corrosion behaviour of the alloy is compared in this study. Potentiodynamic polarization and electrochemical impedance spectroscopy tests were carried out to compare corrosion behaviour. The corrosion resistance achieved by friction stir processing is comparable to that obtained by the laser melting technique.
-
Directory of Open Access Journals (Sweden)
Rhodri eCusack
2015-01-01
Full Text Available Recent years have seen neuroimaging data becoming richer, with larger cohorts of participants, a greater variety of acquisition techniques, and increasingly complex analyses. These advances have made data analysis pipelines complex to set up and run (increasing the risk of human error and time consuming to execute (restricting what analyses are attempted. Here we present an open-source framework, automatic analysis (aa, to address these concerns. Human efficiency is increased by making code modular and reusable, and managing its execution with a processing engine that tracks what has been completed and what needs to be (redone. Analysis is accelerated by optional parallel processing of independent tasks on cluster or cloud computing resources. A pipeline comprises a series of modules that each perform a specific task. The processing engine keeps track of the data, calculating a map of upstream and downstream dependencies for each module. Existing modules are available for many analysis tasks, such as SPM-based fMRI preprocessing, individual and group level statistics, voxel-based morphometry, tractography, and multi-voxel pattern analyses (MVPA. However, aa also allows for full customization, and encourages efficient management of code: new modules may be written with only a small code overhead. aa has been used by more than 50 researchers in hundreds of neuroimaging studies comprising thousands of subjects. It has been found to be robust, fast and efficient, for simple single subject studies up to multimodal pipelines on hundreds of subjects. It is attractive to both novice and experienced users. aa can reduce the amount of time neuroimaging laboratories spend performing analyses and reduce errors, expanding the range of scientific questions it is practical to address.
-
Cusack, Rhodri; Vicente-Grabovetsky, Alejandro; Mitchell, Daniel J; Wild, Conor J; Auer, Tibor; Linke, Annika C; Peelle, Jonathan E
2014-01-01
Recent years have seen neuroimaging data sets becoming richer, with larger cohorts of participants, a greater variety of acquisition techniques, and increasingly complex analyses. These advances have made data analysis pipelines complicated to set up and run (increasing the risk of human error) and time consuming to execute (restricting what analyses are attempted). Here we present an open-source framework, automatic analysis (aa), to address these concerns. Human efficiency is increased by making code modular and reusable, and managing its execution with a processing engine that tracks what has been completed and what needs to be (re)done. Analysis is accelerated by optional parallel processing of independent tasks on cluster or cloud computing resources. A pipeline comprises a series of modules that each perform a specific task. The processing engine keeps track of the data, calculating a map of upstream and downstream dependencies for each module. Existing modules are available for many analysis tasks, such as SPM-based fMRI preprocessing, individual and group level statistics, voxel-based morphometry, tractography, and multi-voxel pattern analyses (MVPA). However, aa also allows for full customization, and encourages efficient management of code: new modules may be written with only a small code overhead. aa has been used by more than 50 researchers in hundreds of neuroimaging studies comprising thousands of subjects. It has been found to be robust, fast, and efficient, for simple-single subject studies up to multimodal pipelines on hundreds of subjects. It is attractive to both novice and experienced users. aa can reduce the amount of time neuroimaging laboratories spend performing analyses and reduce errors, expanding the range of scientific questions it is practical to address.
-
Evolutionary status of AA Doradus: still an enigma?
International Nuclear Information System (INIS)
Sarna, M.J.
1985-01-01
The evolutionary scenarios for AA Dor are reconsidered using new contraction times for degenerate red dwarfs. It is found that both types of models considered by Paczynski (1980) with the primary being either an hydrogen shell burning helium white dwarf or a double shell burning carbon-oxygen white dwarf are consistent with the available data. The second model requires a very narrow range of the initial parameters of the binary system. 26 refs. (author)
-
Slot-type pickup/kicker for AA stochastic cooling
CERN PhotoLab
1979-01-01
A "slotted transmission line" was used for both pickups and kickers of the cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. Here we see the slotted electrodes partly pulled out of the outer casing. See also 7906189, 7906581X, 7896193.
-
Study of the effect of cerium nitrate on AA2024-T3 by means of electrochemical micro-cell technique
International Nuclear Information System (INIS)
Paussa, L.; Andreatta, F.; Rosero Navarro, N.C.; Durán, A.; Fedrizzi, L.
2012-01-01
Highlights: ► We evaluate the cerium nitrate effect on the electrochemical behavior of AA2024-T3. ► We examine how AA2024-T3 microstructure affects cerium precipitation mechanism. ► The entire AA2024-T3 surface is involved in cerium precipitation. ► Anodic and cathodic inhibitions are both provided by cerium precipitation. ► Mg-rich intermetallics are preferential sites for cerium precipitation. - Abstract: This work evaluates the effect of cerium nitrate as corrosion inhibitor for AA2024-T3 in the view of its introduction in sol–gel coatings able to provide self-healing ability. Since it is well established that deposition of Ce species is activated by the local pH increase, the objective of this paper is to investigate the behavior of AA2024-T3 (open circuit potential and polarization curves) in the presence of Ce species in aggressive solutions by means of a local technique, the electrochemical micro-cell. This technique enables the investigation of small areas with resolution in the micrometer range by the use of glass capillaries to define the working electrode area. The micro-cell results clearly displayed that the entire AA2024-T3 area exposed to the cerium-containing electrolyte was involved in the cerium precipitation mechanism. The heterogeneous electrochemical behavior of the microstructure is minimized by the formation of a cerium-containing layer able to protect the metal substrate.
-
The effect of atmospheric corona treatment on AA1050 aluminium
DEFF Research Database (Denmark)
Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.
2010-01-01
The effect of atmospheric corona discharge on AM 050 aluminium surface was investigated using electrochemical polarization, SEM-EDX, FIB-SEM. and XPS. The corona treatment was performed with varying time (1, 5, and 15 min) in atmospheric air. A 200 nm oxide layer was generated on AA1050 after...
-
Backend solutions for AA in the MUSE network supporting FMC
Neerbos, A.N.R. van; Prins, M.; Melander, B.; Pimilla Larrucea, I.; Thakur, M.J.; Fredricx, F.
2007-01-01
The European MUSE project investigated fixed-mobile convergence from the perspective of an unbundled fixed network. A major part of the work consisted of finding solutions for the authentication and authorisation of users who roam from their home network to a visited network. This paper shows how AA
-
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.3361 >orf19.3361; Contig19-10173; 157397..>158185;... YAT2*; carnitine acetyltransferase; gene family | truncated protein MSTYRFQETLEKLPIPDLVQTCNAYLEALKPLQTEQEHE
-
Effects of pH and chloride concentration on pitting corrosion of AA6061 aluminum alloy
International Nuclear Information System (INIS)
Zaid, B.; Saidi, D.; Benzaid, A.; Hadji, S.
2008-01-01
Effects of pH solution and chloride (Cl - ) ion concentration on the corrosion behaviour of alloy AA6061 immersed in aqueous solutions of NaCl have been investigated using measurements of weight loss, potentiodynamic polarisation, linear polarisation, cyclic polarisation experiment combined with open circuit potential transient technique and optical or scanning electron microscopy. The corrosion behaviour of the AA6061 aluminum alloy was found to be dependant on the pH and chloride concentration [NaCl] of solution. In acidic or slightly neutral solutions, general and pitting corrosion occurred simultaneously. In contrast, exposure to alkaline solutions results in general corrosion. Experience revealed that the alloy AA6061 was susceptible to pitting corrosion in all chloride solution of concentration ranging between 0.003 wt% and 5.5 wt% NaCl and an increase in the chloride concentration slightly shifted both the pitting E pit and corrosion E cor potentials to more active values. In function of the conditions of treatment, the sheets of the alloy AA6061 undergo two types of localised corrosion process, leading to the formation of hemispherical and crystallographic pits. Polarisation resistance measurements in acidic (pH = 2) and alkaline chloride solutions (pH = 12) which are in good agreement with those of weight loss, show that the corrosion kinetic is minimised in slightly neutral solutions (pH = 6)
-
Evaluation of Electron Beam Welding Performance of AA6061-T6 Plate-type Fuel Assembly
International Nuclear Information System (INIS)
Kim, Soo-Sung; Seo, Kyoung-Seok; Lee, Don-Bae; Park, Jong-Man; Lee, Yoon-Sang; Lee, Chong-Tak
2014-01-01
As one of the most commonly used heat-treatable aluminum alloys, AA6061-T6 aluminum alloy is available in a wide range of structural materials. Typically, it is used in structural members, auto-body sheet and many other applications. Generally, this alloy is easily welded by conventional GTAW (Gas Tungsten Arc Welding), LBW (Laser Beam Welding) and EBW(Electron Beam Welding). However, certain characteristics, such as solidification cracking, porosity, HAZ (Heat-affected Zone) degradation must be considered during welding. Because of high energy density and low heat input, especially LBW and EBW processes possess the advantage of minimizing the fusing zone and HAZ and producing deeper penetration than arc welding processes. In present study, to apply for the plate-type nuclear fuel fabrication and assembly, a fundamental electron beam welding experiment using AA6061-T6 aluminum alloy specimens was conducted. Furthermore, to establish the suitable welding process, and satisfy the requirements of the weld quality, EBW apparatus using an electron welding gun and vacuum chamber was developed, and preliminary investigations for optimizing the welding parameters of the specimens using AA6061-T6 aluminum plates were also performed. The EB weld quality of AA6061-T6 aluminum alloy for the plate-type fuel assembly has been also studied by the weld penetrations of side plate to end fitting and fixing bar and weld inspections using computed tomography
-
Pan, Xiaohong; Xu, Zhangyan; Li, Lan; Shao, Enshi; Chen, Saili; Huang, Tengzhou; Chen, Zhi; Rao, Wenhua; Huang, Tianpei; Zhang, Lingling; Wu, Songqing; Guan, Xiong
2017-11-01
The traditional Bacillus thuringiensis (Bt) formulations for field applications are not resistant to harsh environmental conditions. Hence, the active ingredients of the Bt bioinsecticides could degrade quickly and has low anti-ultraviolet ability in the field, which significantly limits its practical application. In the present study, we developed an efficient and stable delivery system for Bt Cry11Aa toxins. We coated Cry11Aa proteins with Mg(OH) 2 nanoparticles (MHNPs), and then assessed the effects of MHNPs on bioactivity and anti-ultraviolet ability of the Cry11Aa proteins. Our results indicated that MHNPs, like "coating clothes", could effectively protect the Cry protein and enhance the insecticidal bioactivity after UV radiation (the degradation rate was decreased from 64.29% to 16.67%). In addtion, MHNPs could improve the proteolysis of Cry11Aa in the midgut and aggravate the damage of the Cry protein to the gut epithelial cells, leading to increased insecticidal activity against Culex quinquefasciatus. Our results revealed that MHNPs, as an excellent nanocarrier, could substantially improve the insecticidal bioactivity and anti-ultraviolet ability of Cry11Aa.
-
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4748 >orf19.4748; Contig19-10215; complement(47336.....47731); MSL1*; U2 snRNA-associated protein; MPSTKRSSSTEYSHKDSKKKVKLDYVNLKPSQTLYVKNLNTKINKKILLHNLYLLFSAFGDIISINLQNGFAFIIFSNLNSATLALRNLKNQDFFDKPLVLNYAVKESKAISQEKQKLQDENDEEVMPSYE*
-
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2370 >orf19.2370; Contig19-10147; complement(50671..52716); DSL1*; retrogra...de ER-to-golgi transport; MPSIEQQLEDQELYLKDIEQNINKTLSKINKTTLENDNDFRKQFEEIPQDSNTTESN
-
Interdependent effect of chemical composition and thermal history on artificial aging of AA6061
International Nuclear Information System (INIS)
Pogatscher, S.; Antrekowitsch, H.; Uggowitzer, P.J.
2012-01-01
In this study, the interdependent effect of chemical composition and thermal history on artificial aging was investigated for the aluminum alloy AA6061. Based on thermodynamic calculations, including Al, Fe, Cr, Zn, Ti, Mg, Si and Cu, model alloys exhibiting a maximum variation of the reachable solute super-saturation of elements relevant for precipitation hardening within the compositional limits of AA6061 were produced. The artificial aging behavior of these alloys at 175 °C was studied by tensile testing for two thermal histories, including very short- and long-term room temperature storage after quenching. Precipitation during artificial aging was investigated by an analysis of yield strength data. As generally expected, precipitation kinetics was found to depend strongly on the solute super-saturation in the case of very short room temperature storage. For artificial aging after long-term room temperature storage the kinetics showed almost no dependence on the chemical composition. This seems to be an exception from simple precipitation kinetics and can be explained based on the complex role of quenched-in vacancies in artificial aging of AA6061.
-
Directory of Open Access Journals (Sweden)
S. Joyson Abraham
2016-12-01
Full Text Available Friction stir processing (FSP has been accepted as a potential method to produce aluminum matrix composites (AMCs without the drawbacks of liquid metallurgy methods. The present work focuses on the development of AMCs reinforced with quartz (SiO2 particles using FSP. Grooves with various dimensions were machined on AA6063 plates and compacted with quartz particles. A single pass FSP was carried out using a combination of optimized process parameters. The volume fraction of quartz particles in the AMCs was varied from 0 to 18 vol.% in steps of 6 vol.%. The developed AA6063/Quartz AMCs were characterized using optical, scanning and transmission electron microscopy. The quartz particles were distributed uniformly in the aluminum matrix irrespective of the location within the stir zone. The grains of the AA6063 were extensively refined by the combination of thermomechanical effect of FSP and the pinning effect of quartz particles. The dispersion of the quartz particles improved the microhardness and wear resistance of the AMCs. The role of quartz particles on the worn surface and wear debris is reported.
-
Partial view of the first quarter of the Antiproton Accumulator (AA)
1980-01-01
See under 8004261. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
-
Aa ranna veerele kavandatakse kuni 60 elamuga asumit / Külli Kriis
Kriis, Külli, 1961-
2007-01-01
Ilmunud ka: Severnoje Poberezhje, 6. juuli 2007, lk. 1,4. Lüganuse vallavalitsuses ja kohalikes elanikes tekitavad OÜ Eesti Era kavandatavad elamud Aa külla vastuseisu ranna läheduse, juurdepääsu ning veevarustuse ja kanalisatsiooniprobleemide tõttu
-
CSI 2264: Probing the inner disks of AA Tauri-like systems in NGC 2264
McGinnis, P. T.; Alencar, S. H. P.; Guimarães, M. M.; Sousa, A. P.; Stauffer, J.; Bouvier, J.; Rebull, L.; Fonseca, N. N. J.; Venuti, L.; Hillenbrand, L.; Cody, A. M.; Teixeira, P. S.; Aigrain, S.; Favata, F.; Fűrész, G.; Vrba, F. J.; Flaccomio, E.; Turner, N. J.; Gameiro, J. F.; Dougados, C.; Herbst, W.; Morales-Calderón, M.; Micela, G.
2015-05-01
Context. The classical T Tauri star (CTTS) AA Tau has presented photometric variability that was attributed to an inner disk warp, caused by the interaction between the inner disk and an inclined magnetosphere. Previous studies of the young cluster NGC 2264 have shown that similar photometric behavior is common among CTTS. Aims: The goal of this work is to investigate the main causes of the observed photometric variability of CTTS in NGC 2264 that present AA Tau-like light curves, and verify if an inner disk warp could be responsible for their observed variability. Methods: In order to understand the mechanism causing these stars' photometric behavior, we investigate veiling variability in their spectra and u - r color variations and estimate parameters of the inner disk warp using an occultation model proposed for AA Tau. We also compare infrared Spitzer IRAC and optical CoRoT light curves to analyze the dust responsible for the occultations. Results: AA Tau-like variability proved to be transient on a timescale of a few years. We ascribe this variability to stable accretion regimes and aperiodic variability to unstable accretion regimes and show that a transition, and even coexistence, between the two is common. We find evidence of hot spots associated with occultations, indicating that the occulting structures could be located at the base of accretion columns. We find average values of warp maximum height of 0.23 times its radial location, consistent with AA Tau, with variations of on average 11% between rotation cycles. We also show that extinction laws in the inner disk indicate the presence of grains larger than interstellar grains. Conclusions: The inner disk warp scenario is consistent with observations for all but one star with AA Tau-like variability in our sample. AA Tau-like systems are fairly common, comprising 14% of CTTS observed in NGC 2264, though this number increases to 35% among systems of mass 0.7 M⊙ ≲ M ≲ 2.0 M⊙. Assuming random
-
Albus, Deb; Thurlow, Martha L.; Lazarus, Sheryl S.
2011-01-01
This report examines publicly reported participation and performance data for the alternate assessment based on modified achievement standards (AA-MAS). The authors' analysis of these data included all states publicly reporting AA-MAS data, regardless of whether they had received approval to use the results for Title I accountability calculations.…
-
FIB-SEM investigation of trapped intermetallic particles in anodic oxide films on AA1050 aluminium
DEFF Research Database (Denmark)
Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.
2011-01-01
-containing intermetallic particles incorporated into the anodic oxide films on industrially pure aluminium (AA1050, 99.5 per cent) has been investigated. AA1050 aluminium was anodized in a 100?ml/l sulphuric acid bath with an applied voltage of 14?V at 20°C ±2°C for 10 or 120?min. The anodic film subsequently was analyzed......Purpose - The purpose of this investigation is to understand the structure of trapped intermetallics particles and localized composition changes in the anodized anodic oxide film on AA1050 aluminium substrates. Design/methodology/approach - The morphology and composition of Fe......-shaped particles were embedded in the anodic oxide film as a thin strip structure and located near the top surface of the film, whereas the round-shaped particles were trapped in the film with a spherical structure, but partially dissolved and were located throughout the thickness of the anodic film. The Fe...
-
Mjelde, M.; Berge, D.; Edvardsen, H.
2012-01-01
Den foreliggende rapporten utgjør kunnskapsgrunnlaget for Handlingsplan mot vasspest (Elodea canadensis) og smal vasspest (Elodea nuttallii). Rapporten gir en oppdatert oversikt over de to artenes biologi og økologi, utbredelse og spredningsveier, samt kjente effekter på vannøkosystemet. Kunnskapsbehov diskuteres, bl.a. knyttet til artenes økologiske krav og effekter på biologisk mangfold. Rapporten omtaler tiltak for å hindre videre spredning og tiltak for å redusere eller bekjempe bestande...
-
Lazarus, Sheryl S.; Hodgson, Jennifer R.; Price, Lynn M.; Thurlow, Martha L.
2011-01-01
Federal legislation requires that all students participate in state accountability systems. Most students with disabilities participate in the regular assessment, with or without accommodations. Students with more significant cognitive disabilities participate in the Alternate Assessment based on Alternate Achievement Standards (AA-AAS). A few…
-
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.710 >orf19.710; Contig19-10065; complement(47186.....>47710); LSC2*; succinate-CoA ligase beta subunit; truncated protein | overlap LGFDDNASFRQEEVFSWRDPTQEDPQEAE
-
Heavy quarkonium production: Nontrivial transition from pA to AA collisions
International Nuclear Information System (INIS)
Kopeliovich, B. Z.; Potashnikova, I. K.; Schmidt, Ivan; Pirner, H. J.
2011-01-01
Two novel QCD effects, double-color filtering and mutual boosting of the saturation scales in colliding nuclei, affect the transparency of the nuclei for quark dipoles in comparison with proton-nucleus collisions. The former effect increases the survival probability of the dipoles, since color filtering in one nucleus makes the other one more transparent. The second effect acts in the opposite direction and is stronger; it makes the colliding nuclei more opaque than in the case of pA collisions. As a result of parton saturation in nuclei the effective scale is shifted upward, which leads to an increase of the gluon density at small x. This in turn leads to a stronger transverse momentum broadening in AA compared with pA collisions, i.e., to an additional growth of the saturation momentum. Such a mutual boosting leads to a system of reciprocity equations, which result in a saturation scale, a few times higher in AA than in pA collisions at the energies of the large hadron collider (LHC). Since the dipole cross section is proportional to the saturation momentum squared, the nuclei become much more opaque for dipoles in AA than in pA collisions. For the same reason gluon shadowing turns out to be boosted to a larger magnitude compared with the product of the gluon shadowing factors in each of the colliding nuclei. All these effects make it more difficult to establish a baseline for anomalous J/Ψ suppression in heavy ion collisions at high energies.
-
ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ch_oct10_gene_aa_db Chro.60303 >1wicA 11 152 1 150 4e-26 ... gb|EAL37012.1| conserverd MSP-domain transme...mbrane protein [Cryptosporidium ... hominis] ... Length = 150 ... Query: 1 ... MSME...GAKLVRVHPEKALEFPLVLYSSVTTPLILENITSSTVAFKIKTTAPRGYLVRPSSG 60 ... MSMEGAKLVRVHPEKALEFPLVLYSSVTTPLIL...ENITSSTVAFKIKTTAPRGYLVRPSSG Sbjct: 1 ... MSMEGAKLVRVHPEKALEFPLVLYSSVTTPLILENITSSTVA
-
Tensile behavior of friction stir welded AA 6061-T4 aluminum alloy joints
International Nuclear Information System (INIS)
Heidarzadeh, A.; Khodaverdizadeh, H.; Mahmoudi, A.; Nazari, E.
2012-01-01
Highlights: ► Range of parameters for defect-free friction stir welded AA 6061-T4 was reached. ► A model was developed for predicting UTS and EL of friction stir welded AA 6061-T4. ► The maximum values of UTS and EL of joints were estimated by developed model. ► The optimum values of FSW process parameters were determined. -- Abstract: In this investigation response surface methodology based on a central composite rotatable design with three parameters, five levels and 20 runs, was used to develop a mathematical model predicting the tensile properties of friction stir welded AA 6061-T4 aluminum alloy joints at 95% confidence level. The three welding parameters considered were tool rotational speed, welding speed and axial force. Analysis of variance was applied to validate the predicted model. Microstructural characterization and fractography of joints were examined using optical and scanning electron microscopes. Also, the effects of the welding parameters on tensile properties of friction stir welded joints were analyzed in detail. The results showed that the optimum parameters to get a maximum of tensile strength were 920 rev/min, 78 mm/min and 7.2 kN, where the maximum of tensile elongation was obtained at 1300 rev/min, 60 mm/min and 8 kN.
-
AAS, growth hormone, and insulin abuse: psychological and neuroendocrine effects
Directory of Open Access Journals (Sweden)
Michael R Graham
2008-06-01
Full Text Available Michael R Graham1, Peter Evans2, Bruce Davies1, Julien S Baker11Health and Exercise Science Research Unit, Faculty of Health Sport and Science, University of Glamorgan, Pontypridd, Wales, United Kingdom; 2Royal Gwent Hospital, Newport, Gwent, United KingdomAbstract: The nontherapeutic use of prescription medicines by individuals involved in sport is increasing. Anabolic-androgenic steroids (AAS are the most widely abused drug. Much of our knowledge of the psychological and physiological effects of human growth hormone (hGH and insulin has been learned from deficiency states. As a consequence of the Internet revolution, previously unobtainable and expensive designer drugs, particularly recombinant human growth hormone (rhGH and insulin, have become freely available at ridiculously discounted prices from countries such as China and are being abused. These drugs have various physiological and psychological effects and medical personnel must become aware that such prescription medicine abuse appears to be used not only for performance and cosmetic reasons, but as a consequence of psychological pre-morbidity.Keywords: AAS, cosmesis, growth hormone, insulin, performance, strength
-
Anodising and corrosion resistance of AA 7050 friction stir welds
International Nuclear Information System (INIS)
Atz Dick, Pedro; Knörnschild, Gerhard H.; Dick, Luís F.P.
2017-01-01
Highlights: • Sulphuric Anodizing films of AA7050 friction stir welds are 25% thinner on the nugget zone. • Semicoherent MgZn_2 precipitates locally pin the formation of anodic oxide film. • Coarse Al_7Cu_2Fe precipitates anodize irregularly and produces locally thicker films. • Localized corrosion occurs preferentially on the nugget zone and is related to the thinner oxide film and irregular anodizing on stirring voids. - Abstract: The influence of friction stir welding on the sulphuric anodising and corrosion of AA7050 was studied in 0.1 M NaCl by the scanning vibrating electrode technique under simultaneous polarization. The oxide films obtained were characterized by scanning electron microscopy. The porous oxide films are up to 25% thicker on the thermomechanically and heat affected zones and 25% thinner on the nugget. This thinner defective oxide film explains the lower pitting resistance of the nugget zone. Individual pit current transients were indirectly determined from current maps. However, the calculated values are lower than expected, due to underestimation of electrolyte conductivity near pits.
-
Energy Technology Data Exchange (ETDEWEB)
Weis Olea, Cesar Afonso [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Inst. fuer Werkstofforschung
2008-12-04
Aluminium alloys AA2024 T351, AA6013 T6 and the recently developed Al-Mg-Sc for aircraft industry applications, which are usually considered difficult to weld by conventional fusion welding processes, demonstrate outstanding performance when joined by friction stir welding (FSW). The main feature of the process is to produce solid-state welds, where the maximum temperatures attained during the process are about 80 % that of the melting temperature of the base material. The process generates substantial plastic deformation, due to the solid-state stirring, and consequently creates a high dislocation density, which is a precursor to dynamic recrystallization, a metallurgical feature that characterizes the stir zone (weld centre). A relevant aspect considered, regarding precipitation-hardening aluminium alloys, is the deterioration of the mechanical properties in the weld zones, which are fundamentally attributed to changes in the characteristics of strengthening precipitates. Among the strengthening mechanisms acting in these aluminium alloys, the most important is basically dependent on the morphology, size and population of the precipitates. The thermal cycle and deformation generated during the FSW process alter the precipitation characteristics previously present in the base material. FSW input energy regulates the magnitude of the thermal cycle and the intensity of deformation taking place during the process, and it can be controlled by the welding parameters, affecting the precipitates evolution and consequently the mechanical properties of the joint. Nevertheless, there remains a lack of knowledge about the substructural evolution of these alloys during FSW, and its correlation with weld energy input and their respective mechanical properties, particularly for the Al-Mg-Sc alloy. The main objective of this work is to explain the micro and substructural evolution (emphasizing precipitates evolution) of AA2024- T351, AA6013-T6 and Al-Mg-Sc alloys in similar
-
What Astronomers and the AAS Need to be Doing to Curb Light Pollution
Green, D. W. E.
2001-12-01
Astronomers and especially the AAS are doing apalling little in the war on light pollution. This is quite surprising, considering that optical groundbased astronomy may become nearly extinct in the 21st century if we don't get more serious about the loss of our night skies to artificial lighting. Part of the blame must be placed on astronomers throughout the 20th century (particularly before 1980), as very few of them seem to have set an example by starting an early crusade against bad outdoor night lighting (save for a handful of important individuals near large U.S. observatories, and a few connected with smaller observatories); this apathy of earlier generations of astronomers fueled the current general apathy within the AAS and aided the opening of the floodgates in terms of the disastrous lighting situation now upon us in terms of drowning out the night sky. There are possible solutions, and they need to be discussed and acted upon quickly. For example, the AAS should require that all members include a useful amount (say, \\$30) in annual membership fees to be directly transmitted to the International Dark Sky Association, and the AAS should make constant visible strides to educate the public and government officials of the absolute need to reduce outdoor lighting levels and to fully shield all outdoor lighting. There are many other areas of research into outdoor lighting that the AAS should fund or officially/strongly support, so that the astronomical community can better be educated (and can better educate the public) on the evils of bad and thoughtless outdoor-lighting practices; such research includes developing a comprehensive database of national statistics on numbers and types of different outdoor lamps, as a function of time (thus, historical), and also a comprehensive database including all local, state, and federal lighting laws and ordinances together with legal court cases (and their outcomes) involving outdoor night lighting. And professional
-
Effects of heat treatment on the microstructure and mechanical properties of AA2618 DC cast alloy
International Nuclear Information System (INIS)
Elgallad, E.M.; Shen, P.; Zhang, Z.; Chen, X.-G.
2014-01-01
Highlights: • The microstructure and mechanical properties of AA2618 DC cast alloy were studied. • The Al 2 CuMg, Al 2 Cu, Al 7 Cu 4 Ni, Al 7 Cu 2 (Fe,Ni) and Al 9 FeNi phases were identified. • Solution treatment at 530 °C for 5 h is the optimum solution treatment. • Different combinations of strength and ductility can be achieved. • The strengthening of AA2618 DC cast alloy was caused by GPB zones and S′ phase. - Abstract: Direct chill (DC) cast ingot plates of AA2618 alloy have been increasingly used for large-mold applications in the plastics and automotive industries. The effects of different heat treatments on the microstructure and mechanical properties of AA2618 DC cast alloy were investigated using scanning electron microscopy (SEM), transmission electron microscopy (TEM) and hardness and tensile testing. The as-cast microstructure contained a considerable amount of coarse intermetallic phases, including Al 2 CuMg, Al 2 Cu, Al 7 Cu 4 Ni, Al 7 Cu 2 (Fe,Ni) and Al 9 FeNi, resulting in poor mechanical properties. Solution treatment at 530 °C for 5 h dissolved the first three phases into the solid solution and consequently improved the mechanical properties of the alloy. By utilizing the appropriate aging temperature and time, different combinations of strength and ductility could be obtained to fulfill the design requirements of large-mold applications. The strengthening of AA2618 DC cast alloy under the aging conditions studied was caused by GPB zones and S′ precipitates. The evolution of both precipitates in terms of their size and density was observed to have a significant effect on the mechanical properties of the alloy
-
Directory of Open Access Journals (Sweden)
Mehran Tamjidy
2017-05-01
Full Text Available The development of Friction Stir Welding (FSW has provided an alternative approach for producing high-quality welds, in a fast and reliable manner. This study focuses on the mechanical properties of the dissimilar friction stir welding of AA6061-T6 and AA7075-T6 aluminum alloys. The FSW process parameters such as tool rotational speed, tool traverse speed, tilt angle, and tool offset influence the mechanical properties of the friction stir welded joints significantly. A mathematical regression model is developed to determine the empirical relationship between the FSW process parameters and mechanical properties, and the results are validated. In order to obtain the optimal values of process parameters that simultaneously optimize the ultimate tensile strength, elongation, and minimum hardness in the heat affected zone (HAZ, a metaheuristic, multi objective algorithm based on biogeography based optimization is proposed. The Pareto optimal frontiers for triple and dual objective functions are obtained and the best optimal solution is selected through using two different decision making techniques, technique for order of preference by similarity to ideal solution (TOPSIS and Shannon’s entropy.
-
Tamjidy, Mehran; Baharudin, B T Hang Tuah; Paslar, Shahla; Matori, Khamirul Amin; Sulaiman, Shamsuddin; Fadaeifard, Firouz
2017-05-15
The development of Friction Stir Welding (FSW) has provided an alternative approach for producing high-quality welds, in a fast and reliable manner. This study focuses on the mechanical properties of the dissimilar friction stir welding of AA6061-T6 and AA7075-T6 aluminum alloys. The FSW process parameters such as tool rotational speed, tool traverse speed, tilt angle, and tool offset influence the mechanical properties of the friction stir welded joints significantly. A mathematical regression model is developed to determine the empirical relationship between the FSW process parameters and mechanical properties, and the results are validated. In order to obtain the optimal values of process parameters that simultaneously optimize the ultimate tensile strength, elongation, and minimum hardness in the heat affected zone (HAZ), a metaheuristic, multi objective algorithm based on biogeography based optimization is proposed. The Pareto optimal frontiers for triple and dual objective functions are obtained and the best optimal solution is selected through using two different decision making techniques, technique for order of preference by similarity to ideal solution (TOPSIS) and Shannon's entropy.
-
Microstructure and microhardness of AA1050/TiC surface composite ...
Indian Academy of Sciences (India)
The surface properties dictate the life span of components in ... the life span. This balance of properties is not achiev- ... It is hard to avoid the excessive ... In the present work, an attempt is made to fabricate AA1050/10wt. ... FSW can be considered as a hot-working process in which severe plastic deformation is imported.
-
Wu, Juan; Liu, Xinhui; Fan, Jinjin; Chen, Wenfang; Wang, Juan; Zeng, Youjia; Feng, Xiaorang; Yu, Xueqing; Yang, Xiao
2014-04-06
Bardoxolone methyl (BARD) is an antioxidant modulator that acts through induction of the nuclear factor erythroid 2-related factor 2 (Nrf2) signaling pathway. This study aimed to investigate the role of BARD in protecting kidneys from aristolochic acid (AA)-induced acute kidney injury (AKI). Male C57BL/6 mice received intraperitoneal (i.p.) injections of aristolochic acid I (AAI) (5mg/kg/day) for 5 days to produce acute AA nephropathy (AAN) model. BARD (10mg/kg/day, i.p.) was applied for 7 consecutive days, starting 2 days prior to AAI administration. The mice in the AA group showed AKI as evidenced by worsening kidney function evaluated by blood urea nitrogen (BUN) and serum creatinine (SCr) levels, and severe tubulointerstitial injury marked by massive tubule necrosis in kidney tissues. BARD significantly reduced BUN and SCr levels which were elevated by AAI. Additionally, AAI-induced histopathological renal damage was ameliorated by BARD. Furthermore, the expression of Nrf2 was reduced, and its repressor Kelch-like ECH-associated protein 1 (Keap1) was increased significantly, whereas heme oxygenase-1 (HO-1) was upregulated and NAD(P)H quinone oxidoreductase-1 (NQO1) was barely increased in the cytoplasm of tubules in kidneys after treatment with AAI. BARD significantly upregulated renal Nrf2, NQO1 and HO-1 expression and downregulated Keap1 expression compared with those in the AA group. Moreover, it was found that Nrf2 was expressed both in the cytoplasm and nuclear of glomeruli and tubules, whereas NQO1 and HO-1 were localized in the cytoplasm of tubules only. In conclusion, AA-induced acute renal injury was associated with impaired Nrf2 activation and expression of its downstream target genes in renal tissues. BARD prevented renal damage induced by AAI, and this renoprotective effect may be exerted by activating the Nrf2 signaling pathway and increasing expression of the downstream target genes. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
-
Inhibition of localized attack on the aluminium alloy AA 6351 in glycol/water solutions
Energy Technology Data Exchange (ETDEWEB)
Monticelli, C; Brunoro, G; Zucchi, F; Fagioli, F
1989-06-01
The objective of this work was to examine the feasibility of enhancing pitting resistance of AA 6351 (nominal composition: 1% Si, 0.6% Mg, 0.3% Mn, balance Al) by adding suitable inhibitors to the solutions. The compounds used were two inorganic salts: sodium molybdate and sodium tungstate and two derivatives of pyrimidine: 2-aminopyrimidine (2AP) and 2-hydroxypyrimidine (2HP). The inhibiting efficiencies of these substances were tested by both short-time electrochemical tests (galvanic coupling tests and polarization curves) and long-time immersions under experimental conditions causing the localized attack. Molybdate, tungstate and, to some extent, also 2AP efficiently inhibit AA 6351 localized corrosion in degraded solutions at 80/sup 0/C and in pure boiling solutions, for long exposure periods. The short-time electrochemical tests suggest that molybdate and tungstate are able to retard the electrochemical processes occurring on both the aluminium alloy and the small copper cathodic area produced by copper deposition. On the other hand, the 2AP efficiency is attributed to some complexing capability of this pyrimidine derivative towards dissolved copper ions, that are stabilized in solution. 2HP does not prevent AA 6351 localized attack. (orig./MM).
-
Jurado, Esperanza; Hansen, Mads A.T.; Gavala, Hariklia N.; Skiadas, Ioannis
2013-01-01
AAS treatment is a very efficient method to increase the methane potential of manure fibers. The chemical composition and supramolecular structures of swine manure fibers before and after AAS treatment was investigated in this study. Composition analyses, atomic force microscopy (AFM), scanning electron microscopy (SEM), and chemical surface composition by Attenuated Total Reflectance–Fourier Transform Infrared (ATR–FTIR) showed that no delignification of the lignocellulose took place during ...
-
Peaprokurör: kaevake kartellide peale! / Kadri Paas ; kommenteerinud Norman Aas ; Indrek, Kaju
Paas, Kadri, 1982-
2009-01-01
Seaduseelnõust, mille kohaselt salajasest kartellileppest esimesena võimudele teatanud ettevõte pääseb vastutasuks karistusest. Kommenteerivad peaprokurör Norman Aas ning Neste Eesti peadirektor Indrek Kaju
-
A Novel Tenebrio molitor Cadherin Is a Functional Receptor for Bacillus thuringiensis Cry3Aa Toxin*
Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D.; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis
2009-01-01
Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepid...
-
Zúñiga-Navarrete, Fernando; Gómez, Isabel; Peña, Guadalupe; Amaro, Itzel; Ortíz, Ernesto; Becerril, Baltazar; Ibarra, Jorge E; Bravo, Alejandra; Soberón, Mario
2015-04-01
Bacillus thuringiensis Cry toxins exert their toxic effect by specific recognition of larval midgut proteins leading to oligomerization of the toxin, membrane insertion and pore formation. The exposed domain II loop regions of Cry toxins have been shown to be involved in receptor binding. Insect cadherins have shown to be functionally involved in toxin binding facilitating toxin oligomerization. Here, we isolated a VHH (VHHA5) antibody by phage display that binds Cry3Aa loop 1 and competed with the binding of Cry3Aa to Tenebrio molitor brush border membranes. VHHA5 also competed with the binding of Cry3Aa to a cadherin fragment (CR12) that was previously shown to be involved in binding and toxicity of Cry3Aa, indicating that Cry3Aa binds CR12 through domain II loop 1. Moreover, we show that a loop 1 mutant, previously characterized to have increased toxicity to T. molitor, displayed a correlative enhanced binding affinity to T. molitor CR12 and to VHHA5. These results show that Cry3Aa domain II loop 1 is a binding site of CR12 T. molitor cadherin. Copyright © 2015 Elsevier Ltd. All rights reserved.
-
Partial view of the first quarter of the Antiproton Accumulator (AA)
1980-01-01
See photo 8004261 and Annual Report 1979 p.143, Fig. 1 For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
-
Dynamic behaviour of AA 2024 under blast loading : experiments and simulations
Mediavilla Varas, J.; Soetens, F.; van der Meulen, Ronald; Kroon, E.; Aanhold, van J.E.; Soetens, F.; Katgerman, L.
2010-01-01
The dynamic behaviour of AA2024-T3 is investigated. Dynamic tensile tests using a servo-hydraulic and a light weight shock testing machine (LSM) have been performed. The servo-hydraulic test machine proves to be more reliable and reaches higher strain rates. Neither test revealed any strain rate
-
7 CFR 51.1176 - U.S. Grade AA Juice (Double A).
2010-01-01
... STANDARDS) United States Standards for Grades of Florida Oranges and Tangelos Standards for Internal Quality... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. Grade AA Juice (Double A). 51.1176 Section 51.1176 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards...
-
Energy Technology Data Exchange (ETDEWEB)
Liu, Jie; Wang, Dapeng; Gao, Lixin; Zhang, Daquan, E-mail: zhdq@sh163.net
2016-12-15
Highlights: • Effectively prevent corrosion of AA5052 alloy by using the mixture of cerium nitrate and sodium dodecylbenzenesulfonate. • Synergistic mechanism of the combination of cerium nitrate and sodium dodecylbenzenesulfonate. • Structure of the complex formed between cerium ions and dodecylbenzenesulfonate. • The optimal adsorption model of dodecylbenzenesulfonate on the Al{sub 2}O{sub 3} and CeO{sub 2} surface. - Abstract: The synergistic inhibition effect of rare earth cerium nitrate and sodium dodecylbenzenesulfonate (DBS) on corrosion of AA5052 aluminium alloy in 3 wt.% NaCl solution was investigated by electrochemical impedance spectroscopy (EIS), potentiodynamic polarization curve, scanning electron microscope (SEM) and Fourier transform infrared spectroscopy (FT-IR). The results show that the single cerium nitrate or DBS has a limited inhibition effect against corrosion of AA5052 alloy. The combination cerium ions with DBS produced strong synergistic effect on corrosion inhibition for AA5052 alloy and rendered a negaitve shift of the corrosion potential. The formation of the complex of Al(DBS){sub 3} and Ce(DBS){sub 3} stabilized the passive film of Al{sub 2}O{sub 3} and CeO{sub 2}, retarding both the cathodic and anodic processes of AA5052 alloy corrosion reaction significantly.
-
Lee, Jin Heon; Lee, Kee Jae; Ahn, Ryoungme; Kang, Hee Sook
2014-09-01
Acrylamide (AA) and N-acetyl-S-(2-carbamoylethyl)-cysteine (AAMA) are important urinary biomarkers of acrylamide exposure in human biomonitoring, because AA is classified as a probable carcinogen in humans. In this study, urinary AA and AAMA were assessed in the South Korean adult population aged 18-69, based on the Korean National Human Biomonitoring Survey conducted in 2009. Urinary metabolites in samples were analyzed with LC-MS/MS system. Relying on data from 1873 representative South Korean adults, the population-weighted geometric means of urinary AA and AAMA concentrations were 6.8 ng/ml (95% CI: 6.4-7.3), and 30.0 ng/ml (95% confidence interval (CI): 28.2-31.8), respectively. The creatinine-adjusted geometric means of AA and AAMA were 6.2 μg/g creatinine (95% CI: 5.8-6.7) and 26.4μg/g creatinine (95% CI: 24.9-28.0), respectively. When covariates for predictors of urinary metabolites were adjusted simultaneously in a log-linear multiple regressions, the strongest predictors of urinary AA were education (OR=1.08-1.28; 95% CI: 1.11-1.48; p=0.0024) and age (OR=0.66-0.84; 95% CI: 0.54-0.97; p=0.0003), and those of urinary AAMA were smoking status (OR=1.16-2.63; 95% CI: 0.98-3.08; p=0.001) and education (OR=1.12-1.19; 95% CI: 1.02-1.38; p=0.0425). The ratio of current/never smokers for urinary AA was 1.3, whereas the same ratio for urinary AAMA was 3.0. These findings suggested that most South Koreans had detectable levels of AA and AAMA (98.7% and 99.4%, respectively) in their urine and that the body burden of AA and AAMA varied according to demographic, geographic, and lifestyle (smoking) factors. Copyright © 2014 Elsevier GmbH. All rights reserved.
-
Chakroun, Maissa; Bel, Yolanda; Caccia, Silvia; Abdelkefi-Mesrati, Lobna; Escriche, Baltasar; Ferré, Juan
2012-07-01
The Vip3Aa protein is an insecticidal protein secreted by Bacillus thuringiensis during the vegetative stage of growth. The activity of this protein has been tested after different steps/protocols of purification using Spodoptera frugiperda as a control insect. The results showed that the Vip3Aa protoxin was stable and retained full toxicity after being subjected to common biochemical steps used in protein purification. Bioassays with the protoxin in S. frugiperda and S. exigua showed pronounced differences in LC(50) values when mortality was measured at 7 vs. 10d. At 7d most live larvae were arrested in their development. LC(50) values of "functional mortality" (dead larvae plus larvae remaining in the first instar), measured at 7d, were similar or even lower than the LC(50) values of mortality at 10d. This strong growth inhibition was not observed when testing the trypsin-activated protein (62 kDa) in either species. S. exigua was less susceptible than S. frugiperda to the protoxin form, with LC(50) values around 10-fold higher. However, both species were equally susceptible to the trypsin-activated form. Processing of Vip3Aa protoxin to the activated form was faster with S. frugiperda midgut juice than with S. exigua midgut juice. The results strongly suggest that the differences in the rate of activation of the Vip3Aa protoxin between both species are the basis for the differences in susceptibility towards the protoxin form. Copyright © 2012 Elsevier Inc. All rights reserved.
-
Directory of Open Access Journals (Sweden)
Michael A Rausch
Full Text Available Aphids are sap-sucking insects (order: Hemiptera that cause extensive damage to a wide range of agricultural crops. Our goal was to optimize a naturally occurring insecticidal crystalline (Cry toxins produced by the soil-dwelling bacterium Bacillus thuringiensis for use against the pea aphid, Acyrthosiphon pisum. On the basis that activation of the Cry4Aa toxin is a rate-limiting factor contributing to the relatively low aphicidal activity of this toxin, we introduced cathepsin L and cathepsin B cleavage sites into Cry4Aa for rapid activation in the aphid gut environment. Incubation of modified Cry4Aa and aphid proteases in vitro demonstrated enhanced processing of the toxin into the active form for some of the modified constructs relative to non-modified Cry4Aa. Aphids fed artificial diet with toxin at a final concentration of 125 μg/ml showed enhanced mortality after two days for one of the four modified constructs. Although only modest toxin improvement was achieved by use of this strategy, such specific toxin modifications designed to overcome factors that limit aphid toxicity could be applied toward managing aphid populations via transgenic plant resistance.
-
Lang, Lihui; Zhang, Quanda; Sun, Zhiying; Wang, Yao
2017-09-01
In this paper, the hydraulic bulging experiments were respectively carried out using AA6016-T4 aluminum alloy and AA6016-O aluminum alloy, and the deformation properties and fracture mechanism of aluminum alloy under the conditions of thermal and hydraulic were analyzed. Firstly, the aluminum alloy AA6016 was dealt with two kinds of heat treatment systems such as solid solution heat treatment adding natural ageing and full annealing, then the aluminum alloy such as AA6016-T4 and AA6016-O were obtained. In the same working environment, the two kinds of materials were used in the process of hydraulic bulging experiments, according to the observation and measurement of the deformation sizes of grid circles and material thicknesses near the fracture region, the flow properties and development trend of fracture defect of the materials were analyzed comprehensively from the perspective of qualitative analysis and quantitative analysis; Secondly, the two kinds of materials were sampled in different regions of the fracture area and the microstructure morphology of the fracture was observed by the scanning electron microscope (SEM). The influence laws of the heat treatment systems on the fracture defect of the aluminum alloy under the condition of the liquid pressure were studied preliminarily by observing the distribution characteristics of the fracture microstructure morphology of dimple. At the same time, the experimental research on the ordinary stamping forming process of AA6016-O was carried out and the influence law of different forming process on the fracture defect of the aluminum alloy material was studied by observing the distribution of the fracture microstructure morphology; Finally, the development process of the fracture defect of aluminum alloy sheet was described theoretically from the view of the stress state.
-
Effekt av ulike desinfeksjonsstrategier mot Listeria monocytogenes
Fossmo, Sabine
2013-01-01
Kontroll med bakterier som Listeria utgjør en stor utfordring for mange matprodusenter. Listeria monocytogenes er hovedsakelig et produksjonshygienisk problem, forbedret hygiene kan derfor være tiltak for å redusere overlevelse og smitteoverføring av bakterien i produksjonsmiljø. Hensikten med forsøkene i oppgaven var å undersøke effekten av ulike desinfeksjonsstrategier på drap av L. monocytogenes, både når bakteriene var i biofilm og i suspensjon. Dette inkluderte bruk av tradisjonelle desi...
-
Kunduraci, Meltem
2016-01-01
Endrede klimatiske forhold og større urbanisering medfører økte oversvømmelsesskader i urbane områder. Ekstreme nedbørhendelser opptrer oftere og kraftigere. Utbygging med tette flater hindrer infiltrasjon til grunnen. Den naturlige utjevningen av overvann reduseres. Dette resulterer i økende belastninger på det eksisterende avløpssystemet. Kapasiteten på avløpsnettet er mange steder overbelastet og er ikke i stand til å håndtere overvannsmengder under styrtregn. Lokal overvannsdisponering el...
-
Tanaka, Shiho; Endo, Haruka; Adegawa, Satomi; Iizuka, Ami; Imamura, Kazuhiro; Kikuta, Shingo; Sato, Ryoichi
2017-12-01
Because Bombyx mori ABC transporter C2 (BmABCC2) has 1000-fold higher potential than B. mori cadherin-like protein as a receptor for Bacillus thuringiensis Cry1Aa toxin (Tanaka et al., 2013), the gate-opening ability of the latent pore under six extracellular loops (ECLs) of BmABCC2 was expected to be the reason for its higher potential (Heckel, 2012). In this study, cell swelling assays in Sf9 cells showed that BmABCC2 mutants lacking substrate-excreting activity retained receptor activity, indicating that the gate-opening activity of BmABCC2 is not responsible for Cry1Aa toxicity. The analysis of 29 BmABCC2 mutants demonstrated that 770 DYWL 773 of ECL 4 comprise a putative binding site to Cry1Aa. This suggests that specific toxicity of Cry1Aa toxin to a restricted range of lepidopteran insects is dependent on conservation and variation in the amino acid residues around 770 DYWL 773 of ECL 4 in the ABCC2. Copyright © 2017 Elsevier Ltd. All rights reserved.
-
EDP Sciences and A&A: partnering to providing services to support the scientific community
Henri, Agnes
2015-08-01
Scholarly publishing is no longer about simply producing and packaging articles and sending out to subscribers. To be successful, as well as being global and digital, Publishers and their journals need to be fully engaged with their stakeholders (authors, readers, funders, libraries etc), and constantly developing new products and services to support their needs in the ever-changing environment that we work in.Astronomy & Astrophysics (A&A) is a high quality, major international Journal that belongs to the astronomical communities of a consortium of European and South American countries supported by ESO who sponsor the journal. EDP Sciences is a non-profit publisher belonging to several learned societies and is appointed by ESO to publish the journal.Over the last decade, as well as publishing the results of worldwide astronomical and astrophysical research, A&A and EDP Sciences have worked in partnership to develop a wide range of services for the authors and readers of A&A:- A specialist language editing service: to provide a clear and excellent level of English ensuring full understanding of the high-quality science.- A flexible and progressive Open Access Policy including Gold and Green options and strong links with arXiv.- Enriched articles: authors are able to enhance their articles using a wide range of rich media such as 3D models, videos and animations.Multiple publishing formats: allowing readers to browse articles on multiple devices including eReaders and Kindles.- “Scientific Writing for Young Astronomers”: In 2008 EDP Sciences and A&A set up the Scientific Writing for Young Astronomers (SWYA) School with the objective to teach early PhD Students how write correct and efficient scientific papers for different mediums (journals, proceedings, thesis manuscripts, etc.).
-
Cheng, Qilai; Liao, Meixiang; Hu, Haibo; Li, Hongliang; Wu, Longhuo
2018-01-01
P-glycoprotein (P-gp, i.e., MDR1) is associated with the phenotype of multidrug resistance (MDR) and causes chemotherapy failure in the management of cancers. Searching for effective MDR modulators and combining them with anticancer drugs is a promising strategy against MDR. Asiatic acid (AA), a natural triterpene isolated from the plant Centella asiatica, may have an antitumor activity. The present study assessed the reversing effect of AA on MDR and possible molecular mechanisms of AA action in MDR1-overexpressing cisplatin (DDP)-resistant lung cancer cells, A549/DDP. Human lung adenocarcinoma A549/DDP cells were either exposed to different concentrations of AA or treated with DDP, and their viability was measured by the MTT assay. A Rhodamine 123 efflux assay, immunofluorescent staining, ATPase assay, reverse-transcription PCR (RT-PCR), and western blot analysis were conducted to elucidate the mechanisms of action of AA on MDR. Our results showed that AA significantly enhanced the cytotoxicity of DDP toward A549/DDP cells but not its parental A549 cells. Furthermore, AA strongly inhibited P-gp expression by blocking MDR1 gene transcription and increased the intracellular accumulation of the P-gp substrate Rhodamine 123 in A549/DDP cells. Nuclear factor (NF)-kB (p65) activity, IkB degradation, and NF-kB/p65 nuclear translocation were markedly inhibited by pretreatment with AA. Additionally, AA inhibited the MAPK-ERK pathway, as indicated by decreased phosphorylation of ERK1 and -2, AKT, p38, and JNK, thus resulting in reduced activity of the Y-box binding protein 1 (YB1) via blockage of its nuclear translocation. AA reversed P-gp-mediated MDR by inhibition of P-gp expression. This effect was likely related to downregulation of YB1, and this effect was mediated by the NF-kB and MAPK-ERK pathways. AA may be useful as an MDR reversal agent for combination therapy in clinical trials. © 2018 The Author(s). Published by S. Karger AG, Basel.
-
Flow Injection and Atomic Absorption Spectrometry (FI-AAS) -
DEFF Research Database (Denmark)
Hansen, Elo Harald
1996-01-01
One of the advantages of the flow injection (FI) concept is that it is compatible with virtually all detection techniques. Being a versatile vehicle for enhancing the performance of the individual detection devices, the most spectacular results have possibly been obtained in conjunction with atomic...... the point of sample injection/introduction to the point of detection. Hence, in FI-fAAS this feature allows not only to obtain improved repeatability but also improved accuracy, and because the wash to sample ratio is high it permits the handling of samples with elevated salt contents - which...
-
Development of 2024 AA-Yttrium composites by Spark Plasma Sintering
Vidyasagar, CH S.; Karunakar, D. B.
2018-04-01
The method of fabrication of MMNCs is quite a challenge, which includes advanced processing techniques like Spark Plasma Sintering (SPS), etc. The objective of the present work is to fabricate aluminium based MMNCs with the addition of small amounts of yttrium using Spark Plasma Sintering and to evaluate their mechanical and microstructure properties. Samples of 2024 AA with yttrium ranging from 0.1% to 0.5 wt% are fabricated by Spark Plasma Sintering (SPS). Hardness of the samples is determined using Vickers hardness testing machine. The metallurgical characterization of the samples is evaluated by Optical Microscopy (OM), Field Emission Scanning Electron Microscopy (FE-SEM). Unreinforced 2024 AA sample is also fabricated as a benchmark to compare its properties with those of the composite developed. It is found that the yttrium addition increases the above mentioned properties by altering the precipitation kinetics and intermetallic formation to some extent and then decreases gradually when yttrium wt% increases beyond 0.3 wt%. High density (˂ 99.75) is achieved in the samples and highest hardness achieved is 114 Hv, fabricated by spark plasma sintering and uniform distribution of yttrium is observed.
-
DEFF Research Database (Denmark)
Jurado, Esperanza; Hansen, Mads A.T.; Gavala, Hariklia N.
2013-01-01
and accessible during subsequent anaerobic digestion. This finding has confirmed earlier experimental results, showing that delignification was not necessarily the limiting factor during conversion of manure fibers into methane while cellulose accessibility during digestion seemed more crucial.......AAS treatment is a very efficient method to increase the methane potential of manure fibers. The chemical composition and supramolecular structures of swine manure fibers before and after AAS treatment was investigated in this study. Composition analyses, atomic force microscopy (AFM), scanning...
-
van Goor, Saskia A; Dijck-Brouwer, D A Janneke; Fokkema, M Rebecca; van der Iest, Theo Hans; Muskiet, Frits A J
We investigated essential fatty acids (EFA) and long-chain polyunsaturated fatty acids (LCP) in maternal and fetal brain as a function of EFA/LCP availability to the feto-maternal unit in mice. Diets varying in parent EFA, arachidonic acid (AA), and docosahexaenoic acid (DHA) were administered from
-
Long term immersion test of aluminum alloy AA 6061 used for fuel cladding in MTR type reactors
International Nuclear Information System (INIS)
Linardi, Evelina M.; Rodriguez, Sebastian; Haddad, Roberto; Lanzani, Liliana
2009-01-01
In this work we present the results of long term immersion tests performed in the aluminum alloy AA 6061, used for fuel cladding in MTR type reactors. The tests were performed at open circuit potential in high purity water (ρ = 18.2 MΩ.cm) and in 10 -3 M NaCl solution. Two kinds of assemblies were studied: simple sheets and artificial crevices, immersed during 6, 12 and 18 months at room temperature. In both media and both assemblies, the aluminum hydroxide phases crystalline bayerite and bohemite were identified. It was found that a kind of localized attack named alkaline attack occurs around the iron-rich intermetallics. These particles were confirmed to control the corrosion of the AA 6061 alloy in an aerated medium. Immersion times for up to 18 months did not increase the oxide growth or the alkaline attack on the AA 6061 alloy. (author)
-
Takahama, Shokichi; Adetunji, Modupe O; Zhao, Tantai; Chen, Shan; Li, Wei; Tomarev, Stanislav I
2017-09-01
Our previous experiments demonstrated that intravitreal injection of platelet-derived growth factor-AA (PDGF-AA) provides retinal ganglion cell (RGC) neuroprotection in a rodent model of glaucoma. Here we used PDGFRα-enhanced green fluorescent protein (EGFP) mice to identify retinal cells that may be essential for RGC protection by PDGF-AA. PDGFRα-EGFP mice expressing nuclear-targeted EGFP under the control of the PDGFRα promoter were used. Localization of PDGFRα in the neural retina was investigated by confocal imaging of EGFP fluorescence and immunofluorescent labeling with a panel of antibodies recognizing different retinal cell types. Primary cultures of mouse RGCs were produced by immunopanning. Neurobiotin injection of amacrine cells in a flat-mounted retina was used for the identification of EGFP-positive amacrine cells in the inner nuclear layer. In the mouse neural retina, PDGFRα was preferentially localized in the ganglion cell and inner nuclear layers. Immunostaining of the retina demonstrated that astrocytes in the ganglion cell layer and a subpopulation of amacrine cells in the inner nuclear layer express PDGFRα, whereas RGCs (in vivo or in vitro) did not. PDGFRα-positive amacrine cells are likely to be Type 45 gamma-aminobutyric acidergic (GABAergic) wide-field amacrine cells. These data indicate that the neuroprotective effect of PDGF-AA in a rodent model of glaucoma could be mediated by astrocytes and/or a subpopulation of amacrine cells. We suggest that after intravitreal injection of PDGF-AA, these cells secrete factors protecting RGCs.
-
van Goor, S A; Schaafsma, A; Erwich, J J H M; Dijck-Brouwer, D A J; Muskiet, F A J
2010-01-01
We showed that docosahexaenoic acid (DHA) supplementation during pregnancy and lactation was associated with more mildly abnormal (MA) general movements (GMs) in the infants. Since this finding was unexpected and inter-individual DHA intakes are highly variable, we explored the relationship between GM quality and erythrocyte DHA, arachidonic acid (AA), DHA/AA and Mead acid in 57 infants of this trial. MA GMs were inversely related to AA, associated with Mead acid, and associated with DHA/AA in a U-shaped manner. These relationships may indicate dependence of newborn AA status on synthesis from linoleic acid. This becomes restricted during the intrauterine period by abundant de novo synthesis of oleic and Mead acids from glucose, consistent with reduced insulin sensitivity during the third trimester. The descending part of the U-shaped relation between MA GMs and DHA/AA probably indicates DHA shortage next to AA shortage. The ascending part may reflect a different developmental trajectory that is not necessarily unfavorable. Copyright 2009 Elsevier Ltd. All rights reserved.
-
Energy Technology Data Exchange (ETDEWEB)
Guido, V.; Oliveira, A.C. de; Travessa, D.N.; Cardoso, K.R., E-mail: vane.guid@gmail.com [Universidade Federal de Sao Paulo (USP), Sao Jose dos Campos, SP (Brazil). Instituto de Ciencia e Tecnologia
2014-07-01
This paper presents an alternative solid state route to recycling AA2050 aeronautical aluminium alloy chips. The first stage in the recycling process, reported in this work, is the obtainment of the alloy powder by high energy ball milling to subsequent cold pressing and hot extrusion. The process started with the cleaning of chips with the aim of contaminant removing from machining process and transport, followed by the high energy ball milling to result in the AA2050 alloy powder. The powder obtained was characterized by laser size particle analysis, scanning electron microscopy (SEM), X-Ray diffraction (DRX) and inductively coupled plasma atomic emission spectroscopy (ICP-AES). The results show the feasibility of obtaining a powder having appropriate particle size and chemical composition in accordance with the specification for alloy. (author)
-
Directory of Open Access Journals (Sweden)
Sinan SEZEK
2017-02-01
Full Text Available AA5454-O is an easily wrought, or in other words, a ductile aluminium alloy, however, its mechanical properties are inferior as compared to those of other alloys. The change taking place in corrosion resistance of AA5454-O alloy as a result of its severe plastic deformation (SPD by rolling has been investigated in this study. It has been observed that significant changes occurred in abrasion wear and corrosion resistances of AA5454-O alloy, which was severely deformed up to 80 % by rolling process. Corrosion resistance of the alloy that was severely deformed by rolling has increased. The effect of deformation rate on corrosion has been investigated by applying potentiodynamic test whereas on the other hand such change has been evidenced also through corrosion test. It has been observed that friction coefficient of severely deformed AA5454-O alloy varied by around 10 %, and that, associated with such change, its wear resistance also increased considerably. It has been determined that, as a result of severe deformation by rolling, hardness values rose in areas where the alloy was in contact with rolling surface. In this study, wear resistance of severely deformed alloy has been investigated as well. It has been observed that deformation value contributed positively to the increase in wear resistance.DOI: http://dx.doi.org/10.5755/j01.ms.23.1.14650
-
Oppert, Brenda; Martynov, Alexander G; Elpidina, Elena N
2012-09-01
The yellow mealworm, Tenebrio molitor, is a pest of stored grain products and is sensitive to the Bacillus thuringiensis (Bt) Cry3Aa toxin. As digestive peptidases are a determining factor in Cry toxicity and resistance, we evaluated the expression of peptidase transcripts in the midgut of T. molitor larvae fed either a control or Cry3Aa protoxin diet for 24 h (RNA-Seq), or in larvae exposed to the protoxin for 6, 12, or 24 h (microarrays). Cysteine peptidase transcripts (9) were similar to cathepsins B, L, and K, and their expression did not vary more than 2.5-fold in control and Cry3Aa-treated larvae. Serine peptidase transcripts (48) included trypsin, chymotrypsin and chymotrypsin-like, elastase 1-like, and unclassified serine peptidases, as well as homologs lacking functional amino acids. Highly expressed trypsin and chymotrypsin transcripts were severely repressed, and most serine peptidase transcripts were expressed 2- to 15-fold lower in Cry3Aa-treated larvae. Many serine peptidase and homolog transcripts were found only in control larvae. However, expression of a few serine peptidase transcripts was increased or found only in Cry3Aa-treated larvae. Therefore, Bt intoxication significantly impacted the expression of serine peptidases, potentially important in protoxin processing, while the insect maintained the production of critical digestive cysteine peptidases. Published by Elsevier Inc.
-
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session 2015 Newton Lacy Pierce Prize Lecture: The Elephant in the Room: Effects of Distant, Massive Companions on Planetary System Architectures (by Leonardo dos Santos)The first session on Wednesday at 228th AAS Meeting was the Newton Lacy Pierce Prize Lecture by Heather Knutson (California Institute of Technology). This talk featured a broad range of research efforts on exoplanets, with the main focus on how we study the composition of their atmospheres, and how multi-body interactions carve the structure of the planetary systems we observe.One of her first points is the well-known idea that the Solar System is an oddball, compared to the exoplanet systems we have found so far: most of these systems contain hot Jupiters and mini-Neptunes at very close-in orbits around their host stars. Moreover, even when studying their transmission spectra, it is difficult to know the exact composition of their atmospheres.Knutson: it is difficult to constrain atmospheric composition of exoplanets (H-poor or H-rich+clouds?) #aas228pic.twitter.com/LdyN4o9RC7 astrobites (@astrobites) June 15, 2016The main proposal on how these systems formed is the migration scenario. In order to validate this idea, Dr. Knutson and her group The Friends of Hot Jupiters study systems with close-in gas giants and their frequency of binary companions, which are supposed to be the main culprits causing gas-giant migration. They found that approximately half of the observed systems have long-distance companions, providing strong validation of the migration scenario. Moreover, Dr. Knutson speculates that wide binaries have more
-
Effect of two-step aging on the mechanical properties of AA2219 DC cast alloy
Energy Technology Data Exchange (ETDEWEB)
Elgallad, E.M., E-mail: eelgalla@uqac.ca; Zhang, Z.; Chen, X.-G.
2015-02-11
With its combination of high specific strength, good machinability and excellent weldability, AA2219 direct chill (DC) cast alloy has become a new category of materials for manufacturing large molds for the plastics and automotive industries. The effect of two-step aging on the microstructural evolution and mechanical properties of AA2219 DC cast alloy was investigated. The precipitate microstructure was characterized under different heat treatment conditions using differential scanning calorimetry (DSC) and transmission electron microscopy (TEM). The poor mechanical properties of the air-quenched alloy were attributed to the presence of quench-induced coarse θ′ and θ precipitates, which had very limited contribution to the precipitation hardening during the aging treatment. The two-step aging treatment of the air-quenched AA2219 alloy involved the precipitation of GP zones in the first step followed by their transformation into fine θ″ strengthening precipitates in the second step, which considerably improved the mechanical properties. After undergoing 120 °C/36 h+190 °C/8 h two-step aging, the hardness, YS and UTS of the air-quenched alloy were increased by 27%, 46% and 15%, respectively, compared with 190 °C/8 h one-step aging.
-
An Auger and XPS survey of cerium active corrosion protection for AA2024-T3 aluminum alloy
Energy Technology Data Exchange (ETDEWEB)
Uhart, A. [IPREM-ECP-UMR CNRS 5254, Université de Pau et des Pays de l' Adour, Technopole Hélioparc, 2 Avenue Président Pierre Angot, 64053 Pau Cedex 09 (France); Ledeuil, J.B. [IPREM-ECP-UMR CNRS 5254, Université de Pau et des Pays de l' Adour, Technopole Hélioparc, 2 Avenue Président Pierre Angot, 64053 Pau Cedex 09 (France); Université de Toulouse, UPS-INP-CNRS, Institut Carnot CIRIMAT, 118 Route de Narbonne, 31062 Toulouse Cedex 09 (France); Gonbeau, D. [IPREM-ECP-UMR CNRS 5254, Université de Pau et des Pays de l' Adour, Technopole Hélioparc, 2 Avenue Président Pierre Angot, 64053 Pau Cedex 09 (France); Dupin, J.C., E-mail: dupin@univ-pau.fr [IPREM-ECP-UMR CNRS 5254, Université de Pau et des Pays de l' Adour, Technopole Hélioparc, 2 Avenue Président Pierre Angot, 64053 Pau Cedex 09 (France); Bonino, J.P.; Ansart, F. [Université de Toulouse, UPS-INP-CNRS, Institut Carnot CIRIMAT, 118 Route de Narbonne, 31062 Toulouse Cedex 09 (France); Esteban, J. [Messier-Bugatti-Dowty, Etablissement de Molsheim, 3, rue Antoine de St Exupéry, 67129 Molsheim (France)
2016-12-30
Graphical abstract: Coupled SAM/SEM survey of cerium inhibitor migration towards corrosion pits in a conversion coating over AA2024-T3 substrate. - Highlights: • XPS evidenced the proximity of the inhibitor with the surface AA2024 alloy. • Cerium conversion coatings with [Ce] = 0.1 M offer the best corrosion resistance. • SAM shown the migration of Ce + III entities towards the corrosion pits or crevices. • High resolution analyses (Auger) connecting the nano-scale order with the chemical distribution.
-
Surface oxide formation during corona discharge treatment of AA 1050 aluminium surfaces
DEFF Research Database (Denmark)
Minzari, Daniel; Møller, Per; Kingshott, Peter
2008-01-01
process modifies aluminium AA 1050 surface, the oxide growth and resulting corrosion properties. The corona treatment is carried out in atmospheric air. Treated surfaces are characterized using XPS, SEM/EDS, and FIB-FESEM and results suggest that an oxide layer is grown, consisting of mixture of oxide...
-
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.6649; Contig19-10251; complement(36800..38461); BR...87398.1| ... TFIIB related subunit of TFIIIB (BRF1) [Candida ... albicans] pir||B55483 transcr...L Transcription factor IIIB 70 kDa ... subunit (TFIIIB) (B-related factor)
-
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2029; Contig19-10139; 79190..80278; RFC5*; DNA replicationn factor C | lead...ing strand elongation mismatch repair ... (ATPase); >1a5t0 2 329 7 339 1e-22 ... gb|EAL00
-
Directory of Open Access Journals (Sweden)
Per Westermark
Full Text Available BACKGROUND: Mouse AA-amyloidosis is a transmissible disease by a prion-like mechanism where amyloid fibrils act by seeding. Synthetic peptides with no amyloid relationship can assemble into amyloid-like fibrils and these may have seeding capacity for amyloid proteins. PRINCIPAL FINDINGS: Several synthetic peptides, designed for nanotechnology, have been examined for their ability to produce fibrils with Congo red affinity and concomitant green birefringence, affinity for thioflavin S and to accelerate AA-amyloidosis in mice. It is shown that some amphiphilic fibril-forming peptides not only produced Congo red birefringence and showed affinity for thioflavin S, but they also shortened the lag phase for systemic AA-amyloidosis in mice when they were given intravenously at the time of inflammatory induction with silver nitride. Peptides, not forming amyloid-like fibrils, did not have such properties. CONCLUSIONS: These observations should caution researchers and those who work with synthetic peptides and their derivatives to be aware of the potential health concerns.
-
Directory of Open Access Journals (Sweden)
Carlos Nava Quiroz***
2010-03-01
Full Text Available RESUMENEntre los factores de riesgo de inicio al consumo de alcohol se encuentra el déficit en habilidades sociales, que aunqueno es determinante, sí es un factor que de alguna manera influye en la conducta de beber en exceso. En la presenteinvestigación se realizó un análisis de habilidades sociales en tres muestras distintas: universitarios, adolescentes y alcohólicosen recuperación (AA. Se utilizaron los siguientes instrumentos: Escala Multidimensional de Expresión Social – ParteMotora (EMES-M: Caballo, 1987, 2006 y la Escala Multidimensional de Expresión Social – Parte Cognitiva (EMES-C:Caballo, 1987, 2006. Estas escalas se aplicaron a una muestra de 157 participantes (74 hombres y 83 mujeres. Se distribuyeronde la siguiente forma: 58 adolescentes (estudiantes de secundaria, 55 integrantes de AA y 44 estudiantes universitarios. Seencontraron diferencias significativas entre algunas subescalas y los diferentes grupos de referencia. La mayoría de estasdiferencias se encontraron en cuanto a habilidades sociales de corte cognitivo. El grupo de alcohólicos AA marcó ladiferencia, mostrando éstos una mayor puntuación en las subescalas que indican «temor» o «preocupación» en ciertassituaciones sociales. Se discuten estos resultados y las implicaciones de éstos para el tratamiento y prevención del alcoholismo.ABSTRACTAmong the risk factors for alcohol use initiation is the deficit in social skills, which while not conclusive, if it is a factorthat somehow influences the behavior of excessive drinking. In the present study it conducted an analysis of social skills inthree different samples: college, young people and alcoholics in recovery (AA. The following instruments were used:Multidimensional Scale of Social Expression-Motor Part (EMES-M: Horse, 1987 and Multidimensional Scale of SocialExpression-Cognitive Part (EMES-C: Caballo, 1987. These scales were applied to a sample of 157 participants (74 menand 83 women and they
-
Paas, Kadri, 1982-
2009-01-01
Seaduseelnõust, mille eesmärgiks on tõhustada võitlust kartellidega ja muude raskete konkurentsiõiguse rikkumistega nn leebusprogrammi abil. Kommenteerivad peaprokurör Norman Aas ja Juhan Põldroos
-
Production and characterization of AA6061-B4C stir cast composite
International Nuclear Information System (INIS)
Kalaiselvan, K.; Murugan, N.; Parameswaran, Siva
2011-01-01
Highlights: → Stir casting of AA6061-B 4 C Composite. Color metallographic of composites → Enhanced wetting of B 4 C particles by K 2 TiF 6 flux. → Effect of B 4 C particles on mechanical properties of AA6061. -- Abstract: This work focuses on the fabrication of aluminum (6061-T6) matrix composites (AMCs) reinforced with various weight percentage of B 4 C particulates by modified stir casting route. The wettability of B 4 C particles in the matrix has been improved by adding K 2 TiF 6 flux into the melt. The microstructure and mechanical properties of the fabricated AMCs are analyzed. The optical microstructure and scanning electron microscope (SEM) images reveal the homogeneous dispersion of B 4 C particles in the matrix. The reinforcement dispersion has also been identified with X-ray diffraction (XRD). The mechanical properties like hardness and tensile strength have improved with the increase in weight percentage of B 4 C particulates in the aluminum matrix.
-
Figure Types in the AAS Journals: A Treasure Trove of Unmined Data
Schwarz, Greg
2013-01-01
I present an analysis of the types of figures submitted to the AAS Journals as the prelude of a long term AAS project to capture more of the supporting data. Figures can be classified into 3 broad categories, diagrams, line art, and images. Diagrams are schematic, drawings, or illustrations and are meant to convey purely visual information. There is no intrinsic machine readable data underlying them. Line art and images, on the other hand, are snapshots of the larger underlying observational and model generated data sets. The advantages of including more data in a Virtual Observatory supported format is obvious for the reader but would also be an advantage for the author through greater visibility and thus higher citation counts. In this poster I present statistics from the August 2012 Astronomical Journal (V144 n2) and September 10th, 2012 Astrophysical Journal (v756 n2) issues and outline the near term challenges in capturing this "missing mass".
-
T6 and T78 tempers of AA6065 alloy: a quantitative TEM study
Energy Technology Data Exchange (ETDEWEB)
Tanaka, M.; Warner, T. [Compagnie de Produits Chimiques et Electrometallurgiques Pechiney, Centre de Recherches de Voreppe, 38 (France)
2000-07-01
Quantitative transmission electron microscopy is used to characterize the microstructure of an industrial Al-Mg-Si-Cu alloy (AA6056) in a state (T78 temper) desensitized to intergranular corrosion in comparison with the peak aged state (T6 temper). Analysis of dark-field images and of zero-loss filtered selected-area-diffraction patterns, along with EDX spectroscopy, indicates an advanced precipitation of the quaternary phase containing Si and Cu in the T78-tempered alloy compared to the T6 one. This supports the current theory of the desensitization of AA6056 alloy. However, the application of EDX analysis to provide direct evidence of the chemical composition variation in the solid solution across the grain boundary appears less satisfactory. (orig.)
-
Directory of Open Access Journals (Sweden)
Lőrinc S Pongor
Full Text Available Next generation sequencing (NGS of PCR amplicons is a standard approach to detect genetic variations in personalized medicine such as cancer diagnostics. Computer programs used in the NGS community often miss insertions and deletions (indels that constitute a large part of known human mutations. We have developed HeurAA, an open source, heuristic amplicon aligner program. We tested the program on simulated datasets as well as experimental data from multiplex sequencing of 40 amplicons in 12 oncogenes collected on a 454 Genome Sequencer from lung cancer cell lines. We found that HeurAA can accurately detect all indels, and is more than an order of magnitude faster than previous programs. HeurAA can compare reads and reference sequences up to several thousand base pairs in length, and it can evaluate data from complex mixtures containing reads of different gene-segments from different samples. HeurAA is written in C and Perl for Linux operating systems, the code and the documentation are available for research applications at http://sourceforge.net/projects/heuraa/
-
Directory of Open Access Journals (Sweden)
W Aperador Chaparro
2013-03-01
Full Text Available This article presents various techniques for assessing corrosion, the linear polarization resistance and galvanostatic pulse, the analysis was performed using analysis of variance models using a factorial experiment with three factors, one repeated measure, because on the same experimental unit (reinforced concrete, it experienced several samples to be measured in time (0 h=1, 350 h=2, 700 h=3, 1050 h=4, 1700 h=5 y 2600 h=6. This makes the observations are not independent, the other two factors relate to, the binder (ce: 1 = activatedslag [AAS] and 2 = ordinary Portland concrete [OPC] and the exposure condition (ca: 1 = y 2 = environmental exposure accelerated carbonation. These factors were discussed according to the results of the electrochemical properties. Initially performed the statistical processing of each of the variables in relation to the properties and analyzed the interaction between them. Where they established the differences in materials used as coating steel, concrete, OPC and AAS. OPC concrete specimens, exhibited a resting potential, polarization resistance and ohmic (CO2 condition than those obtained for reinforced concrete in AAS.En este artículo se presentan las técnicas de evaluación de la corrosión, tales como potencial de corrosión, resistencia lineal a la polarización y pulso galvanostático a los concretos de activación alcalina (AAS y Portland tipo I (OPC. El estudio se realizó por medio de modelos de análisis de varianza, aplicando un experimento factorial con tres factores, uno de ellos medida repetida, debido a que sobre la misma unidad experimental (concreto armado AAS y OPC se ensayaron varias muestras para medirlas en el tiempo (0 h=1, 350 h=2, 700 h=3, 1050 h=4, 1700 h=5 y 2600 h=6, lo que hace que las observaciones no sean independientes; los otros dos factores corresponden al cementante (ce: 1=escoria activada alcalinamente [AAS] y 2=concreto Portland ordinario [OPC] y la condición de exposici
-
Bugge, Annechen Bahr
2010-01-01
Denne studien er en del av forskningsprosjektene Young Food og HealthMeal. Begge prosjektene er finansiert av Norges forskningsråd. Temaet i rapporten er nordmenns spise- og drikkemønster av en type mat og drikke som helsemyndighetene ønsker at befolkningen skal redusere forbruket sitt av – slik som sjokolade, søtsaker, søte bakervarer, salt snacks og sukkerholdige drikker. Selv om forbruksutviklingen de seneste par årene har vist positive tendenser, har altså nordmenn fremdeles et langt høye...
-
Professional Ethics in Astronomy: The AAS Ethics Statement
Marvel, Kevin B.
2013-01-01
It is fundamental to the advancement of science that practicing scientists adhere to a consistent set of professional ethical principles. Recent violations of these principles have led a decreased trust in the process of science and scientific results. Although astronomy is less in the spotlight on these issues than medical science or climate change research, it is still incumbent on the field to follow sound scientific process guided by basic ethical guidelines. The American Astronomical Society, developed a set of such guidelines in 2010. This contribution summarizes the motivation and process by which the AAS Ethics Statement was produced.
-
de Bono, Johann S; Smith, Matthew R; Saad, Fred; Rathkopf, Dana E; Mulders, Peter F A; Small, Eric J; Shore, Neal D; Fizazi, Karim; De Porre, Peter; Kheoh, Thian; Li, Jinhui; Todd, Mary B; Ryan, Charles J; Flaig, Thomas W
2017-04-01
Treatment patterns for metastatic castration-resistant prostate cancer (mCRPC) have changed substantially in the last few years. In trial COU-AA-302 (chemotherapy-naïve men with mCRPC), abiraterone acetate plus prednisone (AA) significantly improved radiographic progression-free survival and overall survival (OS) when compared to placebo plus prednisone (P). This post hoc analysis investigated clinical responses to docetaxel as first subsequent therapy (FST) among patients who progressed following protocol-specified treatment with AA, and characterized subsequent treatment patterns among older (≥75 yr) and younger (AA arm received subsequent treatment with one or more agents approved for mCRPC. Efficacy analysis was performed for patients for whom baseline and at least one post-baseline prostate-specific antigen (PSA) values were available. Baseline and at least one post-baseline PSA values were available for 100 AA patients who received docetaxel as FST. While acknowledging the limitations of post hoc analyses, 40% (40/100) of these patients had an unconfirmed ≥50% PSA decline with first subsequent docetaxel therapy, and 27% (27/100) had a confirmed ≥50% PSA decline. The median docetaxel treatment duration among these 100 patients was 4.2 mo. Docetaxel was the most common FST among older and younger patients from each treatment arm. However, 43% (79/185) of older patients who progressed on AA received no subsequent therapy for mCRPC, compared with 17% (60/361) of younger patients. Patients with mCRPC who progress with AA treatment may still derive benefit from subsequent docetaxel therapy. These data support further assessment of treatment patterns following AA treatment for mCRPC, particularly among older patients. ClinicalTrials.gov NCT00887198. Treatment patterns for advanced prostate cancer have changed substantially in the last few years. This additional analysis provides evidence of clinical benefit for subsequent chemotherapy in men with advanced
-
Influence of surface pretreatment in resistance spot welding of aluminum AA1050
DEFF Research Database (Denmark)
Al Naimi, Ihsan K.; Al Saadi, Moneer H.; Daws, Kasim M.
2015-01-01
quality. An experimental study of the influence of pretreatment on weld quality in RSW of AA1050 sheets with three thicknesses, comparing welding of as-received sheet with pretreated sheet by either pickling in NaOH or glass-blasting were investigated. Different weld settings were applied with low...
-
Energy Technology Data Exchange (ETDEWEB)
Kumar, A. [Department of Mechanical Engineering, National Institute of Technology, Warangal 506 004 (India)], E-mail: adepu_kumar7@yahoo.co.in; Sundarrajan, S. [Scientist ' G' , Defence Research and Development Laboratory, Hyderabad 500 028 (India)
2009-04-15
The present work pertains to the improvement of mechanical properties of AA 5456 Aluminum alloy welds through pulsed tungsten inert gas (TIG) welding process. Taguchi method was employed to optimize the pulsed TIG welding process parameters of AA 5456 Aluminum alloy welds for increasing the mechanical properties. Regression models were developed. Analysis of variance was employed to check the adequacy of the developed models. The effect of planishing on mechanical properties was also studied and observed that there was improvement in mechanical properties. Microstructures of all the welds were studied and correlated with the mechanical properties.
-
International Nuclear Information System (INIS)
Kumar, A.; Sundarrajan, S.
2009-01-01
The present work pertains to the improvement of mechanical properties of AA 5456 Aluminum alloy welds through pulsed tungsten inert gas (TIG) welding process. Taguchi method was employed to optimize the pulsed TIG welding process parameters of AA 5456 Aluminum alloy welds for increasing the mechanical properties. Regression models were developed. Analysis of variance was employed to check the adequacy of the developed models. The effect of planishing on mechanical properties was also studied and observed that there was improvement in mechanical properties. Microstructures of all the welds were studied and correlated with the mechanical properties
-
Energy Technology Data Exchange (ETDEWEB)
Cardoso, K.R.; Guido, V. [Universidade do Vale do Paraiba (UNIVAP), Sao Jose dos Campos, SP (Brazil). Inst. de Pesquisa e Desenvolvimento; Travessa, D.N. [Empresa Brasileira de Aeronautica (EMBRAER), Sao Jose dos Campos, SP (Brazil); Jorge Junior, A.M. [Universidade Federal de Sao Carlos (DEMa/UFSCar), SP (Brazil). Dept. de Engenharia de Materiais
2010-07-01
The commercial AA7050 aluminium alloy in the solution heat treated condition (W) was processed by ECAP through route A. Two pressing temperatures (room and 150 deg C and velocities (5 and 30mm/min) were used, as well as different number of passes. The effect of such variables on the microstructure evolution was evaluated using optical and transmission electron microscopy with EDX microanalysis, and xray diffraction. It was found that the microstructure has been refined by ECAP, as a result of subgrains formed within deformation bands. ECAP at 150 deg C resulted in intense precipitation of plate like {eta} phase, which evolves to equiaxial morphology as the number of passes increases. (author)
-
Dopaminergic modulation of reward-guided decision making in alcohol-preferring AA rats.
Oinio, Ville; Bäckström, Pia; Uhari-Väänänen, Johanna; Raasmaja, Atso; Piepponen, Petteri; Kiianmaa, Kalervo
2017-05-30
R**esults from animal gambling models have highlighted the importance of dopaminergic neurotransmission in modulating decision making when large sucrose rewards are combined with uncertainty. The majority of these models use food restriction as a tool to motivate animals to accomplish operant behavioral tasks, in which sucrose is used as a reward. As enhanced motivation to obtain sucrose due to hunger may impact its reward-seeking effect, we wanted to examine the decision-making behavior of rats in a situation where rats were fed ad libitum. For this purpose, we chose alcohol-preferring AA (alko alcohol) rats, as these rats have been shown to have high preference for sweet agents. In the present study, AA rats were trained to self-administer sucrose pellet rewards in a two-lever choice task (one pellet vs. three pellets). Once rational choice behavior had been established, the probability of gaining three pellets was decreased over time (50%, 33%, 25% then 20%). The effect of d-amphetamine on decision making was studied at every probability level, as well as the effect of the dopamine D 1 receptor agonist SKF-81297 and D 2 agonist quinpirole at probability levels of 100% and 25%. d-Amphetamine increased unprofitable choices in a dose-dependent manner at the two lowest probability levels. Quinpirole increased the frequency of unprofitable decisions at the 25% probability level, and SKF-82197 did not affect choice behavior. These results mirror the findings of probabilistic discounting studies using food-restricted rats. Based on this, the use of AA rats provides a new approach for studies on reward-guided decision making. Copyright © 2017 Elsevier B.V. All rights reserved.
-
International Nuclear Information System (INIS)
Balasubramanian, I.; Maheswaran, R.
2015-01-01
Highlights: • AA6063/SiC composites with different weight percent are stir cast. • Resistance properties against indentation, stretching force and sliding force are studied. • Increase in initiation of cleavage facets and reduces the tensile strength for 15% SiC. • Transition from micro ploughing to micro cutting wear mechanism is less due to SiC inclusion. - Abstract: This study investigates the mechanical resistance behaviour of AA6063 particulate composites with the inclusion of micron-sized silicon carbide (SiC) particles with different weight percentages in an AA6063 aluminium matrix. AA6063/SiC particulate composites containing 0, 5, 10, and 15 weight percent of SiC particles were produced by stir casting. Standard mechanical tests were conducted on the composite plates, and the mechanical resistance to indentation, tensile force and sliding force are evaluated. It has been observed that upon addition of SiC particles, the resistance against indentation is increased and the resistance against tensile force is initially increased and then decreased. Furthermore, using scanning electron microscopy (SEM), the fracture appearance of the broken specimen subjected to tensile force and morphological changes in the surface subjected to sliding force are analysed. The SEM images reveal that the addition of SiC particles in the AA6063 aluminium matrix initiates more cleavage facets. This leads to brittle fracture in the specimen subjected to tensile forces and less transition from material displacement to material removal in the specimen subjected to sliding forces
-
The effect of drilling parameters for surface roughness in drilling of AA7075 alloy
Directory of Open Access Journals (Sweden)
Yaşar Nafiz
2017-01-01
Full Text Available AA7075 aluminum alloy has been very popular significantly interest in the production of structural components in automotive and aviation applications due to its high strength, low density, good plasticity and better machinability comparable to many metals. Particularly, final products must have uniformly high quality to ensure essential safety standards in the aircraft industry. The optimization of hole quality which can variable according to tool geometry and drilling parameters is important in spite of high machinability rate of AA7075 alloy. In this study, the effects of drilling parameters on average surface roughness (Ra has been investigated in drilling of AA7075 with tungsten carbide drills. Machining experiments were performed with three different drill point angles and three different levels of cutting parameters (feed rate, cutting speed. The effects of drilling parameters on thrust force has been determined with ANOVA in %95 confidence level. Feed rate was determined as the most important factor on Ra according to ANOVA results. Moreover, it was shown that increasing feed rate leads to increase of Ra while increasing drill point angle leads to decrease of Ra. The optimum surface roughness was obtained with point angle of 130°, cutting speed of 40 m/min and feed rate of 0.1 mm/rev, thereby the validity of optimization was confirmed with Taguchi method.
-
Anodic galvanostatic polarization of AA2024-T3 aircraft alloy in conventional mineral acids
Energy Technology Data Exchange (ETDEWEB)
Kozhukharov, S., E-mail: stephko1980@abv.bg [Department of Chemical Sciences, University of Chemical Technology and Metallurgy, 8 “Kliment Okhridski” Blvd, 1756, Sofia (Bulgaria); Girginov, Ch. [Department of Chemical Sciences, University of Chemical Technology and Metallurgy, 8 “Kliment Okhridski” Blvd, 1756, Sofia (Bulgaria); Avramova, I. [Institute of General and Inorganic Chemistry, Bulgarian Academy of Science, 11 “Georgi Bonchev” Str., 1113, Sofia (Bulgaria); Machkova, M. [Department of Chemical Sciences, University of Chemical Technology and Metallurgy, 8 “Kliment Okhridski” Blvd, 1756, Sofia (Bulgaria)
2016-09-01
The present study is devoted to the determination of the impact of the anodization of AA2024-T3 alloys in HCl, HNO{sub 3}, H{sub 2}SO{sub 4} or H{sub 3}PO{sub 4} on the samples’ surface morphology and properties. Subsequent systematic assessments were performed by Scanning Electron Microscopy (SEM), Energy Dispersion X-Ray Spectroscopy (EDX) and X-ray Photoelectron Spectroscopy (XPS). These observations were combined with Linear Voltammetry (LVA) and Electrochemical Impedance Spectroscopy (EIS) after 48 and 168 h of exposure to a 3.5% NaCl model corrosive medium. The main result is, that completely different effects were observed in accordance to the acid used. It was established that the monoprotonic acids have a deep destructive effect due to dissolution of the alloy components, whereas the polyprotonic ones possess either indistinguishable influence, or surface film formation. - Highlights: • AA2024 was polarized anodically in 15%{sub wt} acid solutions at 15 mA cm{sup −2} for 2 h. • Four mineral acids were selected for investigation: HCl, HNO{sub 3}, H{sub 2}SO{sub 4} and H{sub 3}PO{sub 4}. • SEM, EDX and XPS were applied for morphological description. • Electrochemical characterizations were performed by EIS and linear voltammetry. • The acid used predetermines completely different interaction with the AA2024 alloy.
-
International Nuclear Information System (INIS)
Li, Z.; Samuel, A.M.; Samuel, F.H.; Ravindran, C.; Doty, H.W.; Valtierra, S.
2004-01-01
The Charpy impact energy of Al-Si-Cu AA319-type alloys was measured in terms of the total absorbed energy. The Charpy specimens were machined from end-chilled castings to incorporate the effect of cooling rate on the impact properties. Unnotched specimens were used to increase the accuracy of the measurements, and to emphasize the effect of microstructure. The influence of the microconstituents on the impact strength was investigated by adding various alloying elements (i.e. Sr, Fe, and P) to the AA319 base alloy, and applying two different heat treatments (T5, and T6). The results show that strontium-modification enhances the impact properties, so that the Sr-modified AA319 alloy exhibits the highest impact properties compared to the base, and other alloys at any given dendrite arm spacing (DAS). The impact energy increases with increase in cooling rate, while iron, and phosphorus additions have a detrimental influence due, respectively, to the formation of β-Al 5 FeSi, and phosphorus oxide particles during solidification. T6 treatment assists in the even distribution, and dissolution of the microconstituents (including the block-like CuAl 2 particles) into the aluminum matrix. With more Cu available for strengthening during aging, the impact toughness is greatly enhanced. In the unmodified AA319 base alloy, crack initiation, and propagation occur mainly through Si-particle fracture, and the mechanism of void coalescence. In the Sr-modified, 1.2% Fe-containing 319 alloys, however, crack initiation takes place through fragmentation of β-Al 5 FeSi, Si, and CuAl 2 or Cu 2 FeAl 7 particles. Crack propagation occurs through cleavage of the β-Fe platelets, and fracture of the Cu-intermetallics, and brittle Si particles. Such samples exhibit very low impact energies
-
Inside Hall 193 for the Antiproton Accumulator (AA) ring
1979-01-01
Installation work is in full swing. A model quadrupole on the left shows where the magnet ring will be. The cables wound on drums are part of the pulse-forming network for the injection kicker. See Annual Report 1979 p. 103, Fig. 9 and photo 7911303. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
-
Han, Bing; Wang, Tong-Dan; Shen, Shao-Ming; Yu, Yun; Mao, Chan; Yao, Zhu-Jun; Wang, Li-Shun
2015-01-01
Background Annonaceous acetogenins are a family of natural products with antitumor activities. Annonaceous acetogenin mimic AA005 reportedly inhibits mammalian mitochondrial NADH-ubiquinone reductase (Complex I) and induces gastric cancer cell death. However, the mechanisms underlying its cell-death-inducing activity are unclear. Methods We used SW620 colorectal adenocarcinoma cells to study AA005 cytotoxic activity. Cell deaths were determined by Trypan blue assay and flow cytometry, and rel...
-
Perri, Valentina; Gianchecchi, Elena; Cifaldi, Loredana; Pellegrino, Marsha; Giorda, Ezio; Andreani, Marco; Cappa, Marco; Fierabracci, Alessandra
2017-01-01
Type 1 diabetes is an autoimmune disease, in which pancreatic β cells are destroyed by autoreactive T cells in genetically predisposed individuals. Serum beta cell autoantibody specificities have represented the mainstay for classifying diabetes as autoimmune-mediated and for stratifying risk in first-degree relatives. In recent years, approaches were attempted to solve the difficult issue of detecting rare antigen-specific autoreactive T cells and their significance to etiopathogenesis such as the use of the MHC multimer technology. This tool allowed the specific detection of increased percentages of GAD65 autoreactive T cells by means of HLA A*02:01 GAD65 AA 114-122 pentamers in newly diagnosed diabetics. Here we provide evidence that GAD65 AA 114-122 pentamers can depict a GAD65 AA114-122 peptide expandable population of functionally and phenotypically skewed, preliminary characterized CD3-CD8dullCD56+ 'memory-like' NK cells in PBMC of newly diagnosed diabetics. Our data suggest that the NK cell subset could bind the HLA class I GAD65 AA 114-122 pentamer through ILT2 inhibitory receptor. CD107a expression revealed increased degranulation of CD3-CD8dullCD56+ NK cells in GAD65 AA 114-122 and FLU peptide expanded peripheral blood mononuclear cells of diabetics following GAD65 AA 114-122 peptide HLA A*02:01 presentation in respect to the unpulsed condition. CD107a expression was enriched in ILT2 positive NK cells. As opposite to basal conditions where similar percentages of CD3-CD56+ILT2+ cells were detected in diabetics and controls, CD3-CD56+CD107a+ and CD3-CD56+ILT2+CD107a+ cells were significantly increased in T1D PBMC either GAD65 AA 114-122 or FLU peptides stimulated after co-culture with GAD65 AA 114-122 pulsed APCs. As control, healthy donor NK cells showed similar degranulation against both GAD65 AA 114-122 pulsed and unpulsed APCs. The pathogenetic significance of the CD3-CD8dullCD56+ 'memory-like NK cell subset' with increased response upon secondary
-
Directory of Open Access Journals (Sweden)
N. Shit
2012-07-01
Full Text Available Environmental stress boosts the levels of stress hormones and accelerates energy expenditure which subsequently imbalance the body’s homeostasis. L-ascorbic acid (L-AA has been recognized to mitigate the negative impact of environmental stress on production performances in birds. The present investigation was carried out to elucidate the effect of different dietary levels of L-AA on production performance, egg quality traits and fertility in Japanese quail at low ambient temperature. Sixty matured females (15 wks were equally divided into three groups (20/group based on the different dietary levels of L-AA (0, 250 and 500 ppm and coupled with an equal number of males (1:1 obtained from the same hatch. They were managed in uniform husbandry conditions without restriction of feed and water at 14 h photo-schedule. Except for feed efficiency, body weight change, feed consumption and hen-day egg production were recorded highest in 500 ppm L-AA supplemented groups. Among the all egg quality traits studied, only specific gravity, shell weight and thickness differed significantly (p<0.05 in the present study. Fertility was improved significantly (p<0.01 to a dose dependent manner of L-AA. The findings of the present study concluded that dietary L-AA can be a caring management practice at least in part to alleviate the adverse effect of cold induced stress on production performance in Japanese quail.
-
Update on the correlation between the cosmic radiation intensity and the geomagnetic AA index
International Nuclear Information System (INIS)
Shea, M.A.; Smart, D.F.
1985-01-01
A statistical study between the cosmic ray intensity, as observed by a neutron monitor, and of the geomagnetic aa index, as representative of perturbations in the plasma and interplanetary magnetic field in the heliosphere, has been updated to specifically exclude time periods around the reversal of the solar magnetic field. The results of this study show a strong negative correlation for the period 1960 through 1968 with a correlation coefficient of approximately -0.86. However, there is essentially no correlation between the cosmic ray intensity and the aa index for the period 1972-1979 (i.e. correlation coefficient less than 0.16). These results would appear to support the theory of preferential particle propagation into the heliosphere vis the ecliptic during the period 1960-1968 and via the solar polar regions during 1972-1979
-
Development of an alternative route for recycling AA2050 aluminum alloy by powder metallurgy
International Nuclear Information System (INIS)
Guido, V.; Oliveira, A.C. de; Travessa, D.N.; Cardoso, K.R.
2014-01-01
This paper presents an alternative solid state route to recycling AA2050 aeronautical aluminium alloy chips. The first stage in the recycling process, reported in this work, is the obtainment of the alloy powder by high energy ball milling to subsequent cold pressing and hot extrusion. The process started with the cleaning of chips with the aim of contaminant removing from machining process and transport, followed by the high energy ball milling to result in the AA2050 alloy powder. The powder obtained was characterized by laser size particle analysis, scanning electron microscopy (SEM), X-Ray diffraction (DRX) and inductively coupled plasma atomic emission spectroscopy (ICP-AES). The results show the feasibility of obtaining a powder having appropriate particle size and chemical composition in accordance with the specification for alloy. (author)
-
[Changes of CD34(+) and CD71(+)CD45(-) cell levels in bone marrow of MDS and AA patients].
Yan, Zhen-Yu; Tian, Xu; Li, Ying; Yang, Mei-Rong; Zhang, Song; Wang, Xie-Ming; Zhang, Hai-Xia; Cheng, Nai-Yao
2014-04-01
This study was aimed to investigate the changes of CD34(+) and CD71(+)CD45(-) cell levels in MDS and AA patients. A total of 25 cases MDS and 43 cases of AA (18 cases SAA and 25 cases of NSAA) from January 2010 to October 2013 in the Department of Hematology, affiliated hospital of Hebei United University were enrolled in this study. The complete blood count, bone marrow smears, bone marrow biopsy, karyotype analysis and bone marrow blood cell immune genotyping (mainly the proportion of CD34(+) cells, CD71(+)CD45(-) cells in nucleated cells) were carried out for all patients; the changes of CD34(+) and CD71(+)CD45(-) cell levels in patients with MDS and AA (SAA NSAA) were compared; the differences of white blood cell count, platelet count and hemoglobin concentration in patients with count of CD71(+)CD45(-) ≥ 15% or MDS group was higher than that in AA (NSAA and SAA) group (P MDS group was higher than that in SAA (P MDS group. In MDS group with CD71(+)CD45(-) ≥ 15%, the platelet count was significantly higher than that in NSAA group (P MDS and NSAA group with CD71(+)CD45(-) 0.05). It is concluded that the count of CD34(+) cells in MDS patients is significantly higher than that in AA and SAA patients. The count of CD71(+)CD45(-) cells in MDS group is significantly higher than that of SAA group. The platelet count in MDS patients with CD71(+)CD45(-) cells ≥ 15% is significantly higher than that of the NSAA group.
-
Directory of Open Access Journals (Sweden)
Seongjoon Kang
2018-05-01
Full Text Available Chlamydomonas reinhardtii (Chlamydomonas strains that are toxic to mosquito larvae because they express chloroplast transgenes that are based on the mosquitocidal proteins of Bacillus thuringiensis subsp. israelensis (Bti could be very useful in mosquito control. Chlamydomonas has several advantages for this approach, including genetic controls not generally available with industrial algae. The Bti toxin is produced by sporulating bacteria and has been used for mosquito control for >30 years without creating highly resistant mosquito populations. The suite of toxins is four main proteins: three Cry proteins and the cytotoxic Cyt1Aa (27 kDa. Cyt1Aa is not very toxic to mosquitoes by itself, but it prevents the development of resistance. The production of Cyt1Aa in other microbes, however, has been challenging due to its affinity for certain membrane phospholipids. Here we report on the production of recombinant Cyt1Aa (rCyt1A in the chloroplast of photosynthetic Chlamydomonas at levels of at least 0.3% total protein. Live cell bioassays demonstrated toxicity of the rCyt1Aa Chlamydomonas to larvae of Aedes aegypti. We also expressed the chloroplast cyt1Aa gene in a wild-type Chlamydomonas strain (21 gr that can grow on nitrate. These results have implications for developing a Chlamydomonas strain that will be toxic to mosquito larvae but will not induce strongly resistant populations.
-
VR light curves of AA Tau in 2007-2013 (Bouvier+, 2013) [Dataset
Bouvier, J.; Grankin, K.; Ellerbroek, L.; Bouy, H.; Barrado, D.
2013-01-01
Optical observations of AA Tau were obtained at the Crimean Astrophysical Observatory (CrAO) from October 2007 to February 2013. Additional BVRcIc photometry was obtained on December 23, 2011 using the Cafos focal reducer in direct imaging mode with CCD SITE1d 15 on the 2.2m Calar Alto Telescope.
-
Beliakin, S A; Fokin, Iu N; Kokhan, E P; Frolkin, M N
2009-09-01
There was congested a wide experience of organization and management of scientific work in the 3rd CMCH by Vishnevsky A.A. for a term of more than 40 years. This experience is subjected to generalization, analyze for the purpose of determination of it's priority orientations of improvement. Scientific-methods work in hospital is rated as a complex of measures, organisationaly-planed and coordinated by purpose and reinforcement of scientific schools of the 3rd CMCH by Vishnevsky A.A., as a basis of effective delivery of specialized medical aid. The vector of scientific researches is directed, generally, to solving questions of military and field medicine.
-
NCBI nr-aa BLAST: CBRC-PCAP-01-1368 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-1368 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto
-
NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-1594 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto
-
NCBI nr-aa BLAST: CBRC-MLUC-01-1112 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MLUC-01-1112 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto
-
NCBI nr-aa BLAST: CBRC-OPRI-01-0982 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-0982 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto
-
NCBI nr-aa BLAST: CBRC-VPAC-01-1554 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-VPAC-01-1554 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto
-
NCBI nr-aa BLAST: CBRC-MMUR-01-1494 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-1494 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto
-
NCBI nr-aa BLAST: CBRC-TTRU-01-0117 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0117 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto
-
NCBI nr-aa BLAST: CBRC-GGOR-01-1297 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-1297 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto
-
NCBI nr-aa BLAST: CBRC-PHAM-01-0810 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-0810 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 0.0 96% ...
-
NCBI nr-aa BLAST: CBRC-GGOR-01-1001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-1001 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-163 95% ...
-
NCBI nr-aa BLAST: CBRC-STRI-01-2918 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-STRI-01-2918 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-164 78% ...
-
NCBI nr-aa BLAST: CBRC-PVAM-01-1631 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PVAM-01-1631 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-173 86% ...
-
NCBI nr-aa BLAST: CBRC-OPRI-01-1192 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-1192 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-167 81% ...
-
Kuroda, Takeshi; Tanabe, Naohito; Hasegawa, Eriko; Wakamatsu, Ayako; Nozawa, Yukiko; Sato, Hiroe; Nakatsue, Takeshi; Wada, Yoko; Ito, Yumi; Imai, Naofumi; Ueno, Mitsuhiro; Nakano, Masaaki; Narita, Ichiei
2017-06-01
The kidney is a major target organ for systemic amyloidosis, which results in proteinuria and an elevated serum creatinine level. The clinical manifestations and precursor proteins of amyloid A (AA) and light-chain (AL) amyloidosis are different, and the renal damage due to amyloid deposition also seems to differ. The purpose of this study was to clarify haw the difference in clinical features between AA and AL amyloidosis are explained by the difference in the amount and distribution of amyloid deposition in the renal tissues. A total of 119 patients participated: 58 patients with an established diagnosis of AA amyloidosis (AA group) and 61 with AL amyloidosis (AL group). We retrospectively investigated the correlation between clinical data, pathological manifestations, and the area occupied by amyloid in renal biopsy specimens. In most of the renal specimens the percentage area occupied by amyloid was less than 10%. For statistical analyses, the percentage area of amyloid deposition was transformed to a common logarithmic value (Log 10 %amyloid). The results of sex-, age-, and Log 10 %amyloid-adjusted analyses showed that systolic blood pressure (SBP) was higher in the AA group. In terms of renal function parameters, serum creatinine, creatinine clearance (Ccr) and estimated glomerular filtration rate (eGFR) indicated significant renal impairment in the AA group, whereas urinary protein indicated significant renal impairment in the AL group. Pathological examinations revealed amyloid was predominantly deposited at glomerular basement membrane (GBM) and easily transferred to the mesangial area in the AA group, and it was predominantly deposited at in the AL group. The degree of amyloid deposition in the glomerular capillary was significantly more severe in AL group. The frequency of amyloid deposits in extraglomerular mesangium was not significantly different between the two groups, but in AA group, the degree amyloid deposition was significantly more severe, and
-
van Haaften, W. M.; Kool, W. H.; Katgerman, L.
2002-10-01
One of the major problems during direct chill (DC) casting is hot tearing. These tears initiate during solidification of the alloy and may run through the entire ingot. To study the hot tearing mechanism, tensile tests were carried out in semisolid state and at low strain rates, and crack propagation was studied in situ by scanning electron microscopy (SEM). These experimentally induced cracks were compared with hot tears developed in an AA5182 ingot during a casting trial in an industrial research facility. Similarities in the microstructure of the tensile test specimens and the hot tears indicate that hot tearing can be simulated by performing tensile tests at semisolid temperatures. The experimental data were compared with existing hot tearing models and it was concluded that the latter are restricted to relatively high liquid fractions because they do not take into account the existence of solid bridges in the crack.
-
Slot-type kicker for the AA stochastic cooling
Photographic Service
1979-01-01
A "slotted transmission line" structure was used for both pickups and the kicker of one of the stochastic cooling systems of the Antiproton Accumulator (AA). They served for the cooling of the high-density stack, in momentum and in both transverse planes. In the beginning in a single band, 1-2 GHz, later in 3 bands, 1-2, 2-4 and 4-8 GHz. The kicker of the first generation, shown here, was located where the dispersion was zero and the beam size small, and thus had a quadratic cross-section. The pickups were rectangular and wider in the horizontal plane. See also 7906193
-
Energy Technology Data Exchange (ETDEWEB)
Perez, E., E-mail: Emmanuel.Perez@inl.gov [Nuclear Fuels and Materials Division, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Keiser, D.D., E-mail: dennis.keiser@inl.gov [Nuclear Fuels and Materials Division, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Sohn, Y.H., E-mail: yongho.sohn@ucf.edu [Department of Materials Science and Engineering, University of Central Florida, 4000 Central Florida Blvd., Orlando, FL 32816 (United States)
2016-08-15
The U.S. Material Management and Minimization Reactor Conversion Program is developing low enrichment fuel systems encased in Al-alloy for use in research and test reactors. Monolithic fuel plates have local regions where the U−Mo fuel plate may come into contact with the Al-alloy 6061 (AA6061) cladding. This results in the development of interdiffusion zones with complex microstructures with multiple phases. In this study, the microstructural development of diffusion couples, U−7 wt%Mo, U−10 wt%Mo, and U−12 wt%Mo vs. AA6061, annealed at 600 °C for 24 h and at 550 °C for 1, 5, and 20 h, were analyzed by scanning electron microscopy with x-ray energy dispersive spectroscopy. The microstructural development and kinetics were compared to diffusion couples U−Mo vs. high purity Al and binary Al−Si alloys. The diffusion couples developed complex interaction regions where phase development was influenced by the alloying additions of the AA6061. - Highlights: • Diffusion couples of U−7Mo, U−10Mo, and U−12Mo vs. AA6061 were analyzed by SEM with XEDS. • The couples were annealed at 600 °C for 24 h and at 550 °C for 1, 5 and 20 h. • The interaction regions were more complex than those in diffusion couples of U−Mo vs. high purity Al and Al−Si alloys. • Analysis showed that the alloying additions of the AA6061 were present in the interaction regions. • Phase development was significantly influenced by the alloying additions of the AA6061.
-
Pasukphun, N; Vinitnantharat, S; Gheewala, S
2010-04-01
The aim of this study is to investigate the decolorization in anaerobic/aerobic biological activated carbon (A/A BAC) system. The experiment was divided into 2 stages; stage I is batch test for preliminary study of dye removal equilibrium time. The preliminary experiment (stage I) provided the optimal data for experimental design of A/A BAC system in SBR (stage II). Stage II is A/A BAC system imitated Sequencing Batch Reactor (SBR) which consist of 5 main periods; fill, react, settle, draw and idle. React period include anaerobic phase followed by aerobic phase. The BAC main media; Granular Activated Carbon (GAC), Mixed Cultures (MC) and Biological Activated Carbon (BAC) were used for dye and organic substances removal in three different solutions; Desizing Agent Solution (DAS), dye Solution (DS) and Synthetic Textile Wastewater (STW). Results indicate that GAC adsorption plays role in dye removal followed by BAC and MC activities, respectively. In the presence desizing agent, decolorization by MC was improved because desizing agent acts as co-substrates for microorganisms. It was found that 50% of dye removal efficiency was achieved in Fill period by MC. GC/MS analysis was used to identify dye intermediate from decolorization. Dye intermediate containing amine group was found in the solution and on BAC surfaces. The results demonstrated that combination of MC and BAC in the system promotes decolorization and dye intermediate removal. In order to improve dye removal efficiency in an A/A BAC system, replacement of virgin GAC, sufficient co-substrates supply and the appropriate anaerobic: aerobic period should be considered.
-
Frati, Paola; Busardò, Francesco P; Cipolloni, Luigi; Dominicis, Enrico De; Fineschi, Vittorio
2015-01-01
Anabolic androgenic steroids (AASs) represent a large group of synthetic derivatives of testosterone, produced to maximize anabolic effects and minimize the androgenic ones. AAS can be administered orally, parenterally by intramuscular injection and transdermally. Androgens act by binding to the nuclear androgen receptor (AR) in the cytoplasm and then translocate into the nucleus. This binding results in sequential conformational changes of the receptor affecting the interaction between receptor and protein, and receptor and DNA. Skeletal muscle can be considered as the main target tissue for the anabolic effects of AAS, which are mediated by ARs which after exposure to AASs are up-regulated and their number increases with body building. Therefore, AASs determine an increase in muscle size as a consequence of a dose-dependent hypertrophy resulting in an increase of the cross-sectional areas of both type I and type II muscle fibers and myonuclear domains. Moreover, it has been reported that AASs can increase tolerance to exercise by making the muscles more capable to overload therefore shielding them from muscle fiber damage and improving the level of protein synthesis during recovery. Despite some therapeutic use of AASs, there is also wide abuse among athletes especially bodybuilders in order to improve their performances and to increase muscle growth and lean body mass, taking into account the significant anabolic effects of these drugs. The prolonged misuse and abuse of AASs can determine several adverse effects, some of which may be even fatal especially on the cardiovascular system because they may increase the risk of sudden cardiac death (SCD), myocardial infarction, altered serum lipoproteins, and cardiac hypertrophy. The aim of this review is to focus on deaths related to AAS abuse, trying to evaluate the autoptic, histopathological and toxicological findings in order to investigate the pathophysiological mechanism that underlines this type of death, which
-
Siljan, Marte
2010-01-01
Energieffektivisering i bygninger regnes som et av de mest kostnadseffektive tiltakene for å redusere forbruk av energi, samt bidra til reduksjon i klimagassutslipp. I følge rapporter fra blant annet Lavenergiutvalget (2009) og Klimakur 2020 (2010), vil det være mulig å frigjøre rundt 10 TWh elektrisitet fra norske bygninger i løpet av de neste ti årene. Denne masteroppgaven tar for seg følgene av en tilsvarende etterspørselsreduksjon i det norske kraftsystemet. Norge har et kraftsystem med n...
-
Prediction of the surface roughness of AA6082 flow-formed tubes by design of experiments
International Nuclear Information System (INIS)
Srinivasulu, M.; Komaraiah, M.; Rao, C. S. Krishna Prasada
2013-01-01
Flow forming is a modern, chipless metal forming process that is employed for the production of thin-walled seamless tubes. Experiments are conducted on AA6082 alloy pre-forms to flow form into thin-walled tubes on a CNC flow-forming machine with a single roller. Design of experiments is used to predict the surface roughness of flow-formed tubes. The process parameters selected for this study are the roller axial feed, mandrel speed, and roller radius. A standard response surface methodology (RSM) called the Box Behnken design is used to perform the experimental runs. The regression model developed by RSM successfully predicts the surface roughness of AA6082 flow-formed tubes within the range of the selected process parameters.
-
Prediction of the surface roughness of AA6082 flow-formed tubes by design of experiments
Energy Technology Data Exchange (ETDEWEB)
Srinivasulu, M. [Government Polytechnic for Women Badangpet, Hyderabad (India); Komaraiah, M. [Sreenidhi Institute of Science and Technology, Hyderabad (India); Rao, C. S. Krishna Prasada [Bharat Dynamics Limited, Hyderabad (India)
2013-06-15
Flow forming is a modern, chipless metal forming process that is employed for the production of thin-walled seamless tubes. Experiments are conducted on AA6082 alloy pre-forms to flow form into thin-walled tubes on a CNC flow-forming machine with a single roller. Design of experiments is used to predict the surface roughness of flow-formed tubes. The process parameters selected for this study are the roller axial feed, mandrel speed, and roller radius. A standard response surface methodology (RSM) called the Box Behnken design is used to perform the experimental runs. The regression model developed by RSM successfully predicts the surface roughness of AA6082 flow-formed tubes within the range of the selected process parameters.
-
The Efficacy of MAG-DHA for Correcting AA/DHA Imbalance of Cystic Fibrosis Patients
Directory of Open Access Journals (Sweden)
Caroline Morin
2018-05-01
Full Text Available Omega-3 polyunsaturated fatty acid (n-3 PUFA supplementations are thought to improve essential fatty acid deficiency (EFAD as well as reduce inflammation in Cystic Fibrosis (CF, but their effectiveness in clinical studies remains unknown. The aim of the study was to determine how the medical food containing docosahexaenoic acid monoglyceride (MAG-DHA influenced erythrocyte fatty acid profiles and the expression levels of inflammatory circulating mediators. We conducted a randomized, double blind, pilot trial including fifteen outpatients with Cystic Fibrosis, ages 18–48. The patients were divided into 2 groups and received MAG-DHA or a placebo (sunflower oil for 60 days. Patients took 8 × 625 mg MAG-DHA softgels or 8 × 625 mg placebo softgels every day at bedtime for 60 days. Lipid analyses revealed that MAG-DHA increased docosahexaenoic acid (DHA levels and decrease arachidonic acid (AA ratio (AA/DHA in erythrocytes of CF patients following 1 month of daily supplementation. Data also revealed a reduction in plasma human leukocyte elastase (pHLE complexes and interleukin-6 (IL-6 expression levels in blood samples of MAG-DHA supplemented CF patients. This pilot study indicates that MAG-DHA supplementation corrects erythrocyte AA/DHA imbalance and may exert anti-inflammatory properties through the reduction of pHLE complexes and IL6 in blood samples of CF patients. Trial registration: Pro-resolving Effect of MAG-DHA in Cystic Fibrosis (PREMDIC, NCT02518672.
-
Energy Technology Data Exchange (ETDEWEB)
Murty, S.V.S. Narayana [Materials and Mechanical Entity, Vikram Sarabhai Space Center, Trivandrum-695 022 (India); Sarkar, Aditya [Department of Materials Science and Engineering, Indian Institute of Technology, Gandhinagar-382 424 (India); Narayanan, P. Ramesh; Venkitakrishnan, P.V. [Materials and Mechanical Entity, Vikram Sarabhai Space Center, Trivandrum-695 022 (India); Mukhopadhyay, J. [Department of Materials Science and Engineering, Indian Institute of Technology, Gandhinagar-382 424 (India)
2016-11-20
Aluminium alloy AA2219 is widely used in the fabrication of propellant tanks of cryogenic stages of satellite launch vehicles. These propellant tanks are welded structures and a fine grained microstructure is usually preferred for sheets/plates and ring rolled rings used in their fabrication. In order to study the effect of large strain deformation on the microstructural evolution, hot isothermal plane strain compression (PSC) tests were conducted on AA 2219 in the temperature range of 250 °C–400 °C and at strain rates of 0.01 s{sup −1} and 1 s{sup −1}. Flow curves obtained at different temperatures and strain rates exhibited two types of behavior; one with a clear stress peak followed by softening, occurring below Z=2.5E+15 and steady state flow behavior above it. Electron Back-Scatter Diffraction (EBSD) analysis of the PSC tested samples at the location of maximum strain revealed the presence of lamellar microstructures with very low fraction of transverse high angle boundaries (HABs). The loss of HABs during large strain deformation is attributed to the occurrence of dynamic recovery (DRV) as the ratio of calculated to measured lamellar boundary width is less than unity. Based on detailed microstructure and micro texture analysis, it was concluded that it is very difficult to obtain large fraction of HABs through uniaxial large strain deformation. Therefore, to obtain fine grain microstructure in thermo-mechanically processed AA2219 products, multi-axial deformation is essential.
-
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt
-
Laser surface alloying of aluminum (AA1200) with Ni and SiC Powders
CSIR Research Space (South Africa)
Mabhali, Luyolo AB
2010-12-01
Full Text Available . The dissociated C reacted with Al to form Al4C3. The addition of Ni resulted in the formation of the Al3Ni phase. A hardness increase of approximately four times that of aluminum AA1200 was achieved in the alloyed layer....
-
Numerical analysis of heat treatment of TiCN coated AA7075 aluminium alloy
Srinath, M. K.; Prasad, M. S. Ganesha
2018-04-01
The Numerical analysis of heat treatments of TiCN coated AA7075 aluminium alloys is presented in this paper. The Convection-Diffusion-Reaction (CDR) equation with solutions in the Streamlined-Upward Petrov-Galerkin (SUPG) method for different parameters is provided for the understanding of the process. An experimental process to improve the surface properties of AA-7075 aluminium alloy was attempted through the coatings of TiCN and subsequent heat treatments. From the experimental process, optimized temperature and time was obtained which gave the maximum surface hardness and corrosion resistance. The paper gives an understanding and use of the CDR equation for application of the process. Expression to determine convection, diffusion and reaction parameters are provided which is used to obtain the overall expression of the heat treatment process. With the substitution of the optimized temperature and time, the governing equation may be obtained. Additionally, the total energy consumed during the heat treatment process is also developed to give a mathematical formulation of the energy consumed.
-
Lockhart, Shawn R.; Wu, Wei; Radke, Joshua B.; Zhao, Rui; Soll, David R.
2005-01-01
The majority of Candida albicans strains in nature are a/α and must undergo homozygosis to a/a or α/α to mate. Here we have used a mouse model for systemic infection to test the hypothesis that a/α strains predominate in nature because they have a competitive advantage over a/a and α/α offspring in colonizing hosts. Single-strain injection experiments revealed that a/α strains were far more virulent than either their a/a or α/α offspring. When equal numbers of parent a/α and offspring a/a or α/α cells were co-injected, a/α always exhibited a competitive advantage at the time of extreme host morbidity or death. When equal numbers of an engineered a/a/α2 strain and its isogenic a/a parent strain were co-injected, the a/a/α2 strain exhibited a competitive advantage at the time of host morbidity or death, suggesting that the genotype of the mating-type (MTL) locus, not associated genes on chromosome 5, provides a competitive advantage. We therefore propose that heterozygosity at the MTL locus not only represses white-opaque switching and genes involved in the mating process, but also affects virulence, providing a competitive advantage to the a/α genotype that conserves the mating system of C. albicans in nature. PMID:15695357
-
Lockhart, Shawn R; Wu, Wei; Radke, Joshua B; Zhao, Rui; Soll, David R
2005-04-01
The majority of Candida albicans strains in nature are a/alpha and must undergo homozygosis to a/a or alpha/alpha to mate. Here we have used a mouse model for systemic infection to test the hypothesis that a/alpha strains predominate in nature because they have a competitive advantage over a/a and alpha/alpha offspring in colonizing hosts. Single-strain injection experiments revealed that a/alpha strains were far more virulent than either their a/a or alpha/alpha offspring. When equal numbers of parent a/alpha and offspring a/a or alpha/alpha cells were co-injected, a/alpha always exhibited a competitive advantage at the time of extreme host morbidity or death. When equal numbers of an engineered a/a/alpha2 strain and its isogenic a/a parent strain were co-injected, the a/a/alpha2 strain exhibited a competitive advantage at the time of host morbidity or death, suggesting that the genotype of the mating-type (MTL) locus, not associated genes on chromosome 5, provides a competitive advantage. We therefore propose that heterozygosity at the MTL locus not only represses white-opaque switching and genes involved in the mating process, but also affects virulence, providing a competitive advantage to the a/alpha genotype that conserves the mating system of C. albicans in nature.
-
Energy Technology Data Exchange (ETDEWEB)
Naga Raju, P. [Metallurgical and Materials Engineering Department, IIT-Madras, Chennai 600036 (India)], E-mail: puvvala_nagaraju@yahoo.com; Srinivasa Rao, K. [Metallurgical Engineering Department, Andhra University, Visakapatnam 530003 (India); Reddy, G.M. [Defence Metallurgical Research Laboratory, Hyderabad 500258 (India); Kamaraj, M.; Prasad Rao, K. [Metallurgical and Materials Engineering Department, IIT-Madras, Chennai 600036 (India)
2007-08-25
The present work pertains to the improvement of high temperature stability of age hardenable AA2219 aluminium-copper (6.3%) alloy. Addition of scandium, magnesium and zirconium to the base metal AA2219 was adopted to improve this high temperature stability. These additions were systematically varied by preparing alloys of different composition using gas tungsten arc melting. Long time ageing studies and impression creep technique were used to study the high temperature stability of the alloys. These modified compositions of the alloy resulted in fine equiaxed grains, refined eutectics, large number of high temperature stable and finer precipitates. Among all the compositions, 0.8% Sc + 0.45% Mg + 0.2% Zr addition was found to be significant in improving the high temperature stability of AA2219 alloy. This may be attributed to the possible microstructural changes, solute enrichment of the matrix and pinning of the grain boundaries by the finer precipitates.
-
Directory of Open Access Journals (Sweden)
Monikandan V. V.
2018-03-01
Full Text Available This study statistically analyzes the tribological properties of AA6061-10 wt. % B4C mono composite and AA6061-10 wt.% B4C-7.5 wt. % MoS2 hybrid composite. The tribological behavior of the composites was studied at atmospheric conditions using a pin-on-disk tribo-tester. The tribological experiments were conducted as per the full factorial design (FFD experimental scheme. The ANOVA analysis of the wear rate revealed that the three factors, A (MoS2 particles addition, B (applied load, and D (sliding distance presented the physical and statistical significance on the wear rate. The ANOVA analysis of the friction coefficient revealed that the factors B (applied load and C (sliding speed and interaction AB (interaction of MoS2 particles addition and applied load presented the physical and statistical significance on the friction coefficient. It is observed from the main effects plots of the wear rate and friction coefficient that the increase in the levels of factors B (applied load and D (sliding distance increased the wear rate and friction coefficient. However, the wear rate and friction coefficient decreased with the increase in the level of factor A (MoS2 particles addition.
-
Bergamasco, V B; Mendes, D R P; Fernandes, O A; Desidério, J A; Lemos, M V F
2013-02-01
The polyphagous pests belonging to the genus Spodoptera are considered to be among the most important causes of damage and are widely distributed throughout the Americas'. Due to the extensive use of genetically modified plants containing Bacillus thuringiensis genes that code for insecticidal proteins, resistant insects may arise. To prevent the development of resistance, pyramided plants, which express multiple insecticidal proteins that act through distinct mode of actions, can be used. This study analyzed the mechanisms of action for the proteins Cry1Ia10 and Vip3Aa on neonatal Spodoptera frugiperda, Spodoptera albula, Spodoptera eridania and Spodoptera cosmioides larvae. The interactions of these toxins with receptors on the intestinal epithelial membrane were also analyzed by binding biotinylated toxins to brush border membrane vesicles (BBMVs) from the intestines of these insects. A putative receptor of approximately 65 kDa was found by ligand blotting in all of these species. In vitro competition assays using biotinylated proteins have indicated that Vip3Aa and Cry1Ia10 do not compete for the same receptor for S. frugiperda, S. albula and S. cosmioides and that Vip3Aa was more efficient than Cry1Ia10 when tested individually, by bioassays. A synergistic effect of the toxins in S. frugiperda, S. albula and S. cosmioides was observed when they were combined. However, in S. eridania, Cry1Ia10 and Vip3Aa might compete for the same receptor and through bioassays Cry1Ia10 was more efficient than Vip3Aa and showed an antagonistic effect when the proteins were combined. These results suggest that using these genes to develop pyramided plants may not prove effective in preventing the development of resistance in S. eridiana. Copyright © 2012 Elsevier Inc. All rights reserved.
-
Chakroun, Maissa
2014-01-01
Bacillus thuringiensis vegetative insecticidal proteins (Vip3A) have been recently introduced in important crops as a strategy to delay the emerging resistance to the existing Cry toxins. The mode of action of Vip3A proteins has been studied in Spodoptera frugiperda with the aim of characterizing their binding to the insect midgut. Immunofluorescence histological localization of Vip3Aa in the midgut of intoxicated larvae showed that Vip3Aa bound to the brush border membrane along the entire apical surface. The presence of fluorescence in the cytoplasm of epithelial cells seems to suggest internalization of Vip3Aa or a fragment of it. Successful radiolabeling and optimization of the binding protocol for the 125I-Vip3Aa to S. frugiperda brush border membrane vesicles (BBMV) allowed the determination of binding parameters of Vip3A proteins for the first time. Heterologous competition using Vip3Ad, Vip3Ae, and Vip3Af as competitor proteins showed that they share the same binding site with Vip3Aa. In contrast, when using Cry1Ab and Cry1Ac as competitors, no competitive binding was observed, which makes them appropriate candidates to be used in combination with Vip3A proteins in transgenic crops. PMID:25002420
-
DEFF Research Database (Denmark)
Sonne, Mads Rostgaard; Carlone, P.; Citarella, R.
2015-01-01
This paper deals with a numerical and experimental investigation on the influence of residual stresses on fatigue crack growth in AA2024-T3 friction stir welded butt joints. An integrated FEM-DBEM procedure for the simulation of crack propagation is proposed and discussed. A numerical FEM model...... of the welding process of precipitation hardenable AA2024-T3 aluminum alloy is employed to infer the process induced residual stress field. The reliability of the FEM simulations with respect to the induced residual stresses is assessed comparing numerical outcomes with experimental data obtained by means...
-
AA1000 and SA8000 compared: a systematic comparison of contemporary accountability standards
Göbbels, M.; Jonker, J.
2003-01-01
One of the ways to deal with stakeholder issues, is the use and application of accountability standards. Two recent accountability standards (AA1000 and SA8000) will be the subject of comparison in this paper. Firstly, the constituent elements of these new standards will be briefly described. The
-
Kamal Babu, K.; Panneerselvam, K.; Sathiya, P.; Noorul Haq, A.; Sundarrajan, S.; Mastanaiah, P.; Srinivasa Murthy, C. V.
The purpose of this paper is to present the corrosion behavior of the Cryorolled (CR) material and its Friction Stir Welded joints. Due to the thermal cycles of Friction Stir Welding (FSW) process, the corrosion behavior of the material gets affected. Here, the cryorolling process was carried out on AA2219 alloy and CR material was joined by FSW process using four different pin tool profiles such as cylindrical, threaded cylindrical, square and hexagonal pin. The FSW joints were analyzed by corrosion resistance with the help of potentiodynamic polarization test with 3.5% NaCl solution. From the analysis, it is found that CR AA2219 material exhibits good corrosion resistance compared to the base AA2219 material, and also a hexagonal pin profile FSW joint exhibits high corrosion resistance. Among the weld joints created by four different tools, the lowest corrosion resistance was found in the cylindrical pin tool FSW welds. Further, the corroded samples were investigated through metallurgical investigations like OM, Transmission Electron Microscopy (TEM), Energy-Dispersive X-ray Spectroscopy (EDX) and X-Ray Diffraction (XRD). It was found that the amount of dissolution of Al2Cu precipitate was present in the weld nugget. The amount of dissolution of Al2Cu precipitate is higher in the weld nugget produced by hexagonal pin tool. This is due to the enhancement of the corrosion resistance.
-
Hoeppner, Bettina B; Hoeppner, Susanne S; Kelly, John F
2014-10-01
Research has shown that participation in Alcoholics Anonymous (AA) confers significant recovery benefit to adults suffering from alcohol use disorder (AUD). Concerns persist, however, that AA may not work as well for younger adults, who tend to have shorter addiction histories, different social circumstances, and less spiritual/religious interest than adults. Secondary data analysis of Project MATCH, using a prospective, moderated multiple mediation analysis to test and compare six previously identified mechanisms of change in younger adults (n=266) vs. adults aged 30+ (n=1460). Nine clinical sites within the United States. Treatment-seeking adults (n=1726) suffering from AUD who participated in 12 weeks of outpatient treatment and completed follow-ups at 3-, 9- and 15-months. AA attendance during treatment; mediators at 9 months; and outcomes [percentage of days abstinent (PDA) and drinks per drinking day (DDD)] at 15 months. AA attendance was associated with improved drinking outcomes in both younger adults (PDA: F(1, 247)=8.55, p<0.01; DDD: F(1, 247)=15.93, p<0.01) and adults aged 30+ (PDA: F(1, 1311)=86.58, p<0.01; DDD: F(1, 1311)=11.96, p<0.01). Only two of the six hypothesized pathways (i.e., decreases in pro-drinking social networks, self-efficacy in social situations) appeared to work in younger adults. Unidentified mechanisms of behavior change that are mobilized by AA participation appear to be at work in young people. Once identified, these mechanisms may shed new light on how exactly AA confers similar benefits for young people and, more broadly, may enhance our understanding of recovery-related change for young adults that could yield novel intervention targets. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
-
An Update on the AAS Astronomy Ambassadors Program
Fienberg, Richard T.; Gurton, S.; Fraknoi, A.; Prather, E. E.; Hurst, A.; Schatz, D. L.
2013-06-01
The American Astronomical Society, partnering with organizations active in science education and public outreach (EPO), has launched a series of professional-development workshops and a community of practice designed to help improve early-career astronomers’ ability to effectively communicate with students and the public. Called Astronomy Ambassadors, the program provides mentoring and training experiences for young astronomers, from advanced undergraduates to beginning faculty; it also provides access to resources and a network of contacts within the astronomy EPO community. By learning how to implement effective education and outreach strategies, Astronomy Ambassadors become better teachers, better presenters at meetings, and better representatives of our science to the public and to government. And because young astronomers are a more diverse group than those who currently do the majority of outreach, they help the astronomical community present a more multicultural and gender-balanced face to the public, enabling members of underserved groups to see themselves as scientists. Ambassadors are provided with a large library of outreach activities and materials that are suitable for a range of venues and audiences and that will grow with time. For much of this library we are using resources developed by organizations such as the Astronomical Society of the Pacific, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. The first Astronomy Ambassadors workshop was held at the 221st meeting of the AAS in January 2013 and served 30 young astronomers chosen from more than 75 applicants. Incorporating feedback from workshop participants and lessons learned from the reports they’ve submitted after conducting their own outreach events, we are now planning the second annual workshop to be held 4-5 January 2014 at the 223rd AAS meeting in
-
Directory of Open Access Journals (Sweden)
Lauro Saraiva Lessa
2012-12-01
Full Text Available O estudo de correlação tem como propósito mensurar a alteração em um caráter quando se altera outro. Neste trabalho, objetivou-se estimar correlações fenotípicas entre o número de frutos por cacho e 22 caracteres avaliados em híbridos diploides (AA de bananeira. No experimento, conduzido na Embrapa Mandioca e Fruticultura, em blocos casualizados com quatro repetições, foram avaliados 11 híbridos diploides (AA de bananeira. Os caracteres avaliados foram: altura de plantas, diâmetro do pseudocaule, número de filhos, número de folhas na floração, período do plantio ao florescimento, presença de pólen, peso do cacho e da ráquis, sigatoka-amarela no florescimento, número de folhas na colheita, Sigatoka-amarela na colheita do cacho, número de dias do florescimento à colheita, comprimento e diâmetro do engaço, peso da segunda penca, número de pencas e de frutos por cacho, fragilidade do pedicelo, comprimento e diâmetro do fruto e comprimento do pedicelo, além de presença de semente. Após a tabulação, procederam-se a estudos de correlação entre o número de frutos e os demais caracteres da planta. Essas correlações variaram entre os genótipos, sendo assim, observado que as associações entre o número de frutos e os caracteres vegetativos da planta foram, de forma geral, não significativas. Já as relações entre o número de frutos por cacho e os outros caracteres produtivos foram, predominantemente, significativas.The objective of the present study was to estimate the phenotypic correlations between the number of fruits per bunch and 22 characters evaluated in banana (AA diploid hybrids. The experiment was carried out at Embrapa Cassava and Fruits in randomized blocks with four repetitions and 11 (AA banana diploid hybrids were evaluated. The following characteristics were evaluated: plant height, pseudostem diameter, number of suckers, number of leaves during flowering, plant cycle until emission of the
-
The AAS to BAS Pathway: Heating Up the Educational Aspiration of CTE Students
Kujawa, Tricia A.
2013-01-01
The enrollment and transfer behaviors of college students are diverse. As a result, college students travel various pathways to the baccalaureate degree. The purpose of this qualitative study was to better understand the lived experience of students who entered higher education through an associate of applied science (AAS) program and then…
-
Directory of Open Access Journals (Sweden)
I. Sudhakar
2015-03-01
Full Text Available Industrial applications of aluminium and its alloys are restricted because of their poor tribological properties. Thermal spraying, laser surfacing, electron beam welding are the most widely used techniques to alter the surface morphology of base metal. Preliminary studies reveal that the coating and layering of aluminium alloys with ceramic particles enhance the ballistic resistance. Furthermore, among aluminium alloys, 7075 aluminium alloy exhibits high strength which can be compared to that of steels and has profound applications in the designing of lightweight fortification structures and integrated protection systems. Having limitations such as poor bond integrity, formation of detrimental phases and interfacial reaction between reinforcement and substrate using fusion route to deposit hard particles paves the way to adopt friction stir processing for fabricating surface composites using different sizes of boron carbide particles as reinforcement on armour grade 7075 aluminium alloy as matrix in the present investigation. Wear and ballistic tests were carried out to assess the performance of friction stir processed AA7075 alloy. Significant improvement in wear resistance of friction stir processed surface composites is attributed to the change in wear mechanism from abrasion to adhesion. It has also been observed that the surface metal matrix composites have shown better ballistic resistance compared to the substrate AA7075 alloy. Addition of solid lubricant MoS2 has reduced the depth of penetration of the projectile to half that of base metal AA7075 alloy. For the first time, the friction stir processing technique was successfully used to improve the wear and ballistic resistances of armour grade high strength AA7075 alloy.
-
Bernardi, Oderlei; Bernardi, Daniel; Amado, Douglas; Sousa, Renan S; Fatoretto, Julio; Medeiros, Fernanda C L; Conville, Jared; Burd, Tony; Omoto, Celso
2015-12-01
Transgenic Agrisure Viptera 3 corn that expresses Cry1Ab, Vip3Aa20, and EPSPS proteins and Agrisure Viptera expressing Vip3Aa20 are used for control of Spodoptera frugiperda (J.E. Smith) and Diatraea saccharalis (F.) in Brazil. To support a resistance management program, resistance risk assessment studies were conducted to characterize the dose expression of Vip3Aa20 protein and level of control against these species. The Vip3Aa20 expression in Agrisure Viptera 3 and Agrisure Viptera decreased from V6 to V10 stage of growth. However, Vip3Aa20 expression in Agrisure Viptera 3 at V6 and V10 stages was 13- and 16-fold greater than Cry1Ab, respectively. The Vip3Aa20 expression in lyophilized tissue of Agrisure Viptera 3 and Agrisure Viptera diluted 25-fold in an artificial diet caused complete larval mortality of S. frugiperda and D. saccharalis. In contrast, lyophilized tissue of Bt11 at the same dilution does not provide complete mortality of these species. Agrisure Viptera 3 and Agrisure Viptera also caused a high level of mortality against S. frugiperda and D. saccharalis. Moreover, 100% mortality was observed for S. frugiperda larvae (neonates through fifth-instar larvae) when fed in corn with the Vip trait technology. Viptera corn achieves a high level of control against S. frugiperda and D. saccharalis providing a high dose, which is an important determination to support the refuge strategy for an effective resistance management program. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
-
An update on the correlation between the cosmic radiation intensity and the geomagnetic AA index
Shea, M. A.; Smart, D. F.
1985-01-01
A statistical study between the cosmic ray intensity, as observed by a neutron monitor, and of the geomagnetic aa index, as representative of perturbations in the plasma and interplanetary magnetic field in the heliosphere, has been updated to specifically exclude time periods around the reversal of the solar magnetic field. The results of this study show a strong negative correlation for the period 1960 through 1968 with a correlation coefficient of approximately -0.86. However, there is essentially no correlation between the cosmic ray intensity and the aa index for the period 1972-1979 (i.e. correlation coefficient less than 0.16). These results would appear to support the theory of preferential particle propagation into the heliosphere vis the ecliptic during the period 1960-1968 and via the solar polar regions during 1972-1979.
-
NCBI nr-aa BLAST: CBRC-CJAC-01-1245 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1245 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-165 81% ...
-
NCBI nr-aa BLAST: CBRC-CFAM-21-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-21-0001 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-124 74% ...
-
NCBI nr-aa BLAST: CBRC-PTRO-12-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-12-0198 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 0.0 98% ...
-
NCBI nr-aa BLAST: CBRC-MMUS-09-0013 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-09-0013 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-164 80% ...
-
NCBI nr-aa BLAST: CBRC-GGAL-01-0069 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-01-0069 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-141 69% ...
-
NCBI nr-aa BLAST: CBRC-CPOR-01-2040 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CPOR-01-2040 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 6e-55 84% ...
-
NCBI nr-aa BLAST: CBRC-RNOR-08-0020 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-08-0020 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-161 80% ...
-
NCBI nr-aa BLAST: CBRC-RMAC-14-0265 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RMAC-14-0265 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 0.0 95% ...
-
NCBI nr-aa BLAST: CBRC-PVAM-01-1415 [SEVENS
Lifescience Database Archive (English)
Full Text Available g protein 1; AltName: Full=Caspase recruitment domain-containing protein 4 gb|AAD28350.1|AF113925_1 Nod1 [Ho...tein [Homo sapiens] gb|AAS46897.1| unknown [Homo sapiens] gb|EAL24453.1| caspase recruitment domain family, ...member 4 [Homo sapiens] gb|EAW93945.1| caspase recruitment domain family, member 4, isoform CRA_b [Homo sapi...ens] gb|EAW93946.1| caspase recruitment domain family, member 4, isoform CRA_b [H...omo sapiens] gb|EAW93947.1| caspase recruitment domain family, member 4, isoform CRA_b [Homo sapiens] gb|EAW93949.1| caspase recruitm
-
NCBI nr-aa BLAST: CBRC-OPRI-01-0714 [SEVENS
Lifescience Database Archive (English)
Full Text Available g protein 1; AltName: Full=Caspase recruitment domain-containing protein 4 gb|AAD28350.1|AF113925_1 Nod1 [Ho...tein [Homo sapiens] gb|AAS46897.1| unknown [Homo sapiens] gb|EAL24453.1| caspase recruitment domain family, ...member 4 [Homo sapiens] gb|EAW93945.1| caspase recruitment domain family, member 4, isoform CRA_b [Homo sapi...ens] gb|EAW93946.1| caspase recruitment domain family, member 4, isoform CRA_b [H...omo sapiens] gb|EAW93947.1| caspase recruitment domain family, member 4, isoform CRA_b [Homo sapiens] gb|EAW93949.1| caspase recruitm
-
Tu, Yiyou; Qian, Huan; Zhou, Xuefeng; Jiang, Jianqing
2014-04-01
In the current study, the effect of Sc addition on the interaction of concurrent precipitation and recrystallization in commercial AA3003 aluminum alloy was investigated using optical microscopy, scanning electron microscopy, and transmission electron microscopy. In case of AA3003 alloy, which was cold rolled to a true strain of 2.20 and heated at a heating rate of 150 K/s, the onset of precipitation and ending of recrystallization are signified by the critical temperature, T C ~740 K (467 °C). There is a change in the shape of the recrystallized grains from pancake-like to equiaxed shape, as the annealing temperature increases greater than T C. In case of AA3003 alloy microalloyed with 0.4 wt pct of Sc, the high no. density precipitation of coherent Al3Sc precipitates always occurs before recrystallization because of the small nucleation barrier and high rate of decomposition. This leads to extremely coarse pancake-like recrystallization grains with high fraction of low-angle grain boundaries in the entire annealing temperature range, even at a high brazing temperature of 883 K (610 °C).
-
DEFF Research Database (Denmark)
Jønsson, Rie; Struve, Carsten; Boll, Erik J.
2017-01-01
phylogenetically distinct, strains harboring the major pilin subunits from both AAF/III and AAF/V. Whole-genome and plasmid sequencing revealed that in these six strains the agg3A and agg5A genes were located on a novel pAA plasmid variant. Moreover, the plasmid also encoded several other virulence genes including...... some not previously found on pAA plasmids. Thus, this plasmid endows the host strains with a remarkably high number of EAEC associated virulence genes hereby likely promoting strain pathogenicity....
-
Directory of Open Access Journals (Sweden)
Yuen K Ip
Full Text Available We obtained a full cDNA coding sequence of aquaporin 1aa (aqp1aa from the gills of the freshwater climbing perch, Anabas testudineus, which had the highest expression in the gills and skin, suggesting an important role of Aqp1aa in these organs. Since seawater acclimation had no significant effects on the branchial and intestinal aqp1aa mRNA expression, and since the mRNA expression of aqp1aa in the gut was extremely low, it can be deduced that Aqp1aa, despite being a water channel, did not play a significant osmoregulatory role in A. testudineus. However, terrestrial exposure led to significant increases in the mRNA expression of aqp1aa in the gills and skin of A. testudineus. Since terrestrial exposure would lead to evaporative water loss, these results further support the proposition that Aqp1aa did not function predominantly for the permeation of water through the gills and skin. Rather, increased aqp1aa mRNA expression might be necessary to facilitate increased ammonia excretion during emersion, because A. testudineus is known to utilize amino acids as energy sources for locomotor activity with increased ammonia production on land. Furthermore, ammonia exposure resulted in significant decreases in mRNA expression of aqp1aa in the gills and skin of A. testudineus, presumably to reduce ammonia influx during ammonia loading. This corroborates previous reports on AQP1 being able to facilitate ammonia permeation. However, a molecular characterization of Aqp1aa from A. testudineus revealed that its intrinsic aquapore might not facilitate NH3 transport. Hence, ammonia probably permeated the central fifth pore of the Aqp1aa tetramer as suggested previously. Taken together, our results indicate that Aqp1aa might have a greater physiological role in ammonia excretion than in osmoregulation in A. testudineus.
-
Longitudinal ophthalmic findings in a child with Helsmoortel-Van der Aa Syndrome
Directory of Open Access Journals (Sweden)
Michael J. Gale
2018-06-01
Full Text Available Purpose: We present the first detailed ophthalmic description of a child with Helsmoortel-Van der Aa Syndrome (HVDAS, including longitudinal follow-up and analysis. Observations: After extensive workup, a young child with poor visual behavior, hypotonic cerebral palsy, intellectual disability, and global developmental delay was found to have a heterozygous de novo mutation in the ADNP gene and diagnosed with HVDAS. Ophthalmic findings were remarkable for progressive nystagmus, macular pigment mottling, mild foveal hypoplasia with abnormal macular laminations, persistent rod dysfunction with electronegative waveform, and progressive cone degeneration. Conclusions and importance: Patients with HVDAS are known to have abnormal visual behavior due to refractive or cortical impairment. However, we present the first description, to our knowledge, of an association with retinal mal-development and degeneration. Thus, patients with HVDAS should be referred for ophthalmic genetics evaluation, and HVDAS should be on the differential diagnosis for young children with global developmental delay who present with nystagmus, rod and cone dysfunction with electronegative waveform, and relative lack of severe structural degeneration on optical coherence tomography. Keywords: Helsmoortel-Van der Aa Syndrome, HVDAS, Activity-dependent neuroprotective protein, ADNP, Nystagmus, Retinal degeneration, Electronegative waveform, Optical coherence tomography
-
2012-01-01
Arvamust avaldasid Järvakandi vallavanem, Raplamaa omavalitsuste liidu esimees Mart Järvik, Harju maavalitsuse haridus- ja sotsiaalosakonna juhataja Maris Liiders, Põlva maavalitsuse haridus- ja sotsiaalosakonna juhataja Peeter Aas, Ida-Viru maavalitsuse haridus- ja sotsiaalosakonna juhataja Kaarin Veinbergs
-
International Nuclear Information System (INIS)
Masrukan; Tri Yulianto; Anwar Muchsin
2011-01-01
U-Zr-Nb alloy chemical composition analysis using X Ray Fluorescence (XRF) and Atomic Absorption Spectroscopy (AAS) techniques have been conducted, where U-Zr- Nb alloy was chosen as candidates for new high-density fuel for future research reactors . Composition analysis is necessary because the composition of elements in the fuel will determine the characteristics of fuel during the fabrication process and in the reactor. The use of two kinds of analysis techniques were designed to obtain accurate analysis results. The experiment was conducted to determine the major element composition and impurities in the alloy U-Zr-Nb. First U-Zr-Nb varying alloy composition Nb were respectively 1%, 4%, 7% (U10% Zr1% Nb, U10% Zr4% Nb and U10% 7% Nb) as results of the melting process of measuring the diameter of 120 mm crushed on the surface bottom. Once on the bottom surface is smooth, then analyzed using XRF techniques. To analyze the elements using AAS techniques, alloy U-Zr-Nb cut into 10 mm x 5 mm then dissolved using HF and nitric acid. Solution that occurred were analyzed using AAS technique. From the analysis using the XRF technique is obtained the alloy U-10% Zr-1% Nb, U-10% Zr-4% Nb and Zr-10% U-7% Nb) had a content of each element as follows: U (87.8858%), Zr (2.6097%) and Nb (0.2206%), U (87.8556%), Zr (2.6302%), and Nb (0.6573%); U (84.6334%), Zr (2.5773%), and Nb (1.0940) weight. Results of analysis using AAS techniques on samples obtained third consecutive Zr content of 9.25%, 8.90% and 9.80% while the content of Nb was not detected. Meanwhile, the results of elemental analysis of impurities in all three samples showed that almost all the elements are still qualify as fuel except Zn element. Element Zn at the three samples of each alloys U-10% Zr-1% Nb, U-10% Zr-4% Nb and U-10% Zr-7%Nb is 1.3266%, 3.2756% and 1.0927% weight. It could be concluded that the results of analysis of elemental content and impurities in the alloy U-Nb-Zr using both XRF and AAS visible
-
Najafi, S.; Eivani, A. R.; Samaee, M.; Jafarian, H. R.; Zhou, J.
2018-01-01
The effect of equal channel angular pressing (ECAP) on the microstructure and mechanical properties of AA6063 aluminum alloy was investigated. For this purpose, samples of AA6063 aluminum alloy were deformed up to 10 passes using ECAP and the evolution of microstructure, texture and dislocation
-
Kohler, Susanna
2016-06-01
Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session: From Space Archeology to Serving the World Today: A 20-year Journey from the Jungles of Guatemala to a Network of Satellite Remote Sensing Facilities Around the World(by Michael Zevin)In the conferences second plenary session, NASAs Daniel Irwin turned the eyes of the conference back to Earth by highlighting the huge impact that NASA missions play in protecting and developing our own planet.Daniel Irwin: using satellite imagery to detect differences in vegetation and find ancient Mayan cities. #aas228 pic.twitter.com/9LFPQdCHTM astrobites (@astrobites) June 13, 2016Irwin came to be involved in NASA through his work mapping Guatemalan jungles, where he would spend 22 days at a time exploring the treacherous jungles on foot armed with a 1st generation GPS, a compass, and a machete. A colleague introduced Irwin to the satellite imagery thathe was exploring, demonstratinghow these images are a strong complement to field work. The sharing of this satellite data with nearby villages helped to show the encroachment of agriculture and the necessity of connecting space to the village. Satellite imagery also played a role in archeological endeavors, uncovering dozens of Mayan cities that have been buried for over a millennia by vegetation, and it provided evidence that the fall of the Mayan civilization may have been due to massive deforestation that ledto drought.Glacial retreat in Chile imaged by ISERV.Irwin displayed the constellation of NASAs Earth-monitoring satellites that have played an integral role in conserving our planet and alerting the world of natural disasters. He also showed
-
Early Design Stage of the MsAa-4 Moessbauer Spectrometer
International Nuclear Information System (INIS)
Blachowski, A.; Ruebenbauer, K.; Zukrowski, J.; Gornicki, R.
2008-01-01
Entirely new Moessbauer spectrometer MsAa-4 is currently under design and construction. New features as compared to the basic features of the previous generation MsAa-3 spectrometer could be summarized as follows. Completely digital processing of the γ-ray detector signal beyond the Gaussian shape filter/amplifier is to be implemented. The spectrometer is going to be able to accommodate external multiple detector heads. One could collect simultaneously up to 128 γ-ray spectra in 16384 channels of 32-bit each and up to 512 Moessbauer spectra in 4096 channels of 32-bit each provided the proper external multiple detector head is used. The count-rate per single detector is limited to about 105 counts per second total. Improved precision of the reference function from 12-bit to 16-bit is to be provided. The reference function is stored in 8192 channels per complete cycle. Addition of the random noise to the reference corner prism of the Michelson-Morley calibration interferometer is to be introduced to avoid spurious fringes due to the phase lock-up. Integrated universal temperature controller being able to use variety of the temperature sensors is to be interconnected with the proper spectrometer. The spectrometer is now a stand-alone network device as it is equipped with the Ethernet connection to the outside world. Modular design and use of the strict standards allows easy reconfiguration for other applications than the Moessbauer spectroscopy. (authors)
-
Microstructure Stability During Creep of Friction Stir Welded AA2024-T3 Alloy
Regev, Michael; Rashkovsky, Tal; Cabibbo, Marcello; Spigarelli, Stefano
2018-01-01
The poor weldability of the AA2024 aluminum alloy limits its use in industrial applications. Because friction stir welding (FSW) is a non-fusion welding process, it seems to be a promising solution for welding this alloy. In the current study, FSW was applied to butt weld AA2024-T3 aluminum alloy plates. Creep tests were conducted at 250 and at 315 °C on both the parent material and the friction stir welded specimens. The microstructures of the welded and non-welded AA2024-T3 specimens before and after the creep tests were studied and compared. A comprehensive transmission electron microscopy study together with a high-resolution scanning electron microscopy study and energy-dispersive x-ray spectroscopy analysis was conducted to investigate the microstructure stability. The parent material seems to contain two kinds of Cu-rich precipitates—coarse precipitates of a few microns each and uniformly dispersed fine nanosized precipitates. Unlike the parent material, the crept specimens were found to contain the two kinds of precipitates mentioned above together with platelet-like precipitates. In addition, extensive decoration of the grain boundaries with precipitates was clearly observed in the crept specimens. Controlled aging experiments for up to 280 h at the relevant temperatures were conducted on both the parent material and the welded specimens in order to isolate the contribution of exposure to high temperatures to the microstructure changes. TEM study showed the development of dislocation networks into a cellular dislocation structure in the case of the parent metal. Changes in the dislocation structure as a function of the creep strain and the FSW process were recorded. A detailed creep data analysis was conducted, taking into account the instability of the microstructure.
-
Somfai, Tamás; Inaba, Yasushi; Aikawa, Yoshio; Ohtake, Masaki; Kobayashi, Shuji; Konishi, Kazuyuki; Nagai, Takashi; Imai, Kei
2010-12-01
The aim of the present study was to optimise the culture conditions for the in vitro production of bovine embryos. The development of in vitro fertilised bovine oocytes in CR1aa supplemented with 5% calf serum and IVD101 culture media were compared using traditional microdrops and Well of the Well (WOW) culture systems either under 5% or 20% oxygen tension. After 7 days of culture, a significantly higher blastocyst formation rate was obtained for embryos cultured in CR1aa medium compared to those cultured in IVD101, irrespective of O2 tensions and culture systems. The blastocyst formation in IVD101 was suppressed under 20% O2 compared to 5% O2 . Despite their similar total cell numbers, higher rates of inner cell mass (ICM) cells were observed in blastocysts developed in IVD101 medium than in those developed in CR1aa, irrespective of O2 tensions. There was no significant difference in blastocyst formation, total, ICM and trophectoderm (TE) cell numbers between embryos obtained by microdrop and WOW culture systems irrespective of the culture media and O2 tensions used. In conclusion, CR1aa resulted in higher blastocyst formation rates irrespective of O2 tension, whereas IVD101 supported blastocyst formation only under low O2 levels but enhanced the proliferation of ICM cells.
-
Microstructure and mechanical properties of GTAW welded joints of AA6105 aluminum alloy
Directory of Open Access Journals (Sweden)
Minerva Dorta-Almenara
2016-09-01
Full Text Available Gas Tungsten Arc Welding (GTAW is one of the most used methods to weld aluminum. This work investigates the influence of welding parameters on the microstructure and mechanical properties of GTAW welded AA6105 aluminum alloy joints. AA6105 alloy plates with different percent values of cold work were joined by GTAW, using various combinations of welding current and speed. The fusion zone, in which the effects of cold work have disappeared, and the heat affected zone of the welded samples were examined under optical and scanning electron microscopes, additionally, mechanical tests and measures of Vickers microhardness were performed. Results showed dendritic morphology with solute micro- and macrosegregation in the fusion zone, which is favored by the constitutional supercooling when heat input increases. When heat input increased and welding speed increased or remained constant, greater segregation was obtained, whereas welding speed decrease produced a coarser microstructure. In the heat affected zone recrystallization, dissolution, and coarsening of precipitates occurred, which led to variations in hardness and strength.
-
Directory of Open Access Journals (Sweden)
Marco Mineo
2016-06-01
Full Text Available Long non-coding RNAs (lncRNAs have an undefined role in the pathobiology of glioblastoma multiforme (GBM. These tumors are genetically and phenotypically heterogeneous with transcriptome subtype-specific GBM stem-like cells (GSCs that adapt to the brain tumor microenvironment, including hypoxic niches. We identified hypoxia-inducible factor 1 alpha-antisense RNA 2 (HIF1A-AS2 as a subtype-specific hypoxia-inducible lncRNA, upregulated in mesenchymal GSCs. Its deregulation affects GSC growth, self-renewal, and hypoxia-dependent molecular reprogramming. Among the HIF1A-AS2 interactome, IGF2BP2 and DHX9 were identified as direct partners. This association was needed for maintenance of expression of their target gene, HMGA1. Downregulation of HIF1A-AS2 led to delayed growth of mesenchymal GSC tumors, survival benefits, and impaired expression of HMGA1 in vivo. Our data demonstrate that HIF1A-AS2 contributes to GSCs’ speciation and adaptation to hypoxia within the tumor microenvironment, acting directly through its interactome and targets and indirectly by modulating responses to hypoxic stress depending on the subtype-specific genetic context.
-
Inorganic arsenic –spe hg–aas method for rice tested in-house and collaboratively
DEFF Research Database (Denmark)
Rasmussen, Rie Romme; Qian, Yiting; Sloth, Jens Jørgen
2013-01-01
and is one of the major contributors to the iAs exposure in many countries. The work presented here describes the development, validation and application of a simple and inexpensive method for inorganic arsenic (iAs) determination in rice samples. The separation of iAs from organoarsenic compounds (MA...... sample extracts (pH 6±1) followed by selective elution of arsenate from a strong anion exchange SPE cartridge enabled the selective iAs quantification by HG-AAS, measuring total arsenic (As) in the SPE eluate. The in-house validation gave mean recoveries of 101–106 % for spiked rice samples and in two...... and DMA) was done by off-line solidphase extraction (SPE) followed by hydride generation atomic absorption spectrometry (HG-AAS) detection. Water bath heating (90 °C, 60 min) of samples with dilute nitric acid and hydrogen peroxide solubilised and oxidized all iAs to arsenate (AsV). Loading of buffered...
-
Investigation of AA2024-T3 surfaces modified by cerium compounds: A localized approach
International Nuclear Information System (INIS)
Paussa, L.; Andreatta, F.; De Felicis, D.; Bemporad, E.; Fedrizzi, L.
2014-01-01
Highlights: •The precipitation of cerium compounds occurs on the entire AA2024-T3 surface. •The matrix is less involved in the cerium precipitation. •Cerium intensely precipitates on Mg-rich IM particles. •The electrochemical behavior of Mg-rich IM particles influences the mechanism of cerium precipitation. -- Abstract: The precipitation of cerium compounds on polished AA2024-T3 surfaces was investigated following an electrochemical and microstructural localized approach. It was found that cerium precipitation occurs on the entire surface covering intermetallic particles and the matrix as well. The matrix is the region where the precipitation of cerium is less favoured. The highest amount of cerium was observed on magnesium-rich intermetallic particles. The localized analyses suggest that precipitation of cerium on magnesium-rich intermetallic particles could happen following two mechanisms: the former based on a potential reversal of the intermetallic particles and the latter due to a partial magnesium dissolution
-
Recent Insights into the Pathogenesis of Type AA Amyloidosis
Directory of Open Access Journals (Sweden)
J. C. H. van der Hilst
2011-01-01
Full Text Available The amyloidoses are a group of life-threatening diseases in which fibrils made of misfolded proteins are deposited in organs and tissues. The fibrils are stable, insoluble aggregates of precursor proteins that have adopted an antiparallel β-sheet structure. In type AA, or reactive, amyloidosis, the precursor protein of the fibrils is serum amyloid A (SAA. SAA is a 104-amino-acid protein that is produced in the liver in response to proinflammatory cytokines. Although the protein that is produced by the liver contains 104 amino acids, only the N-terminal 66–76 amino acids are found in amyloid fibrils. Furthermore, SAA has been shown to have an α-helical structure primarily. Thus, for SAA to be incorporated into an amyloid fibril, two processes have to occur: C-terminal cleavage and conversion into a β-sheet. Only a minority of patients with elevated SAA levels develop amyloidosis. Factors that contribute to the risk of amyloidosis include the duration and degree of SAA elevation, polymorphisms in SAA, and the type of autoinflammatory syndrome. In the Hyper-IgD syndrome, amyloidosis is less prevalent than in the other autoinflammatory diseases. In vitro work has shown that the isoprenoid pathway influences amyloidogenesis by farnesylated proteins. Although many proteins contain domains that have a potential for self-aggregation, amyloidosis is only a very rare event. Heat shock proteins (HSPs are chaperones that assist other proteins to attain, maintain, and regain a functional conformation. In this review, recent insights into the pathogenesis of amyloidosis are discussed, in addition to a new hypothesis for a role of HSPs in the pathogenesis of type AA.
-
Directory of Open Access Journals (Sweden)
Marina V. Vodka
2013-04-01
Full Text Available The effects of carbonic anhydrase inhibitors (АА and EA on the membrane system of isolated chloroplasts of spinach were investigated. Under the influence of AA the considerable alterations in granal structure occurred, the thickness of the granal thylakoids increased by 36% and the interspace between thylakoids by 10% comparable with the control. As a result of EA treatment, the thickness of granal thylakoids enhanced by 31% and the interspace between thylakoids increased by 8% in comparison to the control. It was shown that structure of the granal system of the chloroplast was more sensitive to AA than EA. The data obtained can indicate a decrease in the activity of the thylakoid carbonic anhydrase, inhibition of electron transport and photosynthetic process as a whole in the presence of carbonic anhydrase inhibitors (AA and EA.
-
AA, radiation shielding curtain along the target area
CERN PhotoLab
1980-01-01
At the far left is the beam tube for the high-intensity proton beam from the 26 GeV PS. The tube ends in a thin window and the proton beam continues in air through a hole in the shielding blocks (see also 8010308), behind which the target (see 7905091, 7905094)was located. After the target followed the magnetic horn, focusing the antiprotons, and the first part of the injection line with a proton dump. The antiprotons, deflected by a magnet, left the target area through another shielding wall, to make their way to the AA ring. Laterally, this sequence of components was shielded with movable, suspended, concrete blocks: the "curtain". Balasz Szeless, who had constructed it, is standing at its side.
-
Langevin dynamics of A+A reactions in one dimension
International Nuclear Information System (INIS)
Sancho, J M; Romero, A H; Lacasta, A M; Lindenberg, Katja
2007-01-01
We propose a set of Langevin equations of motion together with a reaction rule for the study of binary reactions. Our scheme is designed to address this problem for arbitrary friction γ and temperature T. It easily accommodates the inclusion of a substrate potential, and it lends itself to straightforward numerical integration. We test this approach on diffusion-limited (γ → ∞) as well as ballistic (γ = 0) A+A → P reactions for which there are extensive exact and approximate theoretical results as well as extensive Monte Carlo results. We reproduce the known results using our integration scheme, and also present new results for the ballistic reactions
-
Directory of Open Access Journals (Sweden)
Nazar Mohammad Ranjha
2015-06-01
Full Text Available Objective of the present work was to synthesize hydrogels of acrylic acid/polyvinyl alcohol (AA/PVA by free radical polymerization by using glutaradehyde (GA as crosslinkers. The hydrogels were evaluated for swelling, diffusion coefficient and network parameters like the average molecular weight between crosslink’s, polymer volume fraction in swollen state, number of repeating units between crosslinks and crosslinking density by using Flory-Huggins theory. It was found that the degree of swelling of AA/PVA hydrogels increases greatly within the pH range 5-7. The gel fraction and porosity increased by increasing the concentration of AA or PVA. Increase in degree of crosslinking, decreased the porosity and inverse was observed in gel fraction. Selected samples were loaded with metoprolol tartrate. Drug release was studied in USP hydrochloric acid solution of pH 1.2 and phosphate buffer solutions of pH 5.5 and 7.5. Various kinetics models like zero order, first order, Higuchi and Peppas model were used for in vitro kinetic studies. The results showed that the drug release followed concentration dependent effect (First order kinetics with non-Fickian diffusion. FTIR and SEM used to study the structure, crystallinity, compatibility, thermal stability and morphology of prepared and drug loaded hydrogels respectively.
-
International Nuclear Information System (INIS)
Zong Zhaowen; Ren Yongchuan; Shen Yue; Chen Yonghua; Ran Xinze; Shi Chunmeng; Cheng Tianmin
2011-01-01
Objective: To observe whether dermal multipotent stem cells (dMSCs) treated with platelet-derived growth factor-AA (PDGF-AA) could distribute more frequently to the bone marrow in rats of total body irradiation (TBI). Methods: Male dMSCs were isolated and 10 μg/L PDGF-AA was added to the culture medium and further cultured for 2 h. Then the expression of tenascin-C were examined by Western blot, and the migration ability of dMSCs was assessed in transwell chamber. The pre-treated dMSCs were transplanted by tail vein injection into female rats administered with total body irradiation, and 2 weeks after transplantation, real-time PCR was employed to measure the amount of dMSCs in bone marrow. Non-treated dMSCs served as control.Results PDGF-AA treatment increased the expression of tenascin-C in dMSCs, made (1.79 ± 0.13) × 10 5 cells migrate to the lower chamber under the effect of bone marrow extract, and distributed to bone marrow in TBI rats, significantly more than (1.24 ± 0.09) ×10 5 in non-treated dMSCs (t=8.833, P<0.01). Conclusions: PDGF-AA treatment could enhance the migration ability of dMSCs and increase the amount of dMSCs in bone marrow of TBI rats after transplantation. (authors)
-
Predicting Hot Deformation of AA5182 Sheet
Lee, John T.; Carpenter, Alexander J.; Jodlowski, Jakub P.; Taleff, Eric M.
Aluminum 5000-series alloy sheet materials exhibit substantial ductilities at hot and warm temperatures, even when grain size is not particularly fine. The relatively high strain-rate sensitivity exhibited by these non-superplastic materials, when deforming under solute-drag creep, is a primary contributor to large tensile ductilities. This active deformation mechanism influences both plastic flow and microstructure evolution across conditions of interest for hot- and warm-forming. Data are presented from uniaxial tensile and biaxial bulge tests of AA5182 sheet material at elevated temperatures. These data are used to construct a material constitutive model for plastic flow, which is applied in finite-element-method (FEM) simulations of plastic deformation under multiaxial stress states. Simulation results are directly compared against experimental data to explore the usefulness of this constitutive model. The effects of temperature and stress state on plastic response and microstructure evolution are discussed.
-
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available chizosaccharomyces pombe] ref|NP_594201.1| spindle poison ... sensitivity related protein. [Schizosac...charomyces pombe] ... pir||T11624 spindle poison sensitivity protein - fis...inger protein | spindle poison sensitivity related protein; >1rgoA 8 70 40 92 2e-04 ... emb|CAB16391.1| scp3 [S... Ca19AnnotatedDec2004aaSeq orf19.7385; Contig19-2513; 105328..106833; LEE1*; zinc f
-
Poon, Darren M C; Chan, Kuen; Lee, Siu H; Chan, Tim W; Sze, Henry; Lee, Eric K C; Lam, Daisy; Chan, Michelle F T
2018-03-01
This study aimed to compare the efficacy of abiraterone acetate (AA) versus docetaxel (T) as first-line treatment in chemo-naïve metastatic castration-resistant prostate cancer (mCRPC) patients with or without the ineligible factors of the COU-AA-302 study (presence of visceral metastases, symptomatic disease, and/or Eastern Cooperative Oncology Group performance status ≥ 2). The clinical records of chemo-naïve mCRPC patients who received AA in six public oncology centers or T in two of these centers between 2003 and 2014 were reviewed. The survival time was compared among four subgroups of patients: those with ineligible factors administered AA (Group Ineligible-AA) or T (Group Ineligible-T), and those without ineligible factors and administered AA (Group Eligible-AA) or T (Group Eligible-T). During the study period, we identified 115 mCRPC patients who received AA or T, among whom 29, 36, 29, and 21 patients were classified as Groups Ineligible-AA, Ineligible-T, Eligible-AA, and Eligible-T, respectively. Both Group Ineligible-AA and Group Eligible-AA had significantly longer progression-free survival (PFS) and similar overall survival (OS) as Group Ineligible-T and Group Eligible-T (Ineligible, PFS: 6.3 vs. 5.9 months, P = 0.0234, OS: 7.8 vs. 15.7 months, P = 0.1601; Eligible, PFS: 9.8 vs. 5.6 months, P = 0.0437, OS: 20.5 vs. 18.2 months, P = 0.7820). Compared to T, AA treatment resulted in longer PFS and similar OS in chemo-naïve mCRPC patients, irrespective of the presence of ineligible factors, suggesting that the initial treatment by AA may still be beneficial to those with the aforementioned ineligible factors.
-
Draft Genome Sequence of the Putrescine-Producing Strain Lactococcus lactis subsp. lactis 1AA59
del Rio, Beatriz; Linares, Daniel M.; Fernandez, María; Mayo, Baltasar; Martín, M. Cruz
2015-01-01
We report here the 2,576,542-bp genome annotated draft assembly sequence of Lactococcus lactis subsp. lactis 1AA59. This strain—isolated from a traditional cheese—produces putrescine, one of the most frequently biogenic amines found in dairy products. PMID:26089428
-
International Nuclear Information System (INIS)
Kim, Soosung; Lee, Haein; Lee, Donbae; Park, Jongman; Lee, Yoonsang
2013-01-01
Certain characteristics, such as solidification cracking, porosity, HAZ (Heat-affected Zone) degradation must be considered during welding. Because of high energy density and low heat input, especially LBW and EBW processes posses the advantage of minimizing the fusing zone and HAZ and producing deeper penetration than arc welding processes. In present study, to apply for the nuclear fuel plate fabrication and assembly, a fundamental EBW experiment using AA6061-T6 aluminum alloy specimens was conducted. Furthermore, to establish the welding process, and satisfy the requirements of the weld quality, EBW apparatus using a electron welding gun and vacuum chamber was developed, and preliminary investigations for optimizing the welding parameters of the specimens using AA6061-T6 aluminum plates were also performed. In this experiment, a feasibility test was carried out by tensile tester, bead-on-plate welding and metallographic examination to comply with the aluminum welding procedure. The EB weld quality of AA6061-T6 aluminum alloy for the fuel plate assembly has been also studied by the mechanical testing and microstructure examinations. This study was carried out to determine the suitable welding process and to investigate tensile strength of AA6061-T6 aluminum alloy. In the present experiment, satisfactory EBW of the square butt weld specimens was developed. In comparison with the rolling directions of test specimens, the tensile strengths were no difference between the longitudinal and transverse welds. Based on this fundamental study, fabrication and assembly of the nuclear fuel plates will be provided for the future Kijang research reactor project
-
Evaluación de la corrosión por picadura en aluminio AA1050
Directory of Open Access Journals (Sweden)
Luis Garita-Arce
2014-09-01
Los ensayos realizados según la norma ASTM G100- 89 para las aleaciones consideradas no indicaron diferencias significativas, aunque sí se observó que la aleación AA1050 presenta mayor susceptibilidad a la picadura en ámbitos de un pH= 7 y con deformaciones elevadas.
-
Hussain, Syed-Rehan A.; Flórez, Álvaro M.; Dean, Donald H.; Alzate, Óscar
2011-01-01
Título español: Protección preferencial de los dominios II y III de la toxina Cry1Aa de Bacillus thuringiensis en Vesículas de Membrana de Borde de Cepillo Abstract The surface exposed Leucine 371 on loop 2 of domain II, in Cry1Aa toxin, was mutated to Lysine to generate the trypsin-sensitive mutant, L371K. Upon trypsin digestion L371K is cleaved into approximately 37 and 26 kDa fragments. These are separable on SDS-PAGE, but remain as a single molecule of 65 kDa upon purification by ...
-
Syed-Rehan A. Hussain; Álvaro M. Flórez; Donald H. Dean; Óscar Alzate
2011-01-01
Título español: Protección preferencial de los dominios II y III de la toxina Cry1Aa de Bacillus thuringiensis en Vesículas de Membrana de Borde de Cepillo Abstract The surface exposed Leucine 371 on loop 2 of domain II, in Cry1Aa toxin, was mutated to Lysine to generate the trypsin-sensitive mutant, L371K. Upon trypsin digestion L371K is cleaved into approximately 37 and 26 kDa fragments. These are separable on SDS-PAGE, but remain as a single molecule of 65 kDa upon purification by ...
-
Seismic analysis of HD 43587Aa, a solar-like oscillator in a multiple system
Boumier, P.; Benomar, O.; Baudin, F.; Verner, G.; Appourchaux, T.; Lebreton, Y.; Gaulme, P.; Chaplin, W.; García, R.A.; Hekker, S.; Regulo, C.; Salabert, D.; Stahn, T.; Elsworth, Y.; Gizon, L.; Hall, M.; Mathur, S.; Michel, E.; Morel, T.; Mosser, B.; Poretti, E.; Rainer, M.; Roxburgh, I.; do Nascimento Jr., J.D.; Samadi, R.; Auvergne, M.; Chaintreuil, S.; Baglin, A.; Catala, C.
2014-01-01
Context. The object HD 43587Aa is a G0V star observed during the 145-day LRa03 run of the COnvection, ROtation and planetary Transits space mission (CoRoT), for which complementary High Accuracy Radial velocity Planet Searcher (HARPS) spectra with S/N > 300 were also obtained. Its visual magnitude
-
A profile of Keith AA Fox, cardiologist and researcher.
Fox, Keith A A; Telfer, Caroline
2014-01-01
Professor Keith AA Fox speaks to Caroline Telfer, Commissioning Editor. Professor Keith AA Fox is the British Heart Foundation and the Duke of Edinburgh Professor of Cardiology at the University of Edinburgh (UK). He is a founding fellow of the European Society of Cardiology and is currently Chair of the Programme of the European Society of Cardiology. In addition, he was President of the British Cardiovascular Society from 2009 to 2012. Professor Fox gave the State-of-the-Art lecture on acute coronary syndromes at the American Heart Association, as well as the 2009 Plenary lecture at the European Society of Cardiology-American College of Cardiology Symposium, the Lord Rayner lecture of the Royal College of Physicians (London, UK) and the Sir Stanley Davidson Lecture of the Royal College (Edinburgh, UK). He was awarded the Silver Medal of the European Society of Cardiology in 2010. Professor Fox's major research interest lies in the mechanisms and manifestations of acute coronary arterial disease; his work extends from underlying biological mechanisms to in vitro and in vivo studies and clinical trials. He is the author of more than 587 scientific papers (H-index Web of Science 73, Citations: 30,261 to March 2013). Professor Fox is chairman of the RITA program, co-chairman of ROCKET-AF and OASIS program, and chair of the GRACE program (the largest multinational study in acute coronary syndromes), and a lead investigator for studies on novel antithrombins, anticoagulants and antiplatelets. He is an International Associate Editor of the European Heart Journal and a member of the editorial boards of a number of journals. His current areas of research include the inhibition of coronary thrombosis and the role of platelets and inflammation in acute coronary syndromes.
-
Fienberg, R. T.; Speck, A. K.; Habbal, S. R.
2017-12-01
More than three years ahead of the "Great American Eclipse" of August 2017, the American Astronomical Society formed the AAS Solar Eclipse Task Force to function as a think tank, coordinating body, and communication gateway to the vast resources available about the 2017 eclipse and solar eclipses more generally. The task force included professional and amateur astronomers, formal and informal educators, and science journalists; many had experienced total solar eclipses before, and others would experience their first totality in August 2017. The AAS task force secured funding from the AAS Council, the National Science Foundation, and NASA. These resources were used mainly for three purposes: (1) to build a website that contains basic information about solar eclipses, safe viewing practices, and eclipse imaging and video, along with resources for educators and the media and a searchable map of eclipse-related events and activities, with links to other authoritative websites with more detailed information; (2) to solicit, receive, evaluate, and fund proposals for mini-grants to support eclipse-related education and public outreach to underrepresented groups both inside and outside the path of totality; and (3) to organize a series of multidisciplinary workshops across the country to prepare communities for the eclipse and to facilitate collaborations between astronomers, meteorologists, school administrators, and transporation and emergency-management professionals. Most importantly, the AAS Solar Eclipse Task Force focused on developing and disseminating appropriate eclipse safety information. The AAS and NASA jointly developed safety messaging that won the endorsement of the American Academies of Opthalmology and Optometry. In the weeks immediately preceding the eclipse, it became clear that the marketplace was being flooded by counterfeit eclipse glasses and solar viewers, leading to a last minute change in our communication strategy. In this talk, we'll review the
-
Joining of hybrid AA6063-6SiCp-3Grp composite and AISI 1030 steel by friction welding
Directory of Open Access Journals (Sweden)
N. Rajesh Jesudoss Hynes
2017-10-01
Full Text Available Joining of metals and aluminium hybrid metal matrix composites has significant applications in aviation, ship building and automotive industries. In the present work, investigation is carried out on Friction Welding of AISI 1030 steel and hybrid AA6063-6SiCp-3Grpcomposite, that are difficult to weld by fusion welding technique. Silicon carbide and graphite particle reinforced AA6063 matrix hybrid composite was developed successfully using stir casting method and the joining feasibility of AISI1030 steel with AA6063-6SiCp-3Grp hybrid composite was tried out by friction stud welding technique. During friction stage of welding process, the particulates (SiC & Graphite used for reinforcement, tend to increase the viscosity and lead to improper mixing of matrix and reinforcement. This eventually results in lower strength in dissimilar joints. To overcome this difficulty AA1100 interlayer is used while joining hybrid composite to AISI 1030 steel. Experimentation was carried out using Taguchi based design of experiments (DOE technique. Multiple regression methods were applied to understand the relationship between process parameters of the friction stud welding process. Micro structural examination reveals three separate zones namely fully plasticized zone, partially deformed zone and unaffected base material zone. Ultra fine dynamically recrystallized grains of about 341 nm were observed at the fully plasticized zone. EDX analysis confirms the presence of intermetallic compound Fe2Al5 at the joint interface. According to the experimental analysis using DOE, rotational speed and interlayer sheet thickness contribute about 39% and 36% respectively in determining the impact strength of the welded joints. It is found that joining with 0.5 mm interlayer sheet provides efficient joints. Developed regression model could be used to predict the axial shortening distance and impact strength of the welded joint with reasonable accuracy.
-
Air quality evaluation of some industrial cities of Pakistan using INAA and AAS
International Nuclear Information System (INIS)
Waheed, S.; Rahman, A.; Daud, M.; Rahman, S.; Ahmad, S.; Islam, Z.
2005-01-01
Instrumental neutron activation analysis technique (INAA) and atomic absorption spectrometry (AAS) have been employed for the characterization of 40 trace elements in suspended particulate matter (SPM) and soil samples from Pakistan's industrially important cities of Gujranwala and Faisalabad. The air particulates, which were collected from five different locations of each city, indicate moderate to unhealthy air quality with SPM levels above the World Health Organization (WHO) guidelines. Enrichment factors (EF) for all the elements have been calculated with respect to their concentrations in the soils. Some of the areas of Gujranwala show high EF values for Pb, Cr, Cu, Cd and Ca, which may indicate contributions due to heavy traffic with automotive exhaust, tanneries and many other acute anthropogenic activities in this area. The presence of high concentration of Cr is due to chrome plating units and leather industry in the adjoining areas. Similarly few sites from Faisalabad have high Pb, Cd and Sb contents from vehicular aerosols with the contributions from coal combustion, battery manufacturing industries, lead smelters and numerous other industries. IAEA Reference Materials were analyzed for the validation of INAA and AAS procedures employed and to ensure the accuracy and precision of the characterized data. (orig.)
-
The effects of various reinforcements on dry sliding wear behaviour of AA 6061 nanocomposites
International Nuclear Information System (INIS)
Jeyasimman, D.; Narayanasamy, R.; Ponalagusamy, R.; Anandakrishnan, V.; Kamaraj, M.
2014-01-01
Highlights: • Wear and friction coefficient of nanocomposites were investigated. • The worn surface morphologies of nanocomposites were analysed. • The wear rate was increased with increasing load and sliding velocity. • The friction coefficient was decreased with increasing load and sliding velocity. - Abstract: The present work aims to investigate the dry sliding wear behaviour of AA 6061 nanocomposites reinforced with various nanolevel reinforcements, such as titanium carbide (TiC), gamma phase alumina (γ-Al 2 O 3 ) and hybrid (TiC + Al 2 O 3 ) nanoparticles with two weight percentages (wt.%) prepared by 30 h of mechanical alloying (MA). The tests were performed using a pin-on-disk wear tester by sliding these pin specimens at sliding speeds of 0.6, 0.9 and 1.2 m/s against an oil-hardened non-shrinking (OHNS) steel disk at room temperature. Wear tests were conducted for normal loads of 5, 7 and 10 N at different sliding speeds at room temperature. The variations of the friction coefficient and the wear rate with the sliding distances (500 m, 1000 m and 1600 m) for different normal loads and sliding velocities were plotted and investigated. To observe the wear characteristics and to investigate the wear mechanism, the morphologies of the worn surfaces were analysed using a scanning electron microscope (SEM). The formation of an oxide layer on the worn surface was examined by energy dispersive spectroscopy (EDS). The wear rate was found to increase with the load and sliding velocity for all prepared nanocomposites. Hybrid (TiC + Al 2 O 3 ) reinforced AA 6061 nanocomposites had lower wear rates and friction coefficients compared with TiC and Al 2 O 3 reinforced AA 6061 nanocomposites
-
The strain path dependence of plastic deformation response of AA5754: Experiment and modeling
International Nuclear Information System (INIS)
Pham, Minh-Son; Hu, Lin; Iadicola, Mark; Creuziger, Adam; Rollett, Anthony D.
2013-01-01
This work presents modeling of experiments on a balanced biaxial (BB) pre-strained AA5754 alloy, subsequently reloaded uniaxially along the rolling direction and transverse direction. The material exhibits a complex plastic deformation response during the change in strain path due to 1) crystallographic texture, 2) aging (interactions between dislocations and Mg atoms) and 3) recovery (annihilation and re-arrangement of dislocations). With a BB prestrain of about 5 %, the aging process is dominant, and the yield strength for uniaxially deformed samples is observed to be higher than the flow stress during BB straining. The strain hardening rate after changing path is, however, lower than that for pre-straining. Higher degrees of pre-straining make the dynamic recovery more active. The dynamic recovery at higher strain levels compensates for the aging effect, and results in: 1) a reduction of the yield strength, and 2) an increase in the hardening rate of re-strained specimens along other directions. The yield strength of deformed samples is further reduced if these samples are left at room temperature to let static recovery occur. The synergistic influences of texture condition, aging and recovery processes on the material response make the modeling of strain path dependence of mechanical behavior of AA5754 challenging. In this study, the influence of crystallographic texture is taken into account by incorporating the latent hardening into a visco-plastic self-consistent model. Different strengths of dislocation glide interaction models in 24 slip systems are used to represent the latent hardening. Moreover, the aging and recovery effects are also included into the latent hardening model by considering strong interactions between dislocations and dissolved atom Mg and the microstructural evolution. These microstructural considerations provide a powerful capability to successfully describe the strain path dependence of plastic deformation behavior of AA5754
-
AA, shims and washers on quadrupole ends
CERN PhotoLab
1981-01-01
Due to the fact that much of the field of the quadrupoles was outside the iron (in particular with the wide quadrupoles) and that thus the fields of quadrupoles and bending magnets interacted, the lattice properties of the AA could not be predicted with the required accuracy. After a first running period in 1980, during which detailed measurements were made with proton test beams, corrections to the quadrupoles were made in 1981, in the form of laminated shims at the ends of the poles, and with steel washers. With the latter ones, further refinements were made in an iterative procedure with measurements on the circulating beam. This eventually resulted, amongst other things, in a very low chromaticity, with the Q-values being constant to within +- 0.001 over the total momentum range of 6 %. Here we see the shims and washers on a narrow qudrupole (QFN, QDN). See also 8103203, 8103204, 8103205, 8103206.
-
Berndt, Sandra; Ebben, Barbara; Kubinski, Eva; Sim, Grant; Liu, Kristin; Lazarus, Sheryl; Thurlow, Martha; Christian, Elizabeth
2011-01-01
Beginning in 2007, federal regulations to two major education laws gave state departments of education the option to develop an alternate assessment based on modified achievement standards (AA-MAS) for some students with disabilities. The regulations stated that the AA-MAS was intended for students who were being instructed in the grade-level…
-
Ghosh, Rahul; Venugopal, A.; Sankaravelayudham, P.; Panda, Rajiv; Sharma, S. C.; George, Koshy M.; Raja, V. S.
2015-02-01
The influence of thermomechanical treatment on the stress corrosion cracking behavior of AA7075 aluminum alloy forgings was examined in 3.5% NaCl solution by varying the extent of thermomechanical working imparted to each of the conditions. The results show that inadequate working during billet processing resulted in inferior corrosion and mechanical properties. However, more working with intermediate pre-heating stages also led to precipitation of coarse particles resulting in lowering of mechanical properties marginally and a significant reduction in the general/pitting corrosion resistance. The results obtained in the present study indicate that optimum working with controlled pre-heating levels is needed during forging to achieve the desired properties. It is also demonstrated that AA7075 in the over aged condition does not show any environmental cracking susceptibility in spite of the microstructural variations in terms of size and volume fraction of the precipitates. However, the above microstructural variations definitely affected the pitting corrosion and mechanical properties significantly and hence a strict control over the working and pre-heating stages during billet processing is suggested.
-
Zhang, Liping; Ling, Bo; Wang, Lun; Chen, Hongqi
2017-09-01
An upconversion luminescence method was developed for the determination of glutathione (GSH), L-cysteine (Cys) or L-ascorbic acid (AA) based on redox reaction. We synthesized poly(acrylic acid) (PAA)-modified Mn 2+ -doped NaYF 4 :Yb,Tm upconversion nanoparticles (UCNPs), and the luminescence of these UCNPs was effectively quenched due to their carboxyl groups coordinating with Fe 3+ to form a UCNPs/Fe 3+ system. GSH, Cys or AA reduced Fe 3+ to Fe 2+ , which induced the luminescence recovery of the UCNPs. Under the optimized conditions, wide linear concentration ranges from 0.25-300μM for GSH, 0.5-875μM for Cys and 0.5-350μM for AA were found, and the detection limits (3S/K) were 0.2μM, 0.5μM and 0.2μM, respectively. Thus, the UCNPs/Fe 3+ system was successfully applied for sensing GSH, Cys or AA. Copyright © 2017 Elsevier B.V. All rights reserved.
-
Energy Technology Data Exchange (ETDEWEB)
Naseri, M.; Reihanian, M. [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz, Ahvaz (Iran, Islamic Republic of); Borhani, E., E-mail: e.borhani@semnan.ac.ir [Department of Nano Technology, Nano Materials Group, Semnan University, Semnan (Iran, Islamic Republic of)
2016-02-22
Nano/ultrafine grained (NG/UFG) AA2024 alloy produced by accumulative roll bonding (ARB) showed high strength (420 MPa) and very limited elongation (about 1.3%). A new strategy via ARB was developed to improve elongation (about 10%) of AA2024 alloy with a relatively high strength (365 MPa). The present strategy produced a bimodal structure consisting of coarse and ultrafine elongated grains in comparison to the UFG alloy. Electron backscattered diffraction (EBSD) revealed that after 4 ARB cycles, the fraction of high angle grain boundaries and mean misorientation angle of the boundaries in the bimodal grain structure were 61% and 27.34°, respectively, in comparison to that of annealed (54% and 24.96°) and UFG (79% and 34.27°) alloy. The crystallographic texture results indicated that, unlike the annealed AA2024 alloy, the intensity of Brass {011}<211> and S {123}<634> components remarkably increased in the UFG and bimodal alloy. Scanning electron microscopy (SEM) observations demonstrated that failure mode in bimodal alloy was ductile fracture with a combination of deep and shallow dimples.
-
Directory of Open Access Journals (Sweden)
Gamal H. Osman
2018-03-01
Full Text Available Black cutworm (BCW Agrotis ipsilon, an economically important lepidopteran insect, has attracted a great attention. Bacillus thuringiensis (Bt is spore forming soil bacteria and is an excellent environment-friendly approach for the control of phytophagous and disease-transmitting insects. In fact, bio-pesticide formulations and insect resistant transgenic plants based on the bacterium Bt delta-endotoxin have attracted worldwide attention as a safer alternative to harmful chemical pesticides. The major objective of the current study was to understand the mechanism of interaction of Bt toxin with its receptor molecule(s. The investigation involved the isolation, identification, and characterization of a putative receptor – vip3Aa. In addition, the kinetics of vip toxin binding to its receptor molecule was also studied. The present data suggest that Vip3Aa toxin bound specifically with high affinity to a 48-kDa protein present at the brush border membrane vesicles (BBMV prepared from the midgut epithelial cells of BCW larvae. Keywords: Receptor, vip3Aa, Bacillus thuringiensis, BBMV
-
Jung, Jeki; Oak, Jeong-Jung; Kim, Yong-Hwan; Cho, Yi Je; Park, Yong Ho
2017-11-01
The aim of this study was to investigate the transition of wear behavior for pure aluminum and extruded aluminum alloy 2024-T4 (AA2024-T4). The wear test was carried using a ball-on-disc wear testing machine at various vertical loads and linear speeds. The transition of wear behaviors was analyzed based on the microstructure, wear tracks, wear cross-section, and wear debris. The critical wear rates for each material are occurred at lower linear speed for each vertical load. The transition of wear behavior was observed in which abrasion wears with the generation of an oxide layer, fracture of oxide layer, adhesion wear, severe adhesion wear, and the generation of seizure occurred in sequence. In case of the pure aluminum, the change of wear debris occurred in the order of blocky, flake, and needle-like debris. Cutting chip, flake-like, and coarse flake-like debris was occurred in sequence for the extruded AA2024-T4. The transition in the wear behavior of extruded AA2024-T4 occurred slower than in pure aluminum.
-
Effects of Different Filler Metals on the Mechanical Behaviors of GTA Welded AA7A52(T6)
Shu, Fengyuan; Lv, Yaohui; Liu, Yuxin; Lin, Jianjun; Sun, Zhe; Xu, Binshi; He, Peng
2014-06-01
ER4043, ER5356, and AA7A52 on behalf of the Al-Si, Al-Mg, and Al-Zn-Mg-based welding material, respectively, were chosen as the filler metal to weld AA7A52(T6) plates by GTAW. The variance in mechanical performances of the joints caused by the various filler materials was investigated with reference to the SEM and EDS test results for the weld seam and the fracture surface. Failure was found in the seam for all the welded joints. With regard to the joint obtained with ER4043 welding wire, the total elongation was limited by the brittle intergranular compound Mg2Si of which Mg was introduced by convection mass transfer. As for the other two welds, the content ratio of Zn and Mg was found to play the dominant role in deciding the mechanical properties of the intergranular Mg-Zn compounds which were responsible for the tensile behavior of the joints. The content ratio (wt.%) of beyond 2:1 gave birth to the strengthening phase MgZn2 leading to a ductile fracture. Cr in the seam obtained with AA7A52 filler metal was found to enhance the strength of the joint through isolated particles.
-
Bhaskar Kurapati, Vijaya; Kommineni, Ravindra
2017-09-01
In the present work AA 2024 alloy reinforced with mixtures of SiC and Fly Ash (FA) particles of 70 µm (5, 10 and 15 wt. %) are fabricated using the stir casting method. Both reinforcements are added in equal weight proportions. The wear test specimens are prepared from both the alloy and composite castings in the dimensions of Ф 4 mm and 30 mm lengths by the wire cut EDM process. The dry sliding wear properties of the prepared composites at room temperature are estimated by pin-on-disc wear testing equipment. The wear characteristics of the composites are studied by conducting the dry sliding wear test over loads of 0.5 Kgf, 1.0 Kgf, 1.5 Kgf, a track diameter of 60 mm and sliding times of 15 min, 30 min, 45min. The experimental results shows that the wear decreases with an increase in the weight percentage of FA and SiC particles in the matrix. Additionally wear increases with an increase in load and sliding time. Further, it is found that the wear resistance of the AA2024-Hybrid composites is higher than that of the AA2024 matrix.
-
Zúñiga-Navarrete, Fernando; Gómez, Isabel; Peña, Guadalupe; Bravo, Alejandra; Soberón, Mario
2013-03-01
Bacillus thuringiensis Cry toxins recognizes their target cells in part by the binding to glycosyl-phosphatidyl-inositol (GPI) anchored proteins such as aminopeptidase-N (APN) or alkaline phosphatases (ALP). Treatment of Tenebrio molitor brush border membrane vesicles (BBMV) with phospholipase C that cleaves out GPI-anchored proteins from the membranes, showed that GPI-anchored proteins are involved in binding of Cry3Aa toxin to BBMV. A 68 kDa GPI-anchored ALP was shown to bind Cry3Aa by toxin overlay assays. The 68 kDa GPI-anchored ALP was preferentially expressed in early instar larvae in comparison to late instar larvae. Our work shows for the first time that GPI-anchored ALP is important for Cry3Aa binding to T. molitor BBMV suggesting that the mode of action of Cry toxins is conserved in different insect orders. Copyright © 2012 Elsevier Inc. All rights reserved.
-
International Nuclear Information System (INIS)
Vijayakumar, S.; Winter, K.; Sause, W.; Gallagher, M.J.; Perez, C.; Bondy, M.
1996-01-01
Purpose/Objective: To use pretreatment serum PSA levels as an 20), gleason score (2-5,6-7,7-10), race (whites and AAs), and two interactions viz (a) PSA by race (p=0.0012) and (b) PSA by total gleason score (p=0.0001). When race was replaced by educational status, or income, or both, the fits (0.8246,0.8197, and 0.7815, respectively) were not as good as the fit with race in the model. Conclusion: The findings of this nation-wide prospective registration study with a high percentage of AA patient participation confirms previous, smaller, geographically-limited studies (1,2,3) results that AA patients with non-metastatic PC present with a higher mean PSA values than whites. The multivariate findings imply that, for each level of total gleason score, there is a higher percentage of whites with PSA levels 20. Education and/or income as surrogates of sociological status could not completely explain the racial differences. Other reasons for health-care barriers among AAs need to be identified
-
Considerations for Consortia as States Transition Away from AA-MAS. NCEO Brief. Number 7
National Center on Educational Outcomes, 2014
2014-01-01
States with an alternate assessment based on modified achievement standards (AA-MAS) that received a flexibility waiver from some of the requirements of No Child Left Behind are required to phase out their use of this assessment. And, on August 23, 2013, the U.S. Department of Education published a proposed rollback of regulation that allowed the…
-
Rajendran, C.; Srinivasan, K.; Balasubramanian, V.; Balaji, H.; Selvaraj, P.
2016-08-01
Friction stir welded (FSWed) joints of aluminum alloys exhibited a hardness drop in both the advancing side (AS) and retreating side (RS) of the thermo-mechanically affected zone (TMAZ) due to the thermal cycle involved in the FSW process. In this investigation, an attempt has been made to overcome this problem by post weld heat treatment (PWHT) methods. FSW butt (FSWB) joints of Al-Cu (AA2014-T6) alloy were PWHT by two methods such as simple artificial aging (AA) and solution treatment followed by artificial aging (STA). Of these two treatments, STA was found to be more beneficial than the simple aging treatment to improve the tensile properties of the FSW joints of AA2014 aluminum alloy.
-
International Nuclear Information System (INIS)
Popescu, Ion V.; Iordan, M.; Stihi, C.; Bancuta, A.; Dima, G.; Busuioc, G.; Ciupina, V.; Belc, M.; Badica, T.
2003-01-01
The aim of this work is to determine the elemental composition of tree leaves using Proton-Induced X-Rays Emission (PIXE) and Atomic Absorption Spectrophotometry (AAS) methods. By PIXE Spectrometry we identified and determined the concentration of S, Cl, K, Ca, Ti, Cr, Mn, Fe, Co, Ni, Cu Zn, As, Br, Sr and by AAS method the concentration of elements: Cr, Mn, Fe, Co, Cu, Zn, Se, Cd. Pb was identified in only 2 samples from 29. For tree leave samples collected at a large distance to the polluting source the Sr concentration decreased and the Mg, Ca, Se, Zn and Fe concentrations increased. Also, we can observe a small affinity of these leaves for the environmental Pb which was detected for two samples at a small distance to polluting source. (authors)
-
Insights into the Structure of the Vip3Aa Insecticidal Protein by Protease Digestion Analysis
Directory of Open Access Journals (Sweden)
Yolanda Bel
2017-04-01
Full Text Available Vip3 proteins are secretable proteins from Bacillus thuringiensis whose mode of action is still poorly understood. In this study, the activation process for Vip3 proteins was closely examined in order to better understand the Vip3Aa protein stability and to shed light on its structure. The Vip3Aa protoxin (of 89 kDa was treated with trypsin at concentrations from 1:100 to 120:100 (trypsin:Vip3A, w:w. If the action of trypsin was not properly neutralized, the results of SDS-PAGE analysis (as well as those with Agrotis ipsilon midgut juice equivocally indicated that the protoxin could be completely processed. However, when the proteolytic reaction was efficiently stopped, it was revealed that the protoxin was only cleaved at a primary cleavage site, regardless of the amount of trypsin used. The 66 kDa and the 19 kDa peptides generated by the proteases co-eluted after gel filtration chromatography, indicating that they remain together after cleavage. The 66 kDa fragment was found to be extremely resistant to proteases. The trypsin treatment of the protoxin in the presence of SDS revealed the presence of secondary cleavage sites at S-509, and presumably at T-466 and V-372, rendering C-terminal fragments of approximately 29, 32, and 42 kDa, respectively. The fact that the predicted secondary structure of the Vip3Aa protein shows a cluster of beta sheets in the C-terminal region of the protein might be the reason behind the higher stability to proteases compared to the rest of the protein, which is mainly composed of alpha helices.
-
One of the 10 cells of AA Injection Kicker K4
CERN PhotoLab
1979-01-01
The 3.5 GeV/c Antiproton Accumulator (AA) had 2 delay-line type injection kickers, K3 (12 cells) and K4 (10 cells). Here we see one of the K4 cells, with ferrite between stainless-steel plates. Pulse voltage: 61 kV; rise/fall-time 86 ns; flat-top 460 ns; top flatness +-2%. During injection, the open side of the C-shaped kickers was closed off with a fast shutter, so that their stray field would not perturb the stack of already accumulated antiprotons.
-
aaBBB: The Strophic Form of Fernan Rodriguez de Calheiros 7
Directory of Open Access Journals (Sweden)
Rip Cohen
2016-12-01
Full Text Available The refrain of a cantiga d’amigo by Fernan Rodriguez Calheiros (B 632/V 233, heretofore misunderstood as consisting of five verses, should be taken as a 3-verse refrain with two internal rhymes in the middle verse, conforming to the strophic form aaBBB. This analysis is confirmed by two virtuoso features: the middle verse of the BBB refrain scans longer than the outer ones but corresponds to the verses of the distich; and the text constitutes an example of a BBB refrain where the third verse repeats the first.
-
Directory of Open Access Journals (Sweden)
Aftab eAhmad
2015-12-01
Full Text Available Study and research of Bt (Bacillus thuringiensis transgenic plants have opened new ways to combat insect pests. Over the decades, however, insect pests, especially the Lepidopteran, have developed tolerance against Bt delta-endotoxins. Such issues can be addressed through the development of novel toxins with greater toxicity and affinity against a broad range of insect receptors. In this computational study, functional domains of Bacillus thuringiensis crystal delta-endotoxin (Cry1Ac insecticidal protein and vegetative insecticidal protein (Vip3Aa have been fused to develop a broad-range Vip3Aa-Cry1Ac fusion protein. Cry1Ac and Vip3Aa are non-homologous insecticidal proteins possessing receptors against different targets within the midgut of insects. The insecticidal proteins were fused to broaden the insecticidal activity. Molecular docking analysis of the fusion protein against aminopeptidase-N (APN and cadherin receptors of five Lepidopteran insects (Agrotis ipsilon, Helicoverpa armigera, Pectinophora gossypiella, Spodoptera exigua and Spodoptera litura revealed that the Ser290, Ser293, Leu337, Thr340 and Arg437 residues of the fusion protein are involved in the interaction with insect receptors. The Helicoverpa armigera cadherin receptor, however, showed no interaction, which might be due to either loss or burial of interactive residues inside the fusion protein. These findings revealed that the Vip3Aa-Cry1Ac fusion protein has a strong affinity against Lepidopteran insect receptors and hence has a potential to be an efficient broad-range insecticidal protein.
-
Mongkolthanaruk, Wiyada; Cooper, Gareth R.; Mawer, Julia S. P.; Allan, Raymond N.; Moir, Anne
2011-01-01
Spores of Bacillus subtilis require the GerAA, GerAB, and GerAC receptor proteins for l-alanine-induced germination. Mutations in gerAA, both random and site directed, result in phenotypes that identify amino acid residues important for receptor function in broad terms. They highlight the functional importance of two regions in the central, integral membrane domain of GerAA. A P324S substitution in the first residue of a conserved PFPP motif results in a 10-fold increase in a spore's sensitivity to alanine; a P326S change results in the release of phase-dark spores, in which the receptor may be in an “activated” or “quasigerminated” state. Substitutions in residues 398 to 400, in a short loop between the last two likely membrane-spanning helices of this central domain, all affect the germination response, with the G398S substitution causing a temperature-sensitive defect. In others, there are wider effects on the receptor: if alanine is substituted for conserved residue N146, H304, or E330, a severe defect in l-alanine germination results. This correlates with the absence of GerAC, suggesting that the assembly or stability of the entire receptor complex has been compromised by the defect in GerAA. In contrast, severely germination-defective mutants such as E129K, L373F, S400F, and M409N mutants retain GerAC at normal levels, suggesting more local and specific effects on the function of GerAA itself. Further interpretation will depend on progress in structural analysis of the receptor proteins. PMID:21378197
-
International Nuclear Information System (INIS)
Thomas, Jeffrey J.; Allen, Andrew J.; Jennings, Hamlin M.
2012-01-01
Alkali-activated slag (AAS) paste was analyzed using small-angle neutron scattering (SANS). The scattering response indicates that the microstructure consists of a uniform matrix of hydration product with a high surface area studded with unhydrated cores of slag particles. In contrast with portland cement paste, no surface fractal scattering regime was detected, and elevated temperature curing (at 60 °C) had no detectable effect on the microstructure at any length scale studied. The specific surface area of the AAS pastes is about 25% higher than that of a portland cement paste cured under the same conditions. The composition and mass density of the nanoscale solid C–S–H phase formed in the AAS paste was determined using a previously developed neutron scattering method, in conjunction with a hydration model. The result ((CaO) 0.99 –SiO 2 –(Al 2 O 3 ) 0.06 –(H 2 O) 0.97 , d = (2.73 ± 0.02) g/cm 3 ) is significantly lower in calcium and in water as compared to portland cement or pure tricalcium silicate paste. These values were used to calculate the chemical shrinkage that would result from complete hydration of the AAS paste. The result, (12.2 ± 1.5) cm 3 of volumetric shrinkage per 100 g of unhydrated cement, is about twice the amount of chemical shrinkage exhibited by normal cement pastes.
-
LENUS (Irish Health Repository)
Horan, Paul G
2006-01-01
BACKGROUND: Ischaemic heart disease (IHD) is a complex disease due to the combination of environmental and genetic factors. Mutations in the MEF2A gene have recently been reported in patients with IHD. In particular, a 21 base pair deletion (Delta7aa) in the MEF2A gene was identified in a family with an autosomal dominant pattern of inheritance of IHD. We investigated this region of the MEF2A gene using an Irish family-based study, where affected individuals had early-onset IHD. METHODS: A total of 1494 individuals from 580 families were included (800 discordant sib-pairs and 64 parent-child trios). The Delta7aa region of the MEF2A gene was investigated based on amplicon size. RESULTS: The Delta7aa mutation was not detected in any individual. Variation in the number of CAG (glutamate) and CCG (proline) residues was detected in a nearby region. However, this was not found to be associated with IHD. CONCLUSION: The Delta7aa mutation was not detected in any individual within the study population and is unlikely to play a significant role in the development of IHD in Ireland. Using family-based tests of association the number of tri-nucleotide repeats in a nearby region of the MEF2A gene was not associated with IHD in our study group.
-
The spotted asparagus beetle, Crioceris quatuordecimpunctata (Coleoptera: Chrysomelidae), is one of the most devastating pests of asparagus in China and elsewhere. In this study, we investigated the interaction of Bacillus thuringiensis (Bt) Cry3Aa toxin and the entomopathogenic fungus Beauveria bas...
-
Gupta, B B P; Yanthan, L; Singh, Ksh Manisana
2010-08-01
Arylalkylamine N-acetyltransferase (AA-NAT) is the rate-limiting enzyme of melatonin biosynthetic pathway. In vitro effects of 5-hydroxytryptophan (5-HTP) and indoleamines (serotonin, N-acetylserotonin and melatonin) were studied on AA-NAT activity in the pineal organ of the fish, C. gariepinus during different phases of its annual breeding cycle. Further, in vitro effects of leptin on AA-NAT activity in the pineal organ were studied in fed and fasted fishes during summer and winter seasons. Treatments with 5-HTP and indoleamines invariably stimulated pineal AA-NAT activity in a dose-dependent manner during all the phases. However, leptin increased AA-NAT activity in a dose-dependent manner only in the pineal organ of the fed fishes, but not of the fasted fishes irrespective of the seasons.
-
Directory of Open Access Journals (Sweden)
Mohammad Moniruzzaman
2018-04-01
Full Text Available While viruses with distinct phylogenetic origins and different nucleic acid types can infect and lyse eukaryotic phytoplankton, “giant” dsDNA viruses have been found to be associated with important ecological processes, including the collapse of algal blooms. However, the molecular aspects of giant virus–host interactions remain largely unknown. Aureococcus anophagefferens virus (AaV, a giant virus in the Mimiviridae clade, is known to play a critical role in regulating the fate of brown tide blooms caused by the pelagophyte Aureococcus anophagefferens. To understand the physiological response of A. anophagefferens CCMP1984 upon AaV infection, we studied the transcriptomic landscape of this host–virus pair over an entire infection cycle using a RNA-sequencing approach. A massive transcriptional response of the host was evident as early as 5 min post-infection, with modulation of specific processes likely related to both host defense mechanism(s and viral takeover of the cell. Infected Aureococcus showed a relative suppression of host-cell transcripts associated with photosynthesis, cytoskeleton formation, fatty acid, and carbohydrate biosynthesis. In contrast, host cell processes related to protein synthesis, polyamine biosynthesis, cellular respiration, transcription, and RNA processing were overrepresented compared to the healthy cultures at different stages of the infection cycle. A large number of redox active host-selenoproteins were overexpressed, which suggested that viral replication and assembly progresses in a highly oxidative environment. The majority (99.2% of annotated AaV genes were expressed at some point during the infection cycle and demonstrated a clear temporal–expression pattern and an increasing relative expression for the majority of the genes through the time course. We detected a putative early promoter motif for AaV, which was highly similar to the early promoter elements of two other Mimiviridae members
-
Foyet, A.; Wu, T.H.; Kodentsov, A.; Ven, van der L.G.J.; With, de G.; Benthem, van R.A.T.M.
2013-01-01
The barrier property of a nanocomposite epoxy coating containing 1 or 1.25 vol% of carbon black (CB) applied on AA2024-T3 was investigated by using electrochemical impedance spectroscopy. Micro-electrochemical impedance spectroscopy and optical microscopy were also used to investigate the
-
Lazarus, Sheryl; Thurlow, Martha; Christensen, Laurene; Shyyan, Vitaliy
2014-01-01
Federal policy initiatives such as the flexibility waivers for accountability are requiring that states transition away from the use of an alternate assessment based on modified achievement standards (AA-MAS). It is expected that those students who had participated in that assessment will instead participate in the state's general assessment (or a…
-
Using CR1aa versus KSOM as the culture medium for in vitro embryo production of cattle
Directory of Open Access Journals (Sweden)
Endang Triwulaninngsih
2002-03-01
Full Text Available This research has been conducted at the laboratory of in vitro fertilization in the Department of Animal Science University of Wisconsin, USA. These embryos can be used for improving genetic value of Indonesian cattle. Oocytes were matured in TCM- 199 medium (in 5% CO2 incubator and at 390C enriched with follicle stimulating hormone (FSH 10 μl/ml, oestradiol 17 β 1μl/ml and 10% Fetal Calf Serum (FCS. The oocytes were fertilized in vitro with motile sperm and incubation between sperm and oocytes in fertilization medium Tyroide Albumin Lactate Pyruvate (TALP for 20 hours. All zygotes were cultured in CR1aa (n=1549 medium versus modification of protein-free pottasium simplex optimized medium (KSOM (n=675 up to blastocyst stage and were fed FCS 5 μl/50 μl medium on day 6, as treatment A and B respectively. Data were analyzed by completely randomized design with SAS program. Percentages of cleavage, morula, blastocyst, expanded blastocyst, unfertilized and degenerated ova in this study were 91.4% vs 75.6 %; 75.6% vs 58.9%; 61.5% vs 38.5%; 31.2% vs 5.1%, 8.6% vs 24.4%, 15.7% vs 8% which were significantly different (P<0.01 for treatment CR1aa and KSOM respectively. Based on this study, CR1aa medium is better culture medium than KSOM for efficient in vitro production (IVP of bovine embryos.
-
Directory of Open Access Journals (Sweden)
Jiemin Wang
Full Text Available Phosphate (Pi limitation is a constraint for plant growth and development in many natural and agricultural ecosystems. In this study, a gene encoding Zea mays L. protein phosphatase 2A regulatory subunit A, designated ZmPP2AA1, was induced in roots by low Pi availability. The function of the ZmPP2AA1 gene in maize was analyzed using overexpression and RNA interference. ZmPP2AA1 modulated root gravitropism, negatively regulated primary root (PR growth, and stimulated the development of lateral roots (LRs. A detailed characterization of the root system architecture (RSA in response to different Pi concentrations with or without indole-3-acetic acid and 1-N-naphthylphthalamic acid revealed that auxin was involved in the RSA response to low Pi availability. Overexpression of ZmPP2AA1 enhanced tolerance to Pi starvation in transgenic maize in hydroponic and soil pot experiments. An increased dry weight (DW, root-to-shoot ratio, and total P content and concentration, along with a delayed and reduced accumulation of anthocyanin in overexpressing transgenic maize plants coincided with their highly branched root system and increased Pi uptake capability under low Pi conditions. Inflorescence development of the ZmPP2AA1 overexpressing line was less affected by low Pi stress, resulting in higher grain yield per plant under Pi deprivation. These data reveal the biological function of ZmPP2AA1, provide insights into a linkage between auxin and low Pi responses, and drive new strategies for the efficient utilization of Pi by maize.
-
Padgett, Barbara Nicole
Recently developed Al-Li-Cu alloys show great potential for implementation in the aerospace industry because of the attractive mix of good mechanical properties and low density. AA2099 is an Al-Li-Cu alloy with the following composition Al-2.69wt%Cu-1.8wt%Li-0.6wt%Zn-0.3wt%Mg-0.3wt%Mn-0.08wt%Zr. The environmental assisted cracking and localized corrosion behavior of the AA2099 was investigated in this thesis. The consequences of uncontrolled grain boundary precipitation via friction stir welding on the stress corrosion cracking (SCC) behavior of AA2099 was investigated first. Using constant extension rate testing, intergranular corrosion immersion experiments, and potentiodynamic scans, the heat-affected zone on the trailing edge of the weld (HTS) was determined to be most susceptible of the weld zones. The observed SCC behavior for the HTS was linked to the dissolution of an active phase (Al2CuLi, T1) populating the grain boundary. It should be stated that the SCC properties of AA2099 in the as-received condition were determined to be good. Focus was then given to the electrochemical behavior of precipitate phases that may occupy grain and sub-grain boundaries in AA2099. The grain boundary micro-chemistry and micro-electrochemistry have been alluded to within the literature as having significant influence on the SCC behavior of Al-Li-Cu alloys. Major precipitates found in this alloy system are T1 (Al 2CuLi), T2 (Al7.5Cu4Li), T B (Al6CuLi3), and theta (Al2 Cu). These phases were produced in bulk form so that the electrochemical nature of each phase could be characterized. It was determined T1 was most active electrochemically and theta was least. When present on grain boundaries in the alloy, electrochemical behavior of the individual precipitates aligned with the observed corrosion behavior of the alloy (e.g. TB was accompanied by general pitting corrosion and T 1 was accompanied by intergranular corrosion attack). In addition to the electrochemical behavior of