SSC kicker impedances

International Nuclear Information System (INIS)

Colton, E.P.; Wang, T.F.

1985-01-01

The longitudinal and transverse complex impedances Z/sub l//n and Z/sub t/, respectively, have been calculated for both the SSC injection and abort kickers. The calculations assumed that no attempt was made to shield the beam from the kickers. We took the injection and abort kickers to be as specified. The injection kickers were ferrite with a single-turn design, and the abort kickers were of a ''window-frame design'' with tape wound cores

The RHIC injection fast kicker

International Nuclear Information System (INIS)

Forsyth, E.B.; Pappas, G.C.; Tuozzolo, J.E.; Zhang, W.

1995-01-01

The purpose of the injection kicker is to provide the ultimate deflection to the incoming beam from the Alternating Gradient Synchrotron (AGS) into the Relativistic Heavy Ion Collider (RHIC). The beam is kicked in the vertical direction to place it on the equilibrium orbit of RHIC. Each bunch in the AGS is transferred separately, and stacked box-car fashion in the appropriate RHIC rf bucket. In order to achieve the required deflection angle four magnets powered by four pulsers will be used for each ring of RHIC. When the bunches are stacked in RHIC the last few rf buckets are left unfilled in order to provide a gap in the beam to facilitate the ejection or beam abort process. This also means there is not a severe constraint on the fall-time of the injection kicker. One prototype pulser has been built and tested. Much of the development effort has gone into the magnet design. Although lumped ferrite magnets are simpler to build and require less power to reach full field, a transmission line magnet was developed because of the very fast rise-time requirement and the tolerances imposed on the field variation and ripple

Design of kicker magnet and power supply unit for synchrotron beam injection

International Nuclear Information System (INIS)

Wang, Ju.

1991-03-01

To inject beams from the positron accumulator ring (PAR) into the synchrotron, a pulsed kicker magnet is used. The specifications of this kicker magnet and the power supply unit are listed and discussed in this report

Operational experience of the upgraded LHC injection kicker magnets during Run 2 and future plans

Science.gov (United States)

Barnes, M. J.; Adraktas, A.; Bregliozzi, G.; Goddard, B.; Ducimetière, L.; Salvant, B.; Sestak, J.; Vega Cid, L.; Weterings, W.; Vallgren, C. Yin

2017-07-01

During Run 1 of the LHC, one of the injection kicker magnets caused occasional operational delays due to beam induced heating with high bunch intensity and short bunch lengths. In addition, there were also sporadic issues with vacuum activity and electrical flashover of the injection kickers. An extensive program of studies was launched and significant upgrades were carried out during Long Shutdown 1 (LS 1). These upgrades included a new design of beam screen to reduce both beam coupling impedance of the kicker magnet and the electric field associated with the screen conductors, hence decreasing the probability of electrical breakdown in this region. This paper presents operational experience of the injection kicker magnets during the first years of Run 2 of the LHC, including a discussion of faults and kicker magnet issues that limited LHC operation. In addition, in light of these issues, plans for further upgrades are briefly discussed.

Particle kickers

CERN Multimedia

Antonella Del Rosso

2014-01-01

These devices are designed to provide a current pulse of 5000 Amps which will in turn generate a fast magnetic pulse that steers the incoming beam into the LHC. Today, the comprehensive upgrade of the LHC injection kicker system is entering its final stages. The upgraded system will ensure the LHC can be refilled without needing to wait for the kicker magnets to cool, thus enhancing the performance of the whole accelerator.   An upgraded kicker magnet in its vacuum tank, with an upgraded beam screen. The LHC is equipped with two kicker systems installed at the injection points (near points 2 and 8, see schematic diagram) where the particle beams coming from the SPS are injected into the accelerator’s orbit. Each system comprises four magnets and four pulse generators in which the field rises to 0.12 Tesla in less than 900 nanoseconds and for a duration of approximately 8 microseconds. Although the injection kickers only pulse 12 times to fill the LHC up with beam, the LHC beam circ...

AA under construction

CERN Multimedia

CERN PhotoLab

1979-01-01

The AA at an early stage of construction, in the newly built AA-Hall. Cable-trays already outline the shape of the accumulator ring. To the right are huge cable-drums for the pulse-forming-network (PFN) of the injection kicker. Seeing this picture, can one imagine that only 8 months later beams were circulating in the completed accumulator ring ?

Design of an Inductive Adder for the FCC injection kicker pulse generator

Science.gov (United States)

Woog, D.; Barnes, M. J.; Ducimetière, L.; Holma, J.; Kramer, T.

2017-07-01

The injection system for a 100 TeV centre-of-mass collider is an important part of the Future Circular Collider (FCC) study. Due to issues with conventional kicker systems, such as self-triggering and long term availability of thyratrons and limitations of HV-cables, innovative design changes are planned for the FCC injection kicker pulse generator. An inductive adder (IA) based on semiconductor (SC) switches is a promising technology for kicker systems. Its modular design, and the possibility of an active ripple suppression are significant advantages. Since the IA is a complex device, with multiple components whose characteristics are important, a detailed design study and construction of a prototype is necessary. This paper summarizes the system requirements and constraints, and describes the main components and design challenges of the prototype IA. It outlines the results from simulations and measurements on different magnetic core materials as well as on SC switches. The paper concludes on the design choices and progress for the prototype to be built at CERN.

Cooling of the LHC Injection Kicker Magnet Ferrite Yoke: Measurements and Future Proposals

CERN Document Server

Sobiech, Z; Bouleghlimat, S; Ducimetière, L; Garlaschè, M; Kramer, T; Namora, V; Noulibos, R; Sillanoli, Y; Weterings, W

2014-01-01

LHC operation with high intensity beam, stable for many hours, resulted in significant heating of the ferrite yoke of the LHC Injection Kicker Magnets. For one kicker magnet the ferrite yoke approached its Curie temperature. As a result of a long thermal time-constant the yoke can require several hours to cool sufficiently to allow re-injection of beam, thus limiting the running efficiency of the LHC. The beam screen, which screens the ferrite yoke from wakefields, has been upgraded to limit ferrite heating. In addition it is important to improve the cooling of the ferrite yoke: one method is to increase the internal emissivity of the cylindrical vacuum tank, in which the kicker magnet is installed. This paper describes a method developed for measuring the emissivity of the inside of the tanks, which has been benchmarked against measurements of the ferrite yoke temperature during heat treatment in an oven and transient thermal simulations. Conclusions are drawn regarding an ion bombardment technique evaluated...

Feasibility Study of the PS Injection for 2 GeV LIU Beams with an Upgraded KFA-45 Injection Kicker System Operating in Short Circuit Mode

CERN Document Server

Kramer, Thomas; Borburgh, Jan; Ducimetière, Laurent; Feliciano, Luis; Ferrero Colomo, Alvaro; Goddard, Brennan; Sermeus, Luc

2016-01-01

Under the scope of the LIU project the CERN PS Booster to PS beam transfer will be modified to match the requirements for the future 2 GeV beams. This paper describes the evaluation of the proposed upgrade of the PS injection kicker. Different schemes of an injection for LIU beams into the PS have been outlined in the past already under the aspect of individual transfer kicker rise and fall time performances. Homogeneous rise and fall time requirements in the whole PSB to PS transfer chain have been established which allowed to consider an upgrade option of the present injection kicker system operated in short circuit mode. The challenging pulse quality constraints require an improvement of the flat top and post pulse ripples. Both operation modes, terminated and short circuit mode are analysed and analogue circuit simulations for the present and upgraded system are outlined. Recent measurements on the installed kickers are presented and analysed together with the simulation data. First measurements verifying...

Simulation of the LHC injection kicker impedance test bench

CERN Document Server

Tsutsui, H

2003-01-01

The coupling impedance measurements of the LHC injection kicker test bench are simulated by HFSS code. The simulation gives qualitatively good agreement with the measurement. In order to damp the resonances, some ferrite rings are tested in the simulation. Longitudinal resonances are damped by a ferrite ring of large tan$\\delta_{\\mu}$. The effect of the ferrite ring is small for damping the transverse impedance resonance around 30 MHz.

Measurement report on the LHC injection kicker ripple denition and maximum pulse length (MD 1268)

CERN Document Server

Bartmann, Wolfgang; Kotzian, Gerd; Stoel, Linda; Velotti, Francesco Maria; Vlachodimitropoulos, Vasileios; Wiesner, Christoph; CERN. Geneva. ATS Department

2016-01-01

The present LHC lling scheme uses a batch spacing which corresponds to the design report specication of the injection kicker rise time. A reduction of the batch spacing can be directly used to increase luminosity without detrimental eect on beam stability. Therefore, measurements were performed to understand if a tighter batch spacing would lead to increased injection oscillations of a the rst and last bunches of a bunch train and eventually also a growth of the transverse emittance. The results of theses measurement were used to dene the minimum possible batch spacing for an acceptable emittance growth. Another measurement was performed to test if a batch consisting of 320 bunches can be injected instead of the nominal 288 bunch trains. This bunch train is dierently produced in the LHC injectors and features an optimum between beam stability and luminosity gain. The pulse length of the injection kicker was measured to ensure the full batch can be injected at once.

An Improved Beam Screen for the LHC Injection Kickers

CERN Document Server

Barnes, M J; Ducimetière, L; Garrel, N; Kroyer, T

2007-01-01

The two LHC injection kicker magnet systems must produce a kick of 1.3 T.m with a flattop duration variable up to 7860 ns, and rise and fall times of less than 900 ns and 3000 ns, respectively. Each system is composed of two resonant charging power supplies (RCPSs) and four 5 WW transmission line kicker magnets with matched terminating resistors and pulse forming networks (PFNs). A beam screen is placed in the aperture of the magnets: the screen consists of a ceramic tube with conductors on the inner wall. The conductors provide a path for the image current of the, high intensity, LHC beam and screen the ferrite against Wake fields. The conductors initially used gave adequately low beam coupling impedance however inter-conductor discharges occurred during pulsing of the magnet: an alternative design was discharge free at the nominal operating voltage but the impedance was too high for the ultimate LHC beam. This paper presents the results of a new development undertaken to meet the often conflicting requireme...

The Beam Screen for the LHC Injection Kicker Magnets

CERN Document Server

Barnes, MJ; Ducimetière, L; Garrel, N; Kroyer, T

2006-01-01

The two LHC injection kicker magnet systems must each produce a kick of 1.2 T.m with a flattop duration variable up to 7.86 ìs, and rise and fall times of less than 0.9 ìs and 3 ìs, respectively. Each system is composed of four 5 Ù transmission line kicker magnets with matched terminating resistors and pulse forming networks (PFN). The LHC beam has a high intensity, hence a beam screen is required in the aperture of the magnets This screen consists of a ceramic tube with conducting ?stripes? on the inner wall. The stripes provide a path for the image current of the beam and screen the magnet ferrites against Wake fields. The stripes initially used gave adequately low beam impedance however stripe discharges occured during pulsing of the magnet: hence further development of the beam screen was undertaken. This paper presents options considered to meet the often conflicting needs for low beam impedance, shielding of the ferrite, fast field rise time and good electrical and vacuum behaviour.

New wave form surveillance and diagnostics for the LEP injection kickers

CERN Document Server

Carlier, E; Verhagen, H

1995-01-01

The introduction of the Bunch Train Scheme in LEP requires a more precise and automatic supervision of the stability of the LEP injection kickers in timing and amplitude. Comprehensive and user-friendly diagnostic tools are required for in-depth investigation of equipment behaviour. A new system is currently being prepared using to a large extent commercial data acquisition hardware and hardware independent software products.

Pulsed modulator power supply for the g-2 muon storage ring injection kicker

NARCIS (Netherlands)

Mi, J.; Lee, Y. Y.; Morse, W. M.; Pai, C. I.; Pappas, G. C.; Sanders, R.; Semertzidis, Y. K.; Warburton, D.; Zapasek, R.; Jungmann, K.; Roberts, L.

1999-01-01

This paper describes the pulse modulator power supplies used to drive the kicker magnets that inject the muon beam into the g-2 storage ring that has been built at Brookhaven National Laboratory. Three modulators built into coaxial structures consisting of a series circuit of an energy storage

SPS Injection and Beam Quality for LHC Heavy Ions With 150 ns Kicker Rise Time

CERN Document Server

Goddard, Brennan; Ducimetière, Laurent; Kotzian, Gerd; Uythoven, Jan; Velotti, Francesco

2016-01-01

As part of the LHC Injectors Upgrade project for LHC heavy ions, the SPS injection kicker system rise time needs reduction below its present 225 ns. One technically challenging option under consideration is the addition of fast Pulse Forming Lines in parallel to the existing Pulse Forming Networks for the 12 kicker magnets MKP-S, targeting a system field rise time of 100 ns. An alternative option is to optimise the system to approach the existing individual magnet field rise time (2-98%) of 150 ns. This would still significantly increase the number of colliding bunches in LHC while minimising the cost and effort of the system upgrade. The observed characteristics of the present system are described, compared to the expected system rise time, together with results of simulations and measurements with 175 and 150 ns injection batch spacing. The expected beam quality at injection into LHC is quantified, with the emittance growth and simulated tail population taking into account expected jitter and synchronisatio...

High voltage measurements on a prototype PFN for the LHC injection kickers

CERN Document Server

Barnes, M J; Carlier, E; Ducimetière, L; Schröder, G; Vossenberg, Eugène B

1999-01-01

Two LHC injection kicker magnet systems must produce a kick of 1.3 T.m each with a flattop duration of 4.25 mu s or 6.5 mu s, a rise time of 900 ns, and a fall time of 3 mu s. The ripple in the field must be less than +or-0.5The electrical circuit of the complete system has been simulated with PSpice. The model includes a 66 kV resonant charging power supply (RCPS), a 5 Omega pulse forming network (PFN), a terminated 5 Omega kicker magnet, and all known parasitic quantities. Component selection for the PEN was made on the basis of models in which a theoretical field ripple of less than +or-0.1as attained. A prototype 66 kV RCPS was built at TRIUMF and shipped to CERN. A prototype 5 Omega system including a PFN, thyratron switches, and terminating resistors, was built at CERN. The system (without a kicker magnet) was assembled as designed without trimming of any PFN component values. The PFN was charged to 60 kV via the RCPS operating at 0.1 Hz. The thyratron timing was adjusted to provide a 30 kV, 5.5 mu s du...

High Voltage Performance of the Beam Screen of the LHC Injection Kicker Magnets

CERN Document Server

Barnes, MJ; Bregliozzi, G; Calatroni, S; Costa Pinto, P; Day, H; Ducimetière, L; Kramer, T; Namora, V; Mertens, V; Taborelli, M

2014-01-01

The LHC injection kicker magnets include beam screens to shield the ferrite yokes against wakefields resulting from the high intensity beam. The screening is provided by conductors lodged in the inner wall of a ceramic support tube. The design of the beam screen has been upgraded to overcome limitations and permit LHC operation with increasingly higher bunch intensity and short bunch lengths: the new design also significantly reduces the electric field associated with the screen conductors, decreasing the probability of electrical breakdown. The high voltage conditioning process for the upgraded kicker magnets is presented and discussed. In addition a test setup has been utilized to study flashover, on the inner wall of the ceramic tube, as a function of both applied voltage and vacuum pressure: results from the test setup are presented.

Reduction of Surface Flashover of the Beam Screen of the LHC Injection Kickers

CERN Document Server

Barnes, M J; Calatroni, S; Caspers, F; Ducimetière, L; Gomes Namora, V; Mertens, V; Noulibos, R; Taborelli, M; Teissandier, B; Uythoven, J; Weterings, W

2013-01-01

The LHC injection kicker magnets include beam screens to shield the ferrite yokes against wake fields resulting from the high intensity beam. The screening is provided by conductors lodged in the inner wall of a ceramic support tube. LHC operation with increasingly higher bunch intensity and short bunch lengths, requires improved ferrite screening. This will be implemented by additional conductors; however these must not compromise the good high-voltage behaviour of the kicker magnets. Extensive studies have been carried out to better satisfy the often conflicting requirements for low beam coupling impedance, fast magnetic field rise-time, ultra-high vacuum and good high voltage behaviour. A new design is proposed which significantly reduces the electric field associated with the screen conductors. Results of high voltage tests are also presented.

Magnetic Waveform Measurements of the PS Injection Kicker KFA45 and Future Emittance Growth Estimates

CERN Document Server

Forte, Vincenzo; Ferrero Colomo, Alvaro; CERN. Geneva. ATS Department

2018-01-01

In the framework of the LHC Injectors Upgrade (LIU) project [1], this document summarises the beam-based measurement of the magnetic waveform of the PS injection kicker KFA45 [2], from data collected during several Machine Development (MD) sessions in 2016 and 2017. In the first part of the document, the measurement methodology is introduced and the results presented and compared with the specification required for a clean transfer of the bunches coming from the PSB after the upgrade. These measurements represent, to date, the only way to reconstruct the magnetic waveform. In the second part, kicker magnetic waveform PSpice®[3] simulations are compared and tuned to the measurements. Finally the simulated (validated through measurements) waveforms are used to estimate the future expected emittance growth for the different PS injection schemes, both for (LIU target) LHC and fixed target beams.

Beam Induced Ferrite Heating of the LHC Injection Kickers and Proposals for Improved Cooling

CERN Document Server

Barnes, M J; Calatroni, S; Day, H; Ducimetière, L; Garlaschè, M; Gomes Namora, V; Mertens, V; Sobiech, Z; Taborelli, M; Uythoven, J; Weterings, W

2013-01-01

The two LHC injection kicker systems produce an integrated field strength of 1.3 T·m with a flattop duration variable up to 7860 ns, and rise and fall times of less than 900 ns and 3000 ns, respectively. A beam screen is placed in the aperture of each magnet, which consists of a ceramic tube with conductors in the inner wall. The conductors provide a path for the beam image current and screen the ferrite yoke against wakefields. Recent LHC operation, with high intensity beam stable for many hours, resulted in significant heating of both the ferrite yoke and beam impedance reduction ferrites. For one kicker magnet the ferrite yoke approached its Curie temperature. As a result of a long thermal time-constant the ferrite yoke can require several hours to cool sufficiently to allow re-injection of beam, thus limiting the running efficiency of the LHC. Thermal measurement data has been analysed, a thermal model developed and emissivity measurements carried out. Various measures to improve the ferrite cooling have...

Test of very fast kicker for TESLA damping ring

International Nuclear Information System (INIS)

Grishanov, B.I.; Podgorny, F.V.; Shiltsev, V.D.

1997-04-01

We describe a very fast kicker with unique combination of high repetition rate and short pulse width. Constructionally, the device is a symmetrical counter traveling wave stripline kicker fed by semiconductor high-voltage pulse generator. Experimentally tested kicker has a full pulse width of about 7 ns, 1.4 MHz repetition rate and maximum kick strength of the order of 3 G·m. Recent achievements in high-voltage semiconductor field-effect transistors (FET) technology and goal-specific optimization of the kicker parameters allow many-fold increase of the strength, and the kicker can be very useful tool for bunch-by-bunch injection/extraction and other accelerator applications. 4 refs., 3 figs

MEASURED TRANSVERSE COUPLING IMPEDANCE OF RHIC INJECTION AND ABORT KICKERS

International Nuclear Information System (INIS)

HAHN, H.; DAVINO, D.

2001-01-01

Concerns regarding possible transverse instabilities in RHIC and the SNS pointed to the need for measurements of the transverse coupling impedance of ring components. The impedance of the RHIC injection and abort kicker was measured using the conventional method based on the S 21 forward transmission coefficient. A commercial 450 Ω twin-wire Lecher line were used and the data was interpreted via the log-formula. All measurements, were performed in test stands fully representing operational conditions including pulsed power supplies and connecting cables. The measured values for the transverse coupling impedance in kick direction and perpendicular to it are comparable in magnitude, but differ from Handbook predictions

Construction and 60 kV tests of the prototype pulser for the LHC injection kicker system

CERN Document Server

Barnes, M J; Carlier, E; Ducimetière, L; Schröder, G; Vossenberg, Eugène B

1999-01-01

The European Laboratory for Particle Physics (CERN) is constructing the Large Hadron Collider (LHC). Two counter-rotating proton beams will be injected into the LHC at an energy of 450 GeV by two kicker magnet systems, producing magnetic field pulses of approximately 900 ns rise time and 6.6 mu s flat top duration with a ripple of less than +or-0.5Both injection systems are composed of 4 travelling wave kicker magnets of 2.17 m length each, powered by pulse forming networks (PFNs). To achieve the high-required kick strength of 1.2 Tm, for a compact and cost efficient design, a characteristic impedance of 5 Ohms has been chosen. The design strategy for the magnets and generators has been defined after detailed analysis of existing systems. The electrical circuit has been optimised using the circuit analysis software PSpice. Most known parasitics have been modelled. A prototype PFN has been constructed at CERN and successfully tested at 60 kV. A calibration procedure has been developed and utilised for obtainin...

Very fast kicker for accelerator applications

International Nuclear Information System (INIS)

Grishanov, B.I.; Podgorny, F.V.; Shiltsev, V.D.

1996-11-01

We describe a very fast counter traveling wave kicker with a full pulse width of about 7 ns. Successful test experiment has been done with hi-tech semiconductor technology FET pulse generator with a MHz- range repetition rates and maximum kick strength of the order of 3 G·m. Further. increase of the strength seems to be quite possible with the FET pursers, that makes the kicker to be very useful tool for bunch-by-bunch injection/extraction and other accelerator applications

An IGBT Driven Slotted Beam Pipe Kicker for SPEAR III Injection

International Nuclear Information System (INIS)

2002-01-01

The SPEAR III injection kicker system is composed of three kicker magnets, K1, K2, and K3. These magnets, along with the power modulators to drive them constitute an injection system which will be used to deflect an incoming electron beam with an energy of 3.3 GeV by an angle of 2.5 mrad for K1 and K3, and 1 mrad for K2. The pulse shape of the magnetic field in the three magnets must be matched in order to preserve a closed orbit. The pulse duration is required to be less than 780 ns, with rise and fall times of less than 375 ns, and a pulse repetition frequency of 10 Hz. The aperture of all three magnets is 60 x 34 mm in an 8 inch vacuum vessel. The magnetic length is 1.2 m for K1 and K3, and 0.6 m for K2 [1]. The magnet design employs a slotted beam pipe which is shorted at one end. A solid state IGBT based, induction type of modulator drives the magnets. Modulators for K1 and K3 consist of eight 4.5 kV, 600 A IGBTs, and eight Finemet magnet cores with four 22.5 Ohm output cables to drive 2381 A into the magnets. The modulator for K2 uses four IGBTs and cores, and 8 output cables to produce a 2619 A pulse. Cables of length greater than one half the pulse width must be used in order to avoid reflections from the shorted magnet. The design charge voltage for the modulators is 20 kV for K1 and K3. This paper describes the magnet and modulator design, as and presents test data from a prototype system

The Booster to AGS beam transfer fast kicker systems

International Nuclear Information System (INIS)

Zhang, W.; Bunicci, J.; Soukas, A.V.; Zhang, S.Y.

1992-01-01

The Brookhaven AGS Booster has a very successful commissioning period in June 1991. The third phase of that commissioning was a beam extraction test. The Booster extraction fast kicker (F3) deflected a 1.2 GeV proton beam from the Booster circulating orbit into the extraction septum aperture, partially down the extraction line to a temporary beam stop. Now, the Booster is committed to the AGS operations program for both heavy ion and proton beams. Thus, the Booster extraction and the corresponding AGS injection systems must operate routinely up to a pulse repetition frequency of 7.5 Hertz, and up to a beam energy of 1.5 Gev. The injection fast kicker is located in the A5 section of the AGS ring and is used to deflect the proton or heavy ion beam into its final AGS closed orbit. A distinctive feature of the AGS injection fast kicker modulators is the tail-bitting function required for proton beam injection. This enables the system to produce a fast current fall time to go along with the high current pulse amplitude with a fast rise time. The AGS injection fast kicker system has three pulse modulators, and each modulator consists of two thyratrons. The main PFN thyratrons switch on the current, and the tail bitting thyratrons are used to force the magnet current to decrease rapidly. Two digital pulse delay generators are used to align the main thyratrons and the tail bitting thyratrons respectively. The system has been tested and installed. The final commissioning of the Booster to AGS beam transfer line and injection is currently being undertaken. In this article, the system design, realization techniques and performance data will be presented

Considerations on a new fast extraction kicker concept for SPS

CERN Document Server

Barnes, M

2010-01-01

An alternative extraction kicker concept is investigated for the SPS, based on open C-type kickers and a fast-bumper system. The beam is moved into the kicker gap some tens of ms before extraction. The concept is illustrated in detail with the LSS4 extraction from the SPS – very similar parameters and considerations apply to LSS6. A similar concept could also be conceived for injection but is more difficult due to the larger beam size. The technical issues are presented and the potential impact on the machine impedance outlined.

Some calculations for the RHIC kicker

International Nuclear Information System (INIS)

Claus, J.

1996-12-01

This paper starts with a brief discussion of the design of the RHIC injection kicker magnets which calls for longitudinal and capacitive sections of the same order as the aperture, not much larger nor much smaller. This makes accurate analytical prediction of their behavior very difficult. In order to gain at least some qualitative insight of that behavior, the author preformed calculations which are based on the actual dimensions of the kickers but which neglect the end effects of the individual sections. The effects of the sectionalization are therefore exaggerated relative to reality in the results

Design Considerations of Fast Kicker Systems for High Intensity Proton Accelerators

International Nuclear Information System (INIS)

Zhang, W.; Sandberg, J.; Parson, W.M.; Walstrom, P.; Murray, M.M.; Cook, E.; Hartouni, E.

2001-01-01

In this paper, we discuss the specific issues related to the design of the Fast Kicker Systems for high intensity proton accelerators. To address these issues in the preliminary design stage can be critical since the fast kicker systems affect the machine lattice structure and overall design parameters. Main topics include system architecture, design strategy, beam current coupling, grounding, end user cost vs. system cost, reliability, redundancy and flexibility. Operating experience with the Alternating Gradient Synchrotron injection and extraction kicker systems at Brookhaven National Laboratory and their future upgrade is presented. Additionally, new conceptual designs of the extraction kicker for the Spallation Neutron Source at Oak Ridge and the Advanced Hydrotest Facility at Los Alamos are discussed

Inside Hall 193 for the Antiproton Accumulator (AA) ring

CERN Multimedia

1979-01-01

Installation work is in full swing. A model quadrupole on the left shows where the magnet ring will be. The cables wound on drums are part of the pulse-forming network for the injection kicker. See Annual Report 1979 p. 103, Fig. 9 and photo 7911303. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

SLC kicker magnet limitations

International Nuclear Information System (INIS)

Cassel, R.; Donaldson, A.; Mattison, T.; Bowden, G.; Weaver, J.; Bulos, F.; Fiander, D.

1991-01-01

The SLC Damping Ring kicker magnets requires a fast magnetic field rise time of 58 nsec, a peak field of 800 gauss, a pulse amplitude stability of 0.01%, and a reasonable operational lifetime. The original kicker magnets designed by SLAC and at Fermi were not able to fulfill the SLC kicker requirements. Extensive studies were conducted to determine the limitation in the magnets, response of the ferrite in kicker magnet, and the modifications needed to improve the kicker magnet performance. The paper details the SLAC and Fermi kicker magnets limitation of performance

The new control system of the SPS injection kicker

CERN Document Server

Antoine, A; Marchand, A; Verhagen, H

2002-01-01

The SPS accelerator will be used as injector for the LHC and has to be adapted to the LHC requirements. The tight specification on beam blow-up and bunch spacing in the SPS has required an upgrade program of the SPS injection kicker in order to obtain a reduction of the magnetic field ripple to less than ± 0.5% and of the magnet current rise time to less than 145 ns. In this context, the slow control part has been entirely rebuilt on the basis of off-the-shelf industrial components. A hierarchical architecture based on a SIEMENS S7-400 master programmable logic controller interconnected through PROFIBUS-DP to S7-300 deported and decentralised I/Os has been implemented. Integration of in-house specific G-64 hardware systems inside this industrial environment has been done through a PROFIBUS-DP to G-64 intelligent interface based on an OEM fieldbus mezzanine board on one side and an FPGA implementing the required functionality on the other. Simultaneously, the fast timing system has been completely reshuffled ...

HL-LHC kicker magnet (MKI)

CERN Multimedia

Brice, Maximilien

2018-01-01

HL-LHC kicker magnet (MKI): last vacuum test, preparation for transport to LHC transfer line in underground tunnel.The LHC injection kicker systems (MKIs) generate fast field pulses to inject the clockwise rotating beam at Point 2 and the anti-clockwise rotating beam at Point 8: there are eight MKI magnets installed in total. Each MKI magnet contains a high purity alumina tube: if an MKI magnet is replaced this tube requires conditioning with LHC beam: until it is properly conditioned, there can be high vacuum pressure due to the beam. This high pressure can also cause electrical breakdowns in the MKI magnets. A special coating (Cr2O3) has been applied to the inside of the alumina tube of an upgraded MKI magnet – this is expected to greatly reduce the pressure rise with beam. In addition, HL-LHC beam would result in excessive heating of the MKI magnets: the upgraded design includes modifications that will reduce heating, and move the power deposition to parts that will be easier to cool. Experience during 2...

Comparison of the Window-Frame RHIC-abort kicker with C-type Kicker

International Nuclear Information System (INIS)

Tsoupas, N.; McMahan, Brandon

2014-01-01

The high intensity proton bunches (~2.5x10 11 p/bunch ) circulating in RHIC increase the temperature of the ferrite-made RHIC-abort-kickers above the Curie point; as a result, the kickers cannot provide the required field to abort the beam at the beam dump. A team of experts in the CAD department worked on modifying the design of the window-frame RHIC-abort kicker to minimize the hysteresis losses responsible for the increase of the ferrite's temperature. In this technical note we report some results from the study of two possible modifications of the window-frame RHIC-abort kicker, and we compare these results with those of a propose C-type RHIC-abort kicker. We also include an Appendix where we describe a method which may further reduce the hysteresis losses of the window-frame kicker.

AA, stochastic precooling pickup

CERN Multimedia

CERN PhotoLab

1980-01-01

The freshly injected antiprotons were subjected to fast stochastic "precooling". In this picture of a precooling pickup, the injection orbit is to the left, the stack orbit to the far right. After several seconds of precooling with the system's kickers (in momentum and in the vertical plane), the precooled antiprotons were transferred, by means of RF, to the stack tail, where they were subjected to further stochastic cooling in momentum and in both transverse planes, until they ended up, deeply cooled, in the stack core. During precooling, a shutter near the central orbit shielded the pickups from the signals emanating from the stack-core, whilst the stack-core was shielded from the violent action of the precooling kickers by a shutter on these. All shutters were opened briefly during transfer of the precooled antiprotons to the stack tail. Here, the shutter is not yet mounted. Precooling pickups and kickers had the same design, except that the kickers had cooling circuits and the pickups had none. Peering th...

AA precooling pickup

CERN Multimedia

CERN PhotoLab

1980-01-01

The freshly injected antiprotons, while circulating on the injection orbit, were subjected to fast stochastic "precooling" for several seconds (in momentum and in the vertical plane). This precooling pickup is being readied by Gerard Laurent for installation in its tank. Precooling PUs and kickers were of identical construction (except for the kickers having cooling circuits), with C-shaped ferrites sandwiched between C-shaped metal plates and couplers at the back of the C. For reasons explained in 8002234, they were also equipped with shutters which closed the open side of the C when there was beam on the injection orbit. For more on precooling see 8020234, 8004064.

Kicker Magnet and Pulser

Energy Technology Data Exchange (ETDEWEB)

Bulos, Fatin [SLAC National Accelerator Lab., Menlo Park, CA (United States)

2014-03-04

The SLC Project utilizes several fast kicker magnets. Their requirements vary somewhat, however, the cooling rings kickers have the most stringent requirements. In this note we describe the design of the positron ring kickers, and the reasons that led to it.

Development of Stripline Kickers for Low Emittance Rings: Application to the Beam Extraction Kicker for CLIC Damping Rings

CERN Document Server

AUTHOR|(SzGeCERN)728476; Toral Fernandez, Fernando

In the framework of the design study of Future Linear Colliders, the Compact Linear Collider (CLIC) aims for electron-positron collisions with high luminosity at a nominal centre-of-mass energy of 3 TeV. To achieve the luminosity requirements, Pre-Damping Rings (PDRs) and Damping Rings (DRs) are required: they reduce the beam emittance before the beam is accelerated in the main linac. Several injection and extraction systems are needed to inject and extract the beam from the PDRs and DRs. The work of this Thesis consists of the design, fabrication and laboratory tests of the first stripline kicker prototype for beam extraction from the CLIC DRs, although the methodology proposed can be extended to stripline kickers for any low emittance ring. The excellent field homogeneity required, as well as a good transmission of the high voltage pulse through the electrodes, has been achieved by choosing a novel electrode shape. With this new geometry, it has been possible to benefit from all the advantages that the most...

Beam-dump kicker magnets

International Nuclear Information System (INIS)

Bulos, F.; Odian, A.; Tomlin, B.

1983-01-01

The beam-dump kicker magnets are located in the final focus region and, in conjunction with septum magnets, extract the beams after they have passed the interaction point (IP) and direct them to their respective dumps. Two schemes for these kickers have been under consideration; ferrite transmission line magnets utilizing technology common with damping rings and positron target kickers, and current loop magnets which are possible only for the dump kickers, where the rise time of the magnetic pulse can be comparatively longer; approximately 400 nanoseconds as compared with 50 nanoseconds for the others. A prototype ferrite kicker has been built and is undergoing tests. Since the current loop requires lower voltage and power plus some additional savings in cost, we decided to build and test a prototype. This note describes in detail an optimized design for the current loop magnets and their associated pulse circuitry

Measurement and analysis of SPS kicker magnet heating and outgassing with Different Bunch Spacing

CERN Document Server

Barnes, M J; Cornelis, K; Ducimetière, L; Mahner, E; Papotti, G; Rumolo, G; Senaj, V; Shaposhnikova, E

2010-01-01

Fast kicker magnets are used to inject beam into and eject beam out of the CERN SPS accelerator ring. These kickers are generally ferrite loaded transmission line type magnets with a rectangular shaped aperture through which the beam passes. Unless special precautions are taken the impedance of the ferrite yoke can provoke significant beam induced heating, over several hours, even above the Curie temperature of the ferrite. At present the nominal bunch spacing in the SPS is 25 ns, however for an early stage of LHC operation it is preferable to have 50 ns bunch spacing. Machine Development (MD) studies have been carried out with an inter-bunch spacing of 25 ns, 50 ns or 75 ns. For some of the SPS kicker magnets the 75 ns bunch spacing resulted in considerable beam induced heating. In addition the MDs showed that 50 ns bunch spacing could result in a very rapid pressure rise in the kicker magnet and thus cause an interlock. This paper discusses the MD observations of the SPS kickers and analyses the available d...

Dynamic devices - pickups and kickers

International Nuclear Information System (INIS)

Lambertson, G.

1986-08-01

A given configuration of electrodes may be used either as a pickup or as a kicker; that duality is addressed. Some general relations between longitudinal and transverse effects and between the respones as pickup and as kicker are derived. Dynamic effects are seen to be entirely determined by the longitudinal electric fields in the direction of the beam current when the electrode is excited as a kicker. Response functions that serve as figures of merit are defined. The responses of specific examples of pickups and kickers are analyzed. An approach to the calculation of the transverse variation of coupling over the electrode aperture is preented

Drawing attention to a neglected injecting-related harm: a systematic review of AA amyloidosis among people who inject drugs.

Science.gov (United States)

Harris, Magdalena; Brathwaite, Rachel; Scott, Jenny; Gilchrist, Gail; Ciccarone, Dan; Hope, Vivian; McGowan, Catherine R

2018-04-26

Chronic skin and soft tissue infections (SSTI) among people who inject drugs (PWID) can lead to AA amyloidosis: a serious, yet neglected, multi-organ disease. We aim to synthesize findings on the epidemiology, risk factors, clinical outcomes, screening recommendations and challenges to treatment for AA amyloidosis among PWID. A systematic review was conducted in accordance with the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA). We searched the following bibliographic databases in July 2017: CINAHL Plus, Embase, Global Health, MEDLINE, PsycEXTRA, PsycINFO and SCOPUS. Studies were included if they investigated AA amyloidosis in PWID. Studies were not restricted to location, study type, year or language of publication. Study heterogeneity precluded meta-analysis; we present a narrative review of the literature. Thirty-seven papers from eight countries met inclusion criteria. A total of 781 PWID are reported on, of whom 177 had AA amyloidosis. Where disease causality is established, it is attributed to chronic inflammation caused by injecting-related SSTIs. Most (88.7%) PWID with AA amyloidosis had SSTIs. The proportion of PWID with AA amyloidosis at post-mortem ranged from 1.6% (Germany) to 22.5% (Serbia). Biopsy studies reported from 5.26% (Portugal) to 50% (Germany) of AA amyloidosis in PWID with suspected or known kidney disease. Following diagnosis, the typical trajectory for PWID with AA amyloidosis was rapid deterioration of renal function requiring haemodialysis. Treatment difficulties, end-stage renal failure and premature death from sepsis were observed. Good outcomes, including reversibility of AA amyloidosis, are attributed to rapid treatment of the underlining inflammation and injecting cessation. Notably, given the population in question, no studies were published in addiction or harm reduction journals; most (92%) appeared in specialist nephrology and medical journals. There is strong evidence of an association between skin

Kicker magnet design

International Nuclear Information System (INIS)

Li, Z.; Thiessen, H.A.

1989-01-01

In this paper, the kicker magnet is studied by use of the program POISSON. For using the dc-code POISSON in the ac problem of the kicker magnet, an approximation of the ac effects is made, this simplifying the ac problem into a dc problem. The study of the magnet is taken in two steps: assuming the γ of the ferrite material is fixed in the calculation to get a preliminary design of the magnet; using the real B /minus/ H curve of the CMD5005 ferrite material in the calculation to get the final design of the magnet. The stored energy, the excitation curve and the excitation efficiency of the kicker magnet are also discussed. 10 figs., 7 tabs

AA, vacuum tank for stochastic precooling

CERN Multimedia

CERN PhotoLab

1979-01-01

The vaccum tank in which the fast stochastic precooling kicker was installed. It is clad with heating jackets for bake-out to 200 deg C, indispensable for reaching the operational vacuum of 7E-11 Torr. Alain Poncet, responsible for AA vacuum, is looking on. See also 7910268, 8002234.

Experimental transmission of AA amyloidosis by injecting the AA amyloid protein into interleukin-1 receptor antagonist knockout (IL-1raKO) mice.

Science.gov (United States)

Watanabe, K; Uchida, K; Chambers, J K; Tei, M; Shoji, A; Ushio, N; Nakayama, H

2015-05-01

The incidence of AA amyloidosis is high in humans with rheumatoid arthritis and several animal species, including cats and cattle with prolonged inflammation. AA amyloidosis can be experimentally induced in mice using severe inflammatory stimuli and a coinjection of AA amyloid; however, difficulties have been associated with transmitting AA amyloidosis to a different animal species, and this has been attributed to the "species barrier." The interleukin-1 receptor antagonist knockout (IL-1raKO) mouse, a rodent model of human rheumatoid arthritis, has been used in the transmission of AA amyloid. When IL-1raKO and BALB/c mice were intraperitoneally injected with mouse AA amyloid together with a subcutaneous pretreatment of 2% AgNO3, all mice from both strains that were injected with crude or purified murine AA amyloid developed AA amyloidosis. However, the amyloid index, which was determined by the intensity of AA amyloid deposition, was significantly higher in IL-1raKO mice than in BALB/c mice. When IL-1raKO and BALB/c mice were injected with crude or purified bovine AA amyloid together with the pretreatment, 83% (5/6 cases) and 38% (3/8 cases) of IL-1raKO mice and 17% (1/6 cases) and 0% (0/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. Similarly, when IL-1raKO and BALB/c mice were injected with crude or purified feline AA amyloid, 33% (2/6 cases) and 88% (7/8 cases) of IL-1raKO mice and 0% (0/6 cases) and 29% (2/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. These results indicated that IL-1raKO mice are a useful animal model for investigating AA amyloidogenesis. © The Author(s) 2014.

RHIC ABORT KICKER WITH REDUCED COUPLING IMPEDANCE

International Nuclear Information System (INIS)

HAHN, H.; DAVINO, D.

2002-01-01

Kicker magnets typically represent the most important contributors to the transverse impedance budget of accelerators and storage rings. Methods of reducing the impedance value of the SNS extraction kicker presently under construction and, in view of a future performance upgrade, that of the RHIC abort kicker have been thoroughly studied at this laboratory. In this paper, the investigation of a potential improvement from using ferrite different from the BNL standard CMD5005 is reported. Permeability measurements of several ferrite types have been performed. Measurements on two kicker magnets using CMD5005 and C2050 suggest that the impedance of a magnet without external resistive damping, such as the RHIC abort kicker, would benefit

Preliminary testing of the LEB to MEB transfer kicker modulator prototype

International Nuclear Information System (INIS)

Pappas, G.C.; Askew, D.R.

1993-01-01

The extraction kicker for the Low Energy Booster (LEB) is used to deflect a 12 GeV/c proton beam from the synchrotron into a transfer line. A kicker system of similar design is used to inject the beam from the transfer line into the Medium Energy Booster (MEB). The modulator requirements for these kicker systems are to deliver a pulse train of seven 1.6 kA, 2.5 μs pulses at a pulse repetition frequency of 10 pps, every seven seconds for one hour. The impedance of the modulator is 12.5 Ω, resulting in a charge voltage of 40 kV. The 10-90% rise time of the pulses is 20 ns, and the 1-99% fall time is 2 μs. The allowable pulse ripple is ±1% of the peak current during the pulse, and ±0.3% from pulse to pulse. The shot-to-shot timing jitter requirement is less than 2 ns. This paper describes the design and performance of the prototype modulator which was fabricated to meet these specifications

Preliminary testing of the LEB to MEB transfer kicker modulator prototype

International Nuclear Information System (INIS)

Pappas, G.C.; Askew, D.R.

1993-05-01

The extraction kicker for the Low Energy Booster (LEB) is used to deflect a 12 GeV/c proton beam from the synchrotron into a transfer line. A kicker system of similar design is used to inject the beam from the transfer line into the Medium Energy Booster (MEB). The modulator requirements for these kicker systems are to deliver a pulse train of seven 1.6kA, 2.5 μs pulses at a pulse repetition frequency of 20 pps, every seven seconds for one hour. The impedance of the modulator is 12.5 ω, resulting in a charge voltage of 40 kV. The 10--90% rise time of the pulses is 20 ns, and the 1--99% fall time is 2 μs. The allowable pulse ripple is ±1% of the peak current during the pulse, and ±0.3% from pulse to pulse. The shot -to-shot timing jitter requirement is less than ns. This paper describes the design and performance of the prototype modulator which was fabricated to meet these specifications

SNS EXTRACTION KICKER POWER SUPPLY PROTOTYPE TEST

International Nuclear Information System (INIS)

MI, J.L.; SANDBERG, J.; SANDERS, R.; SOUKAS, A.; ZHANG, W.

2000-01-01

The SNS (Spallation Neutron Source) accumulator ring Extraction System consists of a Fast kicker and a Lambertson Septum magnet. The proposed design will use 14 kicker magnets powered by an Extraction Kicker Power Supply System. They will eject the high power beam from the SNS accumulator ring into RTBT (Ring to Target Beam Tunnel) through a Lambertson Septum magnet. This paper describes some test results of the SNS Extraction Kicker power supply prototype. The high repetition rate of 60 pulse per second operation is the challenging part of the design. In the prototype testing, a 3 kA damp current of 700ns pulse-width, 200 nS rise time and 60 Hz repetition rate at 32 kV PFN operation voltage has been demonstrated. An Extraction kicker power supply system design diagram is depicted

Design and simulation of fast pulsed kicker/bumper units for the positron accumulator ring at APS

International Nuclear Information System (INIS)

Wang, Ju; Volk, G.J.

1991-01-01

In the design of fast pulsed kicker/burner units for a positron accumulator ring (PAR) at APS, different pulse forming networks (PFN) are considered and different structures for the magnet are studied and simulated. Three fast pulsed kicker/bumper magnets are required in PAR for the beam injection and/or extraction at 450 MeV. These magnets have the same design because they have identical specifications and are expected to produce identical magnetic fields. Each kicker/bumper magnet is required to generate a magnetic field of 0.06 T with rise-time of 80 ns, a flat-top of 80 ns and a fall-time of 80 ns. This paper describes some design considerations and computer simulation results of different designs

Electromagnetic cold-test characterization of the quad-driven stripline kicker

International Nuclear Information System (INIS)

Dunlap, J E; Nelson, S D.

1998-01-01

The first kicker concept design for beam deflection was constructed to allow stripline plates to be driven; thus directing, or kicking, the electron beam into two subsequent beam lines. This quad-driven stripline kicker is an eight port electromagnetic network and consists of two actively driven plates and two terminated plates. Electromagnetic measurements performed on the bi-kicker and quad-kicker were designed to determine: (1) the quality of the fabrication of the kicker, including component alignments; (2) quantification of the input feed transition regions from the input coax to the driven kicker plates; (3) identification of properties of the kicker itself without involving the effects of the electron beam; (4) coupling between a line current source and the plates of the kicker; and (5) the effects on the driven current to simulate an electron beam through the body of the kicker. Included in this are the angular variations inside the kicker to examine modal distributions. The goal of the simulated beam was to allow curved path and changing radius studies to be performed electromagnetically. The cold test results produced were then incorporated into beam models

Flow Injection and Atomic Absorption Spectrometry (FI-AAS) -

DEFF Research Database (Denmark)

Hansen, Elo Harald

1996-01-01

One of the advantages of the flow injection (FI) concept is that it is compatible with virtually all detection techniques. Being a versatile vehicle for enhancing the performance of the individual detection devices, the most spectacular results have possibly been obtained in conjunction with atomic...... the point of sample injection/introduction to the point of detection. Hence, in FI-fAAS this feature allows not only to obtain improved repeatability but also improved accuracy, and because the wash to sample ratio is high it permits the handling of samples with elevated salt contents - which...

The LEB to MEB transfer kicker system prototype

International Nuclear Information System (INIS)

Pappas, C.; Wilson, M.; Anderson, D.

1994-01-01

The design requirements for the Low Energy Booster (LEB) extraction kicker system at the Superconducting Super Collider Laboratory (SSCL) were to deflect a 12 GeV/c beam through an angle of 1.5 mrad. The circumference of the LEB was 540 M. This resulted in a 0.06 T-m integrated field, of 1.8 μs width with a 1% to 99% rise time of less than 80 ns and allowable pulse ripple of less than ±1%. The repetition frequency was 10 Hz and the allowable timing jitter was 2 ns. The field was required to be uniform over a 2x4 cm area to ±2.5%. The requirements for the Medium Energy Booster (MEB) injection kicker were similar except that a 99% to 1% pulse fall time of less than 2 μs was needed. Prototypes of the pulsed power system and magnet to meet these requirements were built and tested at the SSCL. This paper describes the results of that testing

A Harmonic Kicker Scheme for the Circulator Cooler Ring in the Proposed Medium Energy Electron-Ion Collider

Energy Technology Data Exchange (ETDEWEB)

Nissen, Edward W.; Hutton, Andrew M.; Kimber, Andrew J.

2013-06-01

The current electron cooler design for the proposed Medium Energy Electron-Ion collider (MEIC) at Jefferson Lab utilizes a circulator ring for reuse of the cooling electron bunch up to 100 times to cool the ion beams. This cooler requires a fast kicker system for injecting and extracting individual bunches in the circulator ring. Such a kicker must work at a high repetition rate, up to 7.5 to 75 MHz depending on the number of turns in the recirculator ring. It also must have a very short rise and fall time (of order of 1 ns) such that it will kick an individual bunch without disturbing the others in the ring. Both requirements are orders of magnitude beyond the present state-of-the-art as well as the goals of other on-going kicker R&D programs such as that for the ILC damping rings. In this paper we report a scheme of creating this fast, high repetition rate kicker by combining RF waveforms at multiple frequencies to create a kicker waveform that will, for example, kick every eleventh bunch while leaving the other ten unperturbed. We also present a possible implementation of this scheme as well as discuss its limitations.

UP-GRADED RHIC INJECTION SYSTEM.

Energy Technology Data Exchange (ETDEWEB)

HAHN,H.FISCHER,W.SEMERTZIDIS,Y.K.WARBURTON,D.S.

2003-05-12

The design of the RHIC injection systems anticipated the possibility of filling and operating the rings with a 120 bunch pattern, corresponding to 110 bunches after allowing for the abort gap. Beam measurements during the 2002 run confirmed the possibility, although at the expense of severe transverse emittance growth and thus not on an operational basis. An improvement program was initiated with the goal of reducing the kicker rise time from 110 to {approx}95 ns and of minimizing pulse timing jitter and drift. The major components of the injection system are 4 kicker magnets and Blmlein pulsers using thyratron switches. The kicker terminating resistor and operating voltage was increased to reduce the rise time. Timing has been stabilized by using commercial trigger units and extremely stable dc supplies for the thyratron reservoir. A fiber optical connection between control room and the thyratron trigger unit has been provided, thereby allowing the operator to adjust timing individually for each kicker unit. The changes were successfully implemented for use in the RHIC operation.

The Antiproton Accumulator (AA)

CERN Multimedia

1980-01-01

A section of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A large vacuum-tank, a quadrupole (QDN09*), a bending magnet (BST08), another vacuum-tank, a wide quadrupole (QFW08) and (in the background) a further bending magnet (BST08). The tanks are covered with heating tape for bake-out. The tank left of QDN09 contained the kickers for stochastic pre-cooling (see 790621, 8002234, 8002637X), the other one served mainly as vacuum chamber in the region where the beam was large. Peter Zettwoch works on QFW08. * see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984) See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

Impedance of a slotted-pipe kicker

Energy Technology Data Exchange (ETDEWEB)

Zhou, Feng [Academia Sinica, Beijing, BJ (China). Inst. of High Energy Physics

1996-08-01

This paper introduces the principle of a new slotted kicker simply, which is made by using vacuum pipe itself with proper slits as current conductors, and then, presents a rough estimation of its longitudinal and transverse impedance, respectively. Calculation shows that its impedance is reduced significantly compared to our present air-coil kicker. (author)

Calculation of Metallization Resistivity and Thickness for MedAustron Kickers

CERN Document Server

Barnes, M J; Stadlbauer, T

2011-01-01

The MedAustron facility, to be built in Wiener Neustadt (Austria), will provide protons and ions for both cancer therapy and research [1]. Different types of kicker magnets will be used in the facility. The kicker magnets are outside machine vacuum: each kicker magnet has a ceramic beam chamber whose inner surface is metalized. The resistivity and thickness of the metallization are chosen such that the induced eddy currents, resulting from the pulsed kicker magnetic field, do not unduly affect the rise/fall times or homogeneity of the magnetic field. A comparison of an analytical calculation and measurement is reported for the effect of metallization of a ceramic chamber in an existing kicker system at CERN. Conclusions concerning the metallization of the ceramic chambers for the MedAustron kicker magnets are presented.

A real time status monitor for transistor bank driver power limit resistor in boost injection kicker power supply

Energy Technology Data Exchange (ETDEWEB)

Mi, J.; Tan, Y.; Zhang, W.

2011-03-28

For years suffering of Booster Injection Kicker transistor bank driver regulator troubleshooting, a new real time monitor system has been developed. A simple and floating circuit has been designed and tested. This circuit monitor system can monitor the driver regulator power limit resistor status in real time and warn machine operator if the power limit resistor changes values. This paper will mainly introduce the power supply and the new designed monitoring system. This real time resistor monitor circuit shows a useful method to monitor some critical parts in the booster pulse power supply. After two years accelerator operation, it shows that this monitor works well. Previously, we spent a lot of time in booster machine trouble shooting. We will reinstall all 4 PCB into Euro Card Standard Chassis when the power supply system will be updated.

Thermal Studies on the SPS Wideband Transverse Feedback Kicker

CERN Document Server

Roggen, Toon; Hofle, Wolfgang; Montesinos, Eric; CERN. Geneva. ATS Department

2016-01-01

As part of the SPS wideband transverse feedback system in the framework of the LHC Injector Upgrade (LIU) project, a wideband kicker design is being proposed. Vertical beam instabilities due to intensity dependent effects (electron cloud instability (ECI) and transverse mode coupling instability (TMCI)) are potentially suppressed by using a feedback system driving such a kicker system. One of the options for a kicker is a one meter long slotted-coaxial kicker, providing a substantial vertical kick strength (10ˉ5 –10ˉ4 eV.s/m) over a bandwidth ranging from nearly DC to 1 GHz. The necessary kick strength requires a total power of 4 kW. This note describes thermal studies that assisted in the material choice of the feedthroughs of the slotted-coaxial kicker and guided the design choices.

submitter Measurements on a 20-layer 12.5 kV prototype inductive adder for the CLIC DR kickers

CERN Document Server

Holma, J

2018-01-01

The CLIC study is investigating the technical feasibility of an electron-positron collider with high luminosity and a nominal centre-of-mass energy of 3 TeV. The predamping rings and damping rings (DRs) will produce ultra-low emittance beam with high bunch charge. To avoid beam emittance increase, the DR kicker systems must provide extremely stable field pulses during injection and extraction of bunches. The DR extraction kicker system consists of a stripline kicker and two pulse modulators. The present specification for the modulators calls for pulses with 160 ns or 900 ns flat-top duration of nominally ±12.5 kV and 305 A, with ripple of not more than ±0.02% (±2.5 V). In addition, there is a proposal to use the same modulators and striplines for dumping the beam, with ±17.5 kV stripline pulse voltage. An inductive adder is a very promising approach to meeting the CLIC DR extraction kicker specifications because analogue modulation methods can be applied to adjust the shape of the flat-top of the output w...

Challenges and Plans for Injection and Beam Dump

Science.gov (United States)

Barnes, M.; Goddard, B.; Mertens, V.; Uythoven, J.

The injection and beam dumping systems of the LHC will need to be upgraded to comply with the requirements of operation with the HL-LHC beams. The elements of the injection system concerned are the fixed and movable absorbers which protect the LHC in case of an injection kicker error and the injection kickers themselves. The beam dumping system elements under study are the absorbers which protect the aperture in case of an asynchronous beam dump and the beam absorber block. The operational limits of these elements and the new developments in the context of the HL-LHC project are described.

Injection system of teh SSC Medium Energy Booster

International Nuclear Information System (INIS)

Mao, N.; Gerig, R.; McGill, J.; Brown, K.

1994-04-01

The Medium Energy Booster (MEB) is the third of the SSCL accelerators and the largest of the resistive magnet synchrotrons. It accelerates protons from an injection momentum of 12 GeV/c to a top momentum of 200 GeV/c. A beam injection system has been designed to inject the beam transferred from the Low Energy Booster onto the MEB closed orbit in the MEB injection insertion region. The beam is injected via a vertical bending Lambertson septum magnet and a horizontal kicker with appropriate matching and very little beam loss and emittance dilution. The beam optics of the injection system is described in this paper. The required parameters of the Lambertson septum magnet and the injection kicker are given

A New Kicker for the TLS Longitudinal Feedback System

CERN Document Server

Lau, Wai-Keung; Dehler, Micha; Hsu, Kuo-Tung; Hsu, San-Yuang; Jung Chou Ping; Wei Chen, Cheng; Yang Chen Huan; Yang Tze Te

2005-01-01

A new longitudinal kicker that is modified from the Swiss Light Source (SLS) design to fit into the TLS storage ring. It will be served as the actuator in the longitudinal multi-bunch feedback control loop. Beam coupling impedance has been calculated by Gdfidl with a PC cluster. Previous to the installation of this new kicker, bench measurement has been performed in the laboratory to characterize this new kicker. The experimental setups for bandwidth and coaxial wire measurement of longitudinal coupling impedance and their corresponding test results will be reported. As a cross check, bead-pull measurement has also been done to verify the beam coupling measurement by coaxial wire method at the kicker center frequency. Longitudinal field profile of the accelerating mode along the beam path has also been mapped. High order cavity modes of the kicker have also been observed and their effects on the beam are evaluated.

Wake field in matched kicker magnet

International Nuclear Information System (INIS)

Miyahara, Y.

1979-01-01

Coherent transverse instability observed in KEK booster proton synchrotron has been reported previously. This instability is induced by the interaction of the beam with kicker magnet for the fast beam extraction. To understand the mechanism completely, it is necessary to know the wake field in detail. Here, the wake field or induced current in the kicker magnet which is terminated with matched resistance is considered

Analysis of ferrite heating of the LHC injection kickers and proposals for future reduction of temperature

CERN Document Server

Barnes, M J; Garrel, N; Goddard, B; Mertens, V; Weterings, W

2012-01-01

The two LHC injection kicker magnet (MKI) systems must produce a kick of 1.3 T.m with a flat top duration variable up to 7860 ns, and rise and fall times of less than 900 ns and 3000 ns, respectively. A beam screen is placed in the aperture of the magnets: the screen consists of a ceramic tube with conductors on the inner wall. The conductors provide a path for the image current of the high intensity LHC beam and screen the ferrite against wake fields. The conductors initially used gave adequately low beam coupling impedance however screen conductor discharges occurred during pulsing of the magnet; hence an alternative design with fewer screen conductors was implemented to meet the often conflicting requirements for low beam coupling impedance, fast magnetic field rise-time and good high voltage behaviour. During 2011 the LHC was operated with high intensity beam, coasting for many hours at a time, resulting in heating of the ferrite yoke of the MKIs. This paper presents an analysis of thermal measurement dat...

Ultrafast harmonic rf kicker design and beam dynamics analysis for an energy recovery linac based electron circulator cooler ring

Directory of Open Access Journals (Sweden)

Yulu Huang

2016-08-01

Full Text Available An ultrafast kicker system is being developed for the energy recovery linac (ERL based electron circulator cooler ring (CCR in the proposed Jefferson Lab Electron Ion Collider (JLEIC, previously named MEIC. In the CCR, the injected electron bunches can be recirculated while performing ion cooling for 10–30 turns before the extraction, thus reducing the recirculation beam current in the ERL to 1/10−1/30 (150  mA-50  mA of the cooling beam current (up to 1.5 A. Assuming a bunch repetition rate of 476.3 MHz and a recirculating factor of 10 in the CCR, the kicker is required to operate at a pulse repetition rate of 47.63 MHz with pulse width of around 2 ns, so that only every 10th bunch in the CCR will experience a transverse kick while the rest of the bunches will not be disturbed. Such a kicker pulse can be synthesized by ten harmonic modes of the 47.63 MHz kicker pulse repetition frequency, using up to four quarter wavelength resonator (QWR based deflecting cavities. In this paper, several methods to synthesize such a kicker waveform will be discussed and a comparison of their beam dynamics performance is made using ELEGANT. Four QWR cavities are envisaged with high transverse shunt impedance requiring less than 100 W of total rf power for a Flat-Top kick pulse. Multipole fields due to the asymmetry of this type of cavity are analyzed. The transverse emittance growth due to the sextupole component is simulated in ELEGANT. Off-axis injection and extraction issues and beam optics using a multicavity kick-drift scheme will also be discussed.

Literature search on Kickers and Septa for the Amsterdam Pulse Stretcher

International Nuclear Information System (INIS)

Kuijt, J.; Linden, A. v.d.

1988-01-01

Literature search has yielded a qualitative and quantitative view on kickers. Quantitatively specifications on designs in literature have been collected. The UPDATE-kickers have been given the following specs: deflection angle 2 mrad, pulsewidth 2 μs, falltime 70 ns, available length about 2 m. Undertaken is a comparison of characteristic parameters: kick strength (energy x angle), pulse characteristics (pulsewidth/falltime) and required peak power. Realisation of the pulse characteristics will impose the greatest requirements on the UPDATE-kicker design. The comparison has shown correspondence with two ferrite kicker designs (CERN-CPS and ELSA), the Los Alamos TEM-kicker and the electrostatic kicker from Saskatoon. On account of the relative simplicity of construction and pulse forming network the Saskatoon kicker has been chosen as the starting point for a design study. Design calculations will proceed from a length of 1.6 m and a gap of 4 cm between two parallel plates at a potential difference of 50 kV. Literature search on septa resulted in an overview on septum magnets and electrostatic wire septa. 72 refs.; 14 figs.; 2 tabs

Beam interaction of a pulsed, nonlinear in-vacuum injection magnet

International Nuclear Information System (INIS)

Rast, Helge

2013-01-01

Theme of this thesis is the study of the interaction of the injection magnet designed for BESSY II with the electron beam. The main topic of this thesis lies in the numerical and measurement-technical study of the loss factor, the wake potential, and the wake impedance of the nonlinear kicker magnet with the aim of an optimization of the magnet design, so that a stable operation of the kicker in the BESSY II storage ring is made possible. A further main topic of this thesis is a study on the matching of the injection scheme with a single kicker to the conditions of the DELTA storage ring, which is operated by the TU Dortmund.

H5 fast-kicker-magnet pulser

International Nuclear Information System (INIS)

Frey, W.; Ghoshroy, S.; Cottingham, J.G.

1982-01-01

The fast extraction kicker magnet for the AGS is powered by a novel pulse generator. A pulse forming network (PFN) is discharged into nearly 100% mismatched load. The pulser delivers a current pulse of 3000 amperes peak pulse with a 2% flat-top ripple into a 1.4 μ H single turn ferrite core magnet. The pulse is 2.8 μsec wide with a 180 nsec rise time, at a 0.5 to 1.5 pps repetition rate. The pulse rise time is required to provide clean extraction of the 28 GeV proton beam by bringing the kicker magnet field up to 1.25 kG within the 220 nsec space between proton bunches in the machine. The pulser is mounted adjacent to the kicker magnet in the AGS ring. The thyratron's characteristics are not affected by the ionizing radiation environment during operation of the AGS

CONSTRUCTION AND POWER TEST OF THE EXTRACTION KICKER MAGNET FOR SNS ACCUMULATOR RING

International Nuclear Information System (INIS)

PAI, C.; HAHN, H.; HSEUH, H.; LEE, Y.; MENG, W.; MI, J.; SANDBERG, J.; TODD, R.

2005-01-01

Two extraction kicker magnet assemblies that contain seven individual pulsed magnet modules each will kick the proton beam vertically out of the SNS accumulator ring into the aperture of the extraction Lambertson septum magnet. The proton beam then travels to the 1.4 MW SNS target assembly. The 14 kicker magnets and major components of the kicker assembly have been fabricated in BNL. The inner surfaces of the kicker magnets were coated with TiN to reduce the secondary electron yield. All 14 PFN power supplies have been built, tested and delivered to OWL. Before final installation, a partial assembly of the kicker system with three kicker magnets was assembled to test the functions of each critical component in the system. In this paper we report the progress of the construction of the kicker components, the TIN coating of the magnets, the installation procedure of the magnets and the full power test of the kicker with the PFN power supply

Stripline kicker for integrable optics test accelerator

Energy Technology Data Exchange (ETDEWEB)

Antipov, Sergey A.; Didenko, Alexander; Lebedev, Valeri; Valishev, Alexander

2016-06-30

We present a design of a stripline kicker for Integrable Optics Test Accelerator (IOTA). For its experimental program IOTA needs two full-aperture kickers, capable to create an arbitrary controllable kick in 2D. For that reason their strengths are variable in a wide range of amplitudes up to 16 mrad, and the pulse length 100 ns is less than a revolution period for electrons. In addition, the kicker should have a physical aperture of 40 mm for a proposed operation with proton beam, and an outer size of 70 mm to fit inside existing quadrupole magnets to save space in the ring. Computer simulations using CST Microwave Studio show high field uniformity and wave impedance close to 50 {\\Omega}.

Kicker thyratron experience from SLC

International Nuclear Information System (INIS)

Donaldson, A.R.; Cassel, R.L.; Mattison, T.S.; Reginato, L.L.

1991-05-01

The SLAC Linear Collider has five fast kickers for the damping ring injectors, extractors, and the electron extractor for the positron target that use multi-gap Deuterium-filled thyratrons. The thyratrons operate with 30 to 70 kV anode voltages and 1 to 5 kA currents, to deliver pulses to kicker magnets with ∼ 30 ns rise times, up to ∼ 150 ns pulse widths, at 120 Hz. Operating and lifetime experience with several types of thyratrons and support electronics are discussed. Floating driver and power supply electronics were replaced by a ferrite choke isolator to allow grounding of the cathode support electronics with a commensurate increase in operating reliability. The construction of a 100 ns Blumlein enabled detailed measurements of the switching times for all SLC thyratrons under similar conditions. In the final focus area, the kickers dump the SLC beams after the e + e - collisions. These thyratrons function with 15 kV anode voltages and up to 2 kA currents to produce 1/2 sine pulses with ∼ 300 ns rise times, ∼ 550 ns FWHM, at 120 Hz. Operating experience with these thyratrons will also be presented. 7 refs., 1 fig., 3 tabs

Electromagnetic simulations of simple models of ferrite loaded kickers

CERN Document Server

Zannini, Carlo; Salvant, B; Metral, E; Rumolo, G

2010-01-01

The kickers are major contributors to the CERN SPS beam coupling impedance. As such, they may represent a limitation to increasing the SPS bunch current in the frame of an intensity upgrade of the LHC. In this paper, CST Particle Studio time domain electromagnetic simulations are performed to obtain the longitudinal and transverse impedances/wake potentials of simplified models of ferrite loaded kickers. The simulation results have been successfully compared with some existing analytical expressions. In the transverse plane, the dipolar and quadrupolar contributions to the wake potentials have been estimated from the results of these simulations. For some cases, simulations have also been benchmarked against measurements on PS kickers. It turns out that the large simulated quadrupolar contributions of these kickers could explain both the negative total (dipolar+quadrupolar) horizontal impedance observed in bench measurements and the positive horizontal tune shift measured with the SPS beam.

Single-bunch kicker pulser

International Nuclear Information System (INIS)

Frey, W.W.

1983-01-01

The single-bunch kicker magnet is powered by a capacitor discharge pulser. The ferrite-core magnet is used to kick out one of twelve proton bunches circulating in the AGS (Alternating Gradient Synchrotron) into the experimental area. The magnet current pulse has a half-sinusoid shape, with a peak current of 2800 A. The pulse current rises and falls to zero, with minimum undershoot, in 410 nsec to minimize effects on adjacent bunches. The magnet inductance is 1.0 μHy. The pulser is mounted on the kicker magnet in the AGS ring, and is exposed to ionizing radiation. The HVDC power supply, controls, monitoring, and auxiliary circuits are housed approximately 300 feet away external to the ring. A two-gap thyratron is used to discharge the energy storage capacitor. Two hydrogen diodes are series connected to function as an inverse diode

Single-bunch kicker pulser

Energy Technology Data Exchange (ETDEWEB)

Frey, W.W.

1983-01-01

The single-bunch kicker magnet is powered by a capacitor discharge pulser. The ferrite-core magnet is used to kick out one of twelve proton bunches circulating in the AGS (Alternating Gradient Synchrotron) into the experimental area. The magnet current pulse has a half-sinusoid shape, with a peak current of 2800 A. The pulse current rises and falls to zero, with minimum undershoot, in 410 nsec to minimize effects on adjacent bunches. The magnet inductance is 1.0 ..mu..Hy. The pulser is mounted on the kicker magnet in the AGS ring, and is exposed to ionizing radiation. The HVDC power supply, controls, monitoring, and auxiliary circuits are housed approximately 300 feet away external to the ring. A two-gap thyratron is used to discharge the energy storage capacitor. Two hydrogen diodes are series connected to function as an inverse diode.

The PEP-II abort kicker system

International Nuclear Information System (INIS)

Lamare, J de; Donaldson, A.; Kulikov, A. Lipari, J.

1997-07-01

The PEP-II project has two storage rings. The HER (High Energy Ring) has up to 1.48 A of electron beam at 9 GeV, and the LER (Low Energy Ring) has up to 2.14 A of positron beam at 3.1 GeV. To protect the HER and LER beam lines in the event of a ring component failure, each ring has an abort kicker system which directs the beam into a dump when a failure is detected. Due to the high current of the beams, the beam kick is tapered from 100% to 80% in 7.33 uS (the beam transit time around the time). This taper distributes the energy evenly across the window which separates the ring from the beam dump such that the window is not damaged. The abort kicker trigger is synchronized with the ion clearing gap of the beam allowing for the kicker field to rise from 0-80% in 370 nS. This report discusses the design of the system controls, interlocks, power supplies, and modulator

Injection quality measurements with diamond based particle detectors

CERN Document Server

Stein, Oliver; CERN. Geneva. ATS Department

2016-01-01

During the re-commissioning phase of the LHC after the long shutdown 1 very high beam losses were observed at the TDI during beam injection. The losses reached up to 90% of the dump threshold. To decrease the through beam losses induced stress on the accelerator components these loss levels need to be reduced. Measurements with diamond based particle detectors (dBLMs), which have nano-second time resolution, revealed that the majority of these losses come from recaptured SPS beam surrounding the nominal bunch train. In this MD the injection loss patterns and loss intensities were investigated in greater detail. Performed calibration shots on the TDI (internal beam absorber for injection) gave a conversion factor from impacting particles intensities to signal in the dBLMs (0.1Vs/109 protons). Using the SPS tune kicker for cleaning the recaptured beam in the SPS and changing the LHC injection kicker settings resulted in a reduction of the injection losses. For 144 bunch injections the loss levels were decreased...

Nanosecond high-voltage generators for supplying the kickers of charged particle accelerators

International Nuclear Information System (INIS)

Korchuganov, V.N.; Matveev, Yu.G.; Shvedov, D.A.

2000-01-01

The high-voltage nanosecond generators (VNG) of rectangular pulses, developed for supplying the injection and extraction kickers of the accelerator-storage complexes are considered in this work. The pulse hydrogen thyratrons and gas-filled discharges are used as commutators in those generators. If necessary, the VNG pulses fronts may be shortened up to 2-3 ns in the coaxial lines, filled with ferrite rings. The mechanism of the pulse fronts shortening was considered earlier. The basis parameters of the VNG various types are presented [ru

Recent advances in kicker pulser technology for linear induction accelerators

International Nuclear Information System (INIS)

Chen, Y. J.; Cook, E.; Davis, B.; Dehope, W. J.; Yen, B.

1999-01-01

Recent progress in the development and understanding of linear induction accelerator have produced machines with 10s of MeV of beam energy and multi-kiloampere currents. Near-term machines, such as DARHT-2, are envisioned with microsecond pulselengths. Fast beam kickers, based on cylindrical electromagnetic stripline structures, will permit effective use of these extremely high-energy beams in an increasing number of applications. In one application, radiography, kickers were an essential element in resolving temporal evolution of hydrodynamic events by cleaving out individual pulses from long, microsecond beams. Advanced schemes are envisioned where these individual pulses are redirected through varying length beam lines and suitably recombined for stereographic imaging or tomographic reconstruction. Recent advances in fast kickers and their pulsed power technology are described. Kicker pulsers based on both planar triode and all solid-state componentry are discussed and future development plans are presented

An Over-damped Cavity Longitudinal Kicker for the PEP-II LER

CERN Document Server

McIntosh, P

2003-01-01

Both rings of PEP-II use drift tube kickers in the longitudinal bunch-by-bunch feedback system. Efforts are now underway to increase the stored beam currents and luminosity of PEP-II, and beam-induced heating of these structures, particularly in the Low Energy Ring (LER) is of concern. An alternative kicker design based on the over-damped cavity kicker, first developed by INFN-Frascati is being built for PEP-II. This low loaded Q (or wide bandwidth) structure is fed by a network of ridged waveguides coupled to a simple pill-box cavity. Beam induced RF power is also coupled out of the cavity to external loads, so that the higher order modes (HOMs) excited in the structure are well-damped. This paper details the kicker design for PEP-II and discusses some of the design trade-offs between shunt impedance and bandwidth, as well as the influence of the feedthroughs on the kicker parameters. Estimates of the expected power deposition in the cavity are also provided.

Measurement scheme of kicker impedances via beam-induced voltages of coaxial cables

Energy Technology Data Exchange (ETDEWEB)

Shobuda, Yoshihiro, E-mail: yoshihiro.shobuda@j-parc.jp [J-PARC Center, JAEA and KEK, 2-4 Shirakata Shirane, Tokaimura, Nakagun, Ibaraki 319-1195 (Japan); Irie, Yoshiro [KEK, High Energy Accelerator Research Organization, 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Toyama, Takeshi; Kamiya, Junichiro [J-PARC Center, JAEA and KEK, 2-4 Shirakata Shirane, Tokaimura, Nakagun, Ibaraki 319-1195 (Japan); Watanabe, Masao [Ministry of Education, Culture, Sports, Science and Technology, 3-2-2 Kasumigaseki, Chiyoda, Tokyo 100-8959 (Japan)

2013-06-11

A new theory, which satisfies the causality condition, is developed to describe impedances of kicker magnets with coaxial cables. The theoretical results well describe measurement results, which are obtained by standard wire methods. On the other hand, when beams pass through the kicker, voltages are induced at the terminals of coaxial cables. In other words, by analyzing the voltages, the kicker impedance for the beams can be obtained. The observed impedances are consistent with the theoretical results. The theory describes the impedance for non-relativistic beams, as well. The theoretical, simulation and measurement results indicate that the horizontal kicker impedance is drastically reduced by the non-relativistic effect. -- Highlights: ► We develop an innovative method to measure kicker impedance including power cable. ► By analyzing voltages at the ends of coaxial cables, the impedance is derived. ► The horizontal impedance is reduced as the beam becomes non-relativistic.

Fast Extraction Kicker for the Accelerator Test Facility

International Nuclear Information System (INIS)

De Santis, Stefano; Urakawa, Junji; Naito, Takashi

2007-01-01

We present the results of a study for the design of a fast extraction kicker to be installed in the Accelerator Test Facility ring at KEK. This activity is carried on in the framework of the ATF2 project, which will be built on the KEK Tsukuba campus as an extension of the existing ATF, taking advantage of the worlds smallest normalized emittance achieved there. ATF2's primary goal is to operate as a test facility and establish the hardware and beam handling technologies envisaged for the International Linear Collider. In particular, the fast extraction kicker object of the present paper is an important component of the ILC damping rings, since its rise and fall time define the minimum distance between bunches and ultimately the damping rings length itself. Building on the initial results presented at EPAC '06, we report on the present status of the kicker design and define the minimum characteristics for pulsers and other subsystems. In addition to the original scheme with multiple stripline modules producing a total deflection of 5 mrad, we also investigated a scheme with a single kicker module for a reduced deflection of 1 mrad placed inside a closed orbit bump, which takes the electron closer to the extraction septum

AN OVERVIEW OF HIGH VOLTAGE DIELECTRIC MATERIAL FOR TRAVELING WAVE KICKER MAGNET APPLICATION

International Nuclear Information System (INIS)

ZHANG, W.; SANDBERG, J.; TUOZZOLO, J.; CASSEL, R.; DUCIMETIERE, L.; JENSEN, C.; BARNES, M.; WAIT, G.; WANG, J.

2002-01-01

Pulsed high power fast kickers are being used to change beam trajectories in particle accelerators. The fast rise and fall time of pulse waveform demands a transmission line structure for the kicker deflector design. The ideal design will be parallel metal plates. However, it uses very long straight sections to achieve the required deflection. In accelerators with constrained straight sections, high permeability materials such as ferrite have to be used to gain deflection efficiency. The transmission line kicker magnet is also referred as traveling wave kicker magnet. Its construction is based on distributed 1-C cells along the longitudinal direction. The magnetic cells and capacitive cells are interleaved to simulate the characteristic impedance of a transmission line to minimize pulse reflection, and provide adequate frequency bandwidth to transmit the kicker pulse with fast rise and fall time. The magnetic cells are usually made of ferrite ceramics, but the capacitive cells have been made with different materials. For traveling wave kickers with higher impedance, the parallel plate vacuum capacitor has been used in CERN and KEK design. Others have used ceramic capacitors, printed circuit boards, and high permittivity ceramics as the capacitive cell. The high dielectric material has the advantage of compactness for low impedance kicker magnet construction. It continues to be very attractive for future kicker magnet applications. The high voltage phenomena associated with high dielectric ceramic materials have been widely reported in many industrial application areas. Their implication in the traveling wave magnet application has to be well understood. In this presentation, the areas requiring further quantitative study will be outlined

The Abort Kicker System for the PEP-II Storage Rings at SLAC.

CERN Document Server

Delamare, J E

2003-01-01

The PEP-II project has two storage rings. The HER (High Energy Ring) has up to 1.48 A of election beam at 9 GeV, and the LER (Low Energy Ring) has up to 2.14 A of positron beam at 3.1 GeV. To protect the HER and LER beam lines in the event of a ring component failure, each ring has an abort kicker system which directs the beam into a dump when a failure is detected. Due to the high current of the beams, the beam kick is tapered from 100% to 80% in 7.33 (micro)S (the beam transit time around the ring). This taper distributes the energy evenly across the window which separates the ring from the beam dump such that the window is not damaged. The abort kicker trigger is synchronized with the ion clearing gap of the beam allowing for the kicker field to rise from 0-80% while there is no beam in the kicker magnet. Originally the kicker system was designed for a rise time of 370nS [1], but because the ion clearing gap was reduced in half, so was the rise time requirement for the kicker. This report discusses the des...

Some fast beam kicker magnet systems at SLAC

International Nuclear Information System (INIS)

Bulos, F.; Cassel, R.L.; Donaldson, A.R.; Genova, L.F.; Grant, J.A.; Mihalka, A.M.; Sukiennicki, B.A.; Tomlin, W.T.; Veldhuizen, F.T.; Walz, D.R.

1987-01-01

The Stanford Linear Collider requires very fast rise and fall times from its kicker magnets. The damping rings and positron source need either one or two bunches deflected from two or three that are separated in time by about 59 ns. The final focus region kicker magnets need a rise time of less than 700 ns and each one deflects only one bunch. This paper discusses the design and characteristics of a thyratron-switched, castor-oil-filled, coaxial, Blumlein line used for one bunch kicking. It discharges a 118 ns (at the base), 50 kV, 3 kA pulse into a 33 cm long, ferrite-loaded, kicker magnet of rectangular coaxial-line geometry, which in turn is terminated by a matched load. Reference is made to a Fermilab (FNAL) designed magnet and a dual-thyratron pulser that deflects two serial bunches in or out of the electron ring. Also, a brief description of the final focus magnet is given

The Abort Kicker System for the PEP-II Storage Rings at SLAC

International Nuclear Information System (INIS)

Delamare, Jeffrey E

2003-01-01

The PEP-II project has two storage rings. The HER (High Energy Ring) has up to 1.48 A of election beam at 9 GeV, and the LER (Low Energy Ring) has up to 2.14 A of positron beam at 3.1 GeV. To protect the HER and LER beam lines in the event of a ring component failure, each ring has an abort kicker system which directs the beam into a dump when a failure is detected. Due to the high current of the beams, the beam kick is tapered from 100% to 80% in 7.33 (micro)S (the beam transit time around the ring). This taper distributes the energy evenly across the window which separates the ring from the beam dump such that the window is not damaged. The abort kicker trigger is synchronized with the ion clearing gap of the beam allowing for the kicker field to rise from 0-80% while there is no beam in the kicker magnet. Originally the kicker system was designed for a rise time of 370nS [1], but because the ion clearing gap was reduced in half, so was the rise time requirement for the kicker. This report discusses the design of the system interlocks, diagnostics, and modulator with the modifications necessary to accommodate an ion clearing gap of 185nS

In situ baking method for degassing of a kicker magnet in accelerator beam line

International Nuclear Information System (INIS)

Kamiya, Junichiro; Ogiwara, Norio; Yanagibashi, Toru; Kinsho, Michikazu; Yasuda, Yuichi

2016-01-01

In this study, the authors propose a new in situ degassing method by which only kicker magnets in the accelerator beam line are baked out without raising the temperature of the vacuum chamber to prevent unwanted thermal expansion of the chamber. By simply installing the heater and thermal radiation shield plates between the kicker magnet and the chamber wall, most of the heat flux from the heater directs toward the kicker magnet. The result of the verification test showed that each part of the kicker magnet was heated to above the target temperature with a small rise in the vacuum chamber temperature. A graphite heater was selected in this application to bake-out the kicker magnet in the beam line to ensure reliability and easy maintainability of the heater. The vacuum characteristics of graphite were suitable for heater operation in the beam line. A preliminary heat-up test conducted in the accelerator beam line also showed that each part of the kicker magnet was successfully heated and that thermal expansion of the chamber was negligibly small

In situ baking method for degassing of a kicker magnet in accelerator beam line

Energy Technology Data Exchange (ETDEWEB)

Kamiya, Junichiro, E-mail: kamiya.junichiro@jaea.go.jp; Ogiwara, Norio; Yanagibashi, Toru; Kinsho, Michikazu [Japan Atomic Energy Agency, J-PARC Center, Ooaza Shirakata 2-4, Tokai, Naka, Ibaraki 319-1195 (Japan); Yasuda, Yuichi [SAKAGUCHI E.H VOC CORP., Sakura Dai-san Kogyodanchi 1-8-6, Osaku, Sakura, Chiba 285-0802 (Japan)

2016-03-15

In this study, the authors propose a new in situ degassing method by which only kicker magnets in the accelerator beam line are baked out without raising the temperature of the vacuum chamber to prevent unwanted thermal expansion of the chamber. By simply installing the heater and thermal radiation shield plates between the kicker magnet and the chamber wall, most of the heat flux from the heater directs toward the kicker magnet. The result of the verification test showed that each part of the kicker magnet was heated to above the target temperature with a small rise in the vacuum chamber temperature. A graphite heater was selected in this application to bake-out the kicker magnet in the beam line to ensure reliability and easy maintainability of the heater. The vacuum characteristics of graphite were suitable for heater operation in the beam line. A preliminary heat-up test conducted in the accelerator beam line also showed that each part of the kicker magnet was successfully heated and that thermal expansion of the chamber was negligibly small.

Diagnosing the PEP-II Injection System

Energy Technology Data Exchange (ETDEWEB)

Decker, F.-J.; Donald, M.H.; Iverson, R.H.; Kulikov, A.; Pappas, G.C.; Weaver, M.; /SLAC

2005-05-09

The injection of beam into the PEP-II B-Factory, especially into the High Energy Ring (HER) has some challenges. A high background level in the BaBar detector has for a while inhibited us from trickling charge into the HER similar to the Low Energy Ring (LER). Analyzing the injection system has revealed many issues which could be improved. The injection bump between two kickers was not closed, mainly because the phase advance wasn't exactly 180{sup o} and the two kicker strengths were not balanced. Additionally we found reflections which kick the stored beam after the main kick and cause the average luminosity to drop about 3% for a 10 Hz injection rate. The strength of the overall kick is nearly twice as high as the design, indicating a much bigger effective septum thickness. Compared with single beam the background is worse when the HER beam is colliding with the LER beam. This hints that the beam-beam force and the observed vertical blow-up in the HER pushes the beam and especially the injected beam further out to the edge of the dynamic aperture or beyond.

Diagnosing the PEP-II Injection System

International Nuclear Information System (INIS)

Decker, F.-J.; Donald, M.H.; Iverson, R.H.; Kulikov, A.; Pappas, G.C.; Weaver, M.; SLAC

2005-01-01

The injection of beam into the PEP-II B-Factory, especially into the High Energy Ring (HER) has some challenges. A high background level in the BaBar detector has for a while inhibited us from trickling charge into the HER similar to the Low Energy Ring (LER). Analyzing the injection system has revealed many issues which could be improved. The injection bump between two kickers was not closed, mainly because the phase advance wasn't exactly 180 o and the two kicker strengths were not balanced. Additionally we found reflections which kick the stored beam after the main kick and cause the average luminosity to drop about 3% for a 10 Hz injection rate. The strength of the overall kick is nearly twice as high as the design, indicating a much bigger effective septum thickness. Compared with single beam the background is worse when the HER beam is colliding with the LER beam. This hints that the beam-beam force and the observed vertical blow-up in the HER pushes the beam and especially the injected beam further out to the edge of the dynamic aperture or beyond

Injection septum magnets for the Loma Linda medical accelerator

International Nuclear Information System (INIS)

Satti, J.A.

1987-01-01

The injection beamline runs over the last magnet before a long straight section and is then displaced downward 55.88 cm to the accelerator beamline. The displacement is magnetic and the final deflection onto the synchrotron orbit is by an electric kicker. The first component, the reverse septum magnet, bends the injection beam 25/degree/ downward. This is followed by the injection septum (20/degree/ bend upward) and the final injection kicker (5/degree/ bend upward). The septum magnets produce a peak field of 3.4 K gauss at a current of 28,000 amperes within a 0.1 msec long pulse. The electric kicker produces a field of 7.3 KV/cm with a pulse length of 0.0011 msec. The septum magnets are similar to each other in construction with a bending radium of 72.7 cm. The curvature is required to increase the effective aperture. Each magnet has a single-turn copper coil bonded to a stainless steel plate for reinforcement. This eliminates insulating material, which could be subject to radiation damage, at the septum. The stainless steel plate is welded to the magnet laminations. The current is confined to the septum by the insulation between the laminations, which are a standard core material. The total septum thickness with shield is 1.227 cm. Pulsing the magnet eliminates the need for water cooling. 2 refs., 4 figs

Kickers and power supplies for the Fermilab Tevatron I antiproton source

International Nuclear Information System (INIS)

Castellano, T.; Bartoszek, L.; Tilles, E.; Petter, J.; McCarthy, J.

1985-05-01

The Fermilab Antiproton Source Accumulator and Debuncher rings require 5 kickers in total. These range in design from conventional ferrite delay line type magnets, with ceramic beam tubes to mechanically complex shuttered kickers situated entirely in the Accumulator Ring's 10 -10 torr vacuum. Power supplies are thyratron switched pulse forming networks that produce microsecond width pulses of several kiloamps with less than 30 nanoseconds rise and fall times. Kicker and power supply design requirements for field strength, vacuum, rise and fall time, timing and magnetic shielding of the stacked beam in the accumulator by the eddy current shutter will be discussed. 8 refs., 3 figs., 2 tabs

Revision of Booster to Storage Ring Transport Line Design and Injection Scheme for Top-Up Operation at NSRRC

CERN Document Server

Wang, Min-Huey; Chen, Jenny; Chen June Rong; Hsu, Kuo-Tung; Kuo, Chin-Cheng; Luo, Gwo-Huei

2005-01-01

In order to help the operation of constant current, the optics of booster to storage ring transport line (BTS) design is reinvestigated. The initial twiss parameters are derived by measurement. The optics of the transport line is readjusted according to the measured initial beam parameters. The design of pulse width of the injection kicker is also changed from 1.2μsecond to 2.0μsecond. The injection scheme is reviewed and the effects of the kicker error on both injected beam and stored beam are investigated and shown in this report.

Effect of saturating ferrite on the field in a prototype kicker magnet

International Nuclear Information System (INIS)

Barnes, M.J.; Wait, G.D.

1994-06-01

The field rise for kicker magnets is often specified between 1% and 99% of full strength. Three-gap thyratrons are frequently used as switches for kicker magnet systems. These thyratrons turn on in three stages: the collapse of voltage across one gap causes a displacement current to flow in the parasitic capacitance of off-state gap(s). The displacement current flows in the external circuit and can thus increase the effective rise-time of the field in the kicker magnet. One promising method of decreasing the effect of the displacement current involves the use of saturating ferrites. Another method for achieving the specified rise-time and 'flatness' for the kick strength is to utilize speed-up networks in the electrical circuit. Measurements have been carried out on a prototype kicker magnet with a speed-up network and various geometries of saturating ferrite. Measurements and PSpice calculations are presented. (author)

Simulation study of electron cloud build up in the SPS MKD kickers

CERN Document Server

Rumolo, G

2009-01-01

During the 2008 run, an unusual behavior characterizing pressure and temperature increase in some of the dump kickers of the SPS was noticed. In particular, it was observed that 1) the MKDV2 kicker would exhibit maximum heating with 75 ns spaced LHC beams and 2) the pressure rise was specially critical in MKDV1 in presence of 50 ns spaced LHC beams [1]. While the anomalous heating of MKDV2 with 75 ns beams could be tentatively explained by the denser beam current spectrum that would more likely hit one of the kicker impedance peaks, the fast pressure rise in MKDV1 with 50 ns spaced beams was ascribed to a surface effect, namely beam induced multipacting leading to electron cloud formation. This report summarizes a simulation study that was done in order to check whether the electron cloud behavior in the dump kickers could explain the experimental observations.

RHIC BEAM ABORT KICKER POWER SUPPLY SYSTEM COMMISSIONING EXPERIENCE AND REMAINING ISSUES

International Nuclear Information System (INIS)

ZHANG, W.; AHRENS, L.A.; MI, J.; OERTER, B.; SANDERS, R.; SANDBERG, J.

2001-01-01

The RHIC Beam Abort Kicker Power Supply Systems commissioning experience and the remaining issues will be reported in this paper. The RHIC Blue Ring Beam Abort Kicker Power Supply System initial commissioning took place in June 1999. Its identical system in Yellow Ring was brought on line during Spring 2000. Each of the RHIC Beam Abort Kicker Power Supply Systems consists of five high voltage modulators and subsystems. These systems are critical devices for RHIC machine protection and environmental protection. They are required to be effective, reliable and operating with sufficient redundancy to safely abort the beam to its beam dump at the end of accumulation or at any time when they are commanded. To deflect 66 GeV ion beam to the beam absorbers, the RHIC Beam Abort Kicker Power Supply Systems were operated at 22 kV level. The RHIC 2000 commissioning run was very successful

Simulation and measurement of the electrostatic beam kicker in the low-energy undulator test line

International Nuclear Information System (INIS)

Waldschmidt, G. J.

1998-01-01

An electrostatic kicker has been constructed for use in the Low-Energy Undulator Test Line (LEUTL) at the Advanced Photon Source (APS). The function of the kicker is to limit the amount of beam current to be accelerated by the APS linac. Two electrodes within the kicker create an electric field that adjusts the trajectory of the beam. This paper will explore the static fields that are set up between the offset electrode plates and determine the reaction of the beam to this field. The kicker was numerically simulated using the electromagnetic solver package MAFIA [1

Design of fast kickers for the ISABELLE beam abort system

International Nuclear Information System (INIS)

Nawrocky, R.J.; Montemurro, P.A.; Baron, J.

1981-01-01

The ISA beam abort (extraction) system must be highly efficient, in the sense of producing minimum beam loss, and reliable to prevent serious damage to accelerator components by the circulating high-energy beams. Since the stored beams will be debunched, the low-loss requirement can be met only with ultra-thin extraction septa and/or fast-acting kickers. This paper examines the design of the ISA extraction kickers subject to a set of extraction channel constraints and a given maximum working voltage. Expressions are derived for determining system parameters for both a lumped parameter magnet and a delay-line magnet. Using these relationships, design parameters are worked out for several possible system configurations. The paper also describes the construction of a full-scale prototype module of the kicker and summarizes the preliminary test results obtained with the module

'Care and Prevent': rationale for investigating skin and soft tissue infections and AA amyloidosis among people who inject drugs in London.

Science.gov (United States)

Harris, M; Brathwaite, R; McGowan, Catherine R; Ciccarone, D; Gilchrist, G; McCusker, M; O'Brien, K; Dunn, J; Scott, J; Hope, V

2018-05-08

Skin and soft tissue infections (SSTIs) are a leading cause of morbidity and mortality among people who inject drugs (PWID). International data indicate up to one third of PWID have experienced an SSTI within the past month. Complications include sepsis, endocarditis and amyloid A (AA) amyloidosis. AA amyloidosis is a serious sequela of chronic SSTI among PWID. Though there is a paucity of literature reporting on AA amyloidosis among PWID, what has been published suggests there is likely a causal relationship between AA amyloidosis and injecting-related SSTI. If left untreated, AA amyloidosis can lead to renal failure; premature mortality among diagnosed PWID is high. Early intervention may reverse disease. Despite the high societal and individual burden of SSTI among PWID, empirical evidence on the barriers and facilitators to injecting-related SSTI prevention and care or the feasibility and acceptability of AA amyloidosis screening and treatment referral are limited. This study aims to fill these gaps and assess the prevalence of AA amyloidosis among PWID. Care and Prevent is a UK National Institute for Health Research-funded mixed-methods study. In five phases (P1-P5), we aim to assess the evidence for AA amyloidosis among PWID (P1); assess the feasibility of AA amyloidosis screening, diagnostic and treatment referral among PWID in London (P2); investigate the barriers and facilitators to AA amyloidosis care (P3); explore SSTI protection and risk (P4); and co-create harm reduction resources with the affected community (P5). This paper describes the conceptual framework, methodological design and proposed analysis for the mixed-methods multi-phase study. We are implementing the Care and Prevent protocol in London. The systematic review component of the study has been completed and published. Care and Prevent will generate an estimate of AA amyloidosis prevalence among community recruited PWID in London, with implications for the development of screening

Dynamic devices: A primer on pickups and kickers

International Nuclear Information System (INIS)

Goldberg, D.A.; Lambertson, G.R.

1991-11-01

A charged-particle beam generates electromagnetic fields which in turn interact with the beam's surroundings. These interactions can produce fields which act back on the beam itself, or, if the ''surroundings'' are of suitably designed form (e.g., sensing electrodes with electrical connection to the ''outside world''), can provide information on various properties of the beam; such electrodes are generally known as pickups. Similarly, charged- particle beams respond to the presence of externally imposed electromagnetic fields; devices used to generate such fields are generally known as kickers. As we shall show, the behavior of an electrode system when it functions as a pickup is intimately related to its behavior as a kicker. A number of papers on pickup behavior have appeared in recent years in most of which the primary emphasis has been on beam instrumentation; there have also been several workshops on the subject. There have been several papers which have treated both pickup and kicker behavior of a particular electrode system, but this has been done in the context of discussing a specialized application, such as a stochastic cooling system. The approach in the present paper is similar to that of earlier works by one of the authors, which is to provide a unified treatment of pickup and kicker behavior, and, it is hoped, to give the reader an understanding which is both general and fundamental enough to make the above references easily accessible to him. As implied by the revised title, we have done the re-writing with the non-expert in mind. We have made the introduction both lengthier and more detailed, and done the same with much of the explanatory material and discussion

Dynamic devices: A primer on pickups and kickers

Energy Technology Data Exchange (ETDEWEB)

Goldberg, D.A.; Lambertson, G.R.

1991-11-01

A charged-particle beam generates electromagnetic fields which in turn interact with the beam`s surroundings. These interactions can produce fields which act back on the beam itself, or, if the ``surroundings`` are of suitably designed form (e.g., sensing electrodes with electrical connection to the ``outside world``), can provide information on various properties of the beam; such electrodes are generally known as pickups. Similarly, charged- particle beams respond to the presence of externally imposed electromagnetic fields; devices used to generate such fields are generally known as kickers. As we shall show, the behavior of an electrode system when it functions as a pickup is intimately related to its behavior as a kicker. A number of papers on pickup behavior have appeared in recent years in most of which the primary emphasis has been on beam instrumentation; there have also been several workshops on the subject. There have been several papers which have treated both pickup and kicker behavior of a particular electrode system, but this has been done in the context of discussing a specialized application, such as a stochastic cooling system. The approach in the present paper is similar to that of earlier works by one of the authors, which is to provide a unified treatment of pickup and kicker behavior, and, it is hoped, to give the reader an understanding which is both general and fundamental enough to make the above references easily accessible to him. As implied by the revised title, we have done the re-writing with the non-expert in mind. We have made the introduction both lengthier and more detailed, and done the same with much of the explanatory material and discussion.

Some fast beam kicker magnet systems at SLAC

International Nuclear Information System (INIS)

Bulos, F.; Cassel, R.L.; Donaldson, A.R.

1987-01-01

The Stanford Linear Collider requires very fast rise and fall times from its kicker magnets. The damping rings and positron source need either one or two bunches deflected from two or three that are separated in time by about 59 ns. The final focus region kicker magnets need a rise time of less than 700 ns and each one deflects only one bunch. This paper discusses the design and characteristics of a thyratron-switched, castor-oil-filled, coaxial, Blumlein line used for one bunch kicking. It discharges a 118 ns (at the base), 50 kV, 3 kA pulse into a 33 cm long, ferrite-loaded, kicker magnet of rectangular coaxial-line geometry, which in turn is terminated by a matched load. Reference is made to a Fermilab (FNAL) designed magnet and a dual-thyratron pulsar that will deflect two serial bunches in or out of the electron ring. Also, a brief description of the final focus magnet is given. Work is continuing on the various subsystem components to decrease the pulse rise and fall time, flattop ripple and jitter and to reduce some of the sources of noise and hv breakdown

Dynamic devices: A primer on pickups and kickers

Energy Technology Data Exchange (ETDEWEB)

Goldberg, D.A.; Lambertson, G.R.

1991-11-01

A charged-particle beam generates electromagnetic fields which in turn interact with the beam's surroundings. These interactions can produce fields which act back on the beam itself, or, if the surroundings'' are of suitably designed form (e.g., sensing electrodes with electrical connection to the outside world''), can provide information on various properties of the beam; such electrodes are generally known as pickups. Similarly, charged- particle beams respond to the presence of externally imposed electromagnetic fields; devices used to generate such fields are generally known as kickers. As we shall show, the behavior of an electrode system when it functions as a pickup is intimately related to its behavior as a kicker. A number of papers on pickup behavior have appeared in recent years in most of which the primary emphasis has been on beam instrumentation; there have also been several workshops on the subject. There have been several papers which have treated both pickup and kicker behavior of a particular electrode system, but this has been done in the context of discussing a specialized application, such as a stochastic cooling system. The approach in the present paper is similar to that of earlier works by one of the authors, which is to provide a unified treatment of pickup and kicker behavior, and, it is hoped, to give the reader an understanding which is both general and fundamental enough to make the above references easily accessible to him. As implied by the revised title, we have done the re-writing with the non-expert in mind. We have made the introduction both lengthier and more detailed, and done the same with much of the explanatory material and discussion.

A Retrofit Technique for Kicker Beam-Coupling Impedance Reduction

CERN Document Server

Caspers, Friedhelm; Kroyer, T; Timmins, M; Uythoven, J; Kurennoy, S

2004-01-01

The reduction of the impedance of operational ferrite kicker structures may be desirable in order to avoid rebuilding such a device. Often resistively coated ceramic plates or tubes are installed for this purpose but at the expense of available aperture. Ceramic U-shaped profiles with a resistive coating fitting between the ellipse of the beam and the rectangular kicker aperture have been used to significantly reduce the impedance of the magnet, while having a limited effect on the available physical aperture. Details of this method, constraints, measurements and simulation results as well as practical aspects are presented and discussed.

Experience with Kicker Beam Coupling Reduction Techniques

CERN Document Server

Gaxiola, Enrique; Caspers, Friedhelm; Ducimetière, Laurent; Kroyer, Tom

2005-01-01

SPS beam impedance is still one of the worries for operation with nominal LHC beam over longer periods, once the final configuration will be installed in 2006. Several CERN SPS kickers suffer from significant beam induced ferrite heating. In specific cases, for instance beam scrubbing, the temperature of certain ferrite yokes went beyond the Curie point. Several retrofit impedance reduction techniques have been investigated theoretically and with practical tests. We report on experience gained during the 2004 SPS operation with resistively coated ceramic inserts in terms of kicker heating, pulse rise time, operating voltage, and vacuum behaviour. For another technique using interleaved metallic stripes we observed significant improvements in bench measurements. Advantages and drawbacks of both methods and potential combinations of them are discussed and simulation as well as measured data are shown. Prospects for further improvements beyond 2006 are briefly outlined.

The injection and extraction of SSRF booster

International Nuclear Information System (INIS)

Li Yuan; Li Haohu; Liu Guimin; Li Deming

2008-01-01

The layout of injection and extraction system were introduced in this paper. The horizontal and vertical injection acceptance are about 23 πmm·mrad and 37 πmm·mrad, respectively, while emittance of the injected beam is 9 πmm·mrad (3σ). This ensures the high injection efficiency. Three slow kickers can form a good bump. The inside position of the entrance of septum is set to 15 mm, where the bumped beam and the extraction beam are 10 mm and 22 mm, respectively, far from the booster central orbit. (authors)

Design of barrier bucket kicker control system

Science.gov (United States)

Ni, Fa-Fu; Wang, Yan-Yu; Yin, Jun; Zhou, De-Tai; Shen, Guo-Dong; Zheng, Yang-De.; Zhang, Jian-Chuan; Yin, Jia; Bai, Xiao; Ma, Xiao-Li

2018-05-01

The Heavy-Ion Research Facility in Lanzhou (HIRFL) contains two synchrotrons: the main cooler storage ring (CSRm) and the experimental cooler storage ring (CSRe). Beams are extracted from CSRm, and injected into CSRe. To apply the Barrier Bucket (BB) method on the CSRe beam accumulation, a new BB technology based kicker control system was designed and implemented. The controller of the system is implemented using an Advanced Reduced Instruction Set Computer (RISC) Machine (ARM) chip and a field-programmable gate array (FPGA) chip. Within the architecture, ARM is responsible for data presetting and floating number arithmetic processing. The FPGA computes the RF phase point of the two rings and offers more accurate control of the time delay. An online preliminary experiment on HIRFL was also designed to verify the functionalities of the control system. The result shows that the reference trigger point of two different sinusoidal RF signals for an arbitrary phase point was acquired with a matched phase error below 1° (approximately 2.1 ns), and the step delay time better than 2 ns were realized.

Fast Kicker for High Current Beam Manipulation in Large Aperture

CERN Document Server

Gambaryan, V

2017-01-01

The pulsed deflecting magnet (kicker) project was worked out in Budker Institute of Nuclear Physics. The kicker design parameters are: impulsive force, 1 mT*m; pulse edge, 5 ns; impulse duration, 200 ns. The unconventional approach is that the plates must be replaced by a set of cylinders. The obtained magnet construction enables the field homogeneity to be controlled by changing current magnitudes in cylinders. Furthermore, we demonstrated the method of field optimization. In addition, measurement technique for the harmonic components was considered and the possibility of control harmonic components value was demonstrated.

Investigation of an Ultrafast Harmonic Resonant RF Kicker

Energy Technology Data Exchange (ETDEWEB)

Huang, Yulu [Univ. of Chinese Academy of Sciences (CAS), Beijing (China)

2016-10-01

square pulse, and get a Flat-Top waveform which will give a uniform kick over the bunch length of the kicked electron bunches, thus the transverse emittance of these kicked electron bunches can be maintained. By using two identical kickers with the betatron phase advance of 180 degree or its odd multiples, the residual kick voltage wave slopes at the unkicked bunch position will be totally cancelled out. Flat-Top waveform combined with two kicker scheme, the transverse emittance of the cooling electron bunches will be conserved during the whole injection, recirculation, and ejection processes. In the cavity design part, firstly, the cavity geometry is optimized to get high transverse shunt impedance thus less than 100 W of RF losses on the cavity wall can be achieved for all these 10 harmonic modes. To support all these 10 harmonic modes, group of four QWRs are adopted with the mode distribution of 5:3:1:1. In the multi-frequency cavities such as the five-mode-cavity and the three-mode-cavity, tunings are required to achieve the design frequencies for each mode. Slight segments of taper design on the inner conductor help to get the frequencies to be exactly on the odd harmonic modes. Stub tuners equal to the number of resonant modes are inserted to the outer conductor wall to compensate the frequency shifts due manufacturing errors and other perturbations during the operation such as the change of the cavity temperature. Single loop couple is designed for all harmonic modes in each cavity. By adjusting its loop size, position and rotation, it is possible to get the fundamental mode critical coupled and other higher harmonic modes slightly over coupled. A broadband circulator will be considered for absorbing the reflected power. Finally in this part, multipole field components due to the asymmetric cylindrical structure around the beam axis of the cavity as well as the beam-induced higher order mode (HOM) issues will be analyzed and discussed in this thesis. A half

Spiral kicker for the beam abort system

Energy Technology Data Exchange (ETDEWEB)

Martin, R.L.

1983-01-01

A brief study was carried out to determine the feasibility of a special kicker to produce a damped spiral beam at the beam dump for the beam abort system. There appears to be no problem with realizing this concept at a reasonably low cost.

Spiral kicker for the beam abort system

International Nuclear Information System (INIS)

Martin, R.L.

1983-01-01

A brief study was carried out to determine the feasibility of a special kicker to produce a damped spiral beam at the beam dump for the beam abort system. There appears to be no problem with realizing this concept at a reasonably low cost

Leg mass characteristics of accurate and inaccurate kickers--an Australian football perspective.

Science.gov (United States)

Hart, Nicolas H; Nimphius, Sophia; Cochrane, Jodie L; Newton, Robert U

2013-01-01

Athletic profiling provides valuable information to sport scientists, assisting in the optimal design of strength and conditioning programmes. Understanding the influence these physical characteristics may have on the generation of kicking accuracy is advantageous. The aim of this study was to profile and compare the lower limb mass characteristics of accurate and inaccurate Australian footballers. Thirty-one players were recruited from the Western Australian Football League to perform ten drop punt kicks over 20 metres to a player target. Players were separated into accurate (n = 15) and inaccurate (n = 16) groups, with leg mass characteristics assessed using whole body dual energy x-ray absorptiometry (DXA) scans. Accurate kickers demonstrated significantly greater relative lean mass (P ≤ 0.004) and significantly lower relative fat mass (P ≤ 0.024) across all segments of the kicking and support limbs, while also exhibiting significantly higher intra-limb lean-to-fat mass ratios for all segments across both limbs (P ≤ 0.009). Inaccurate kickers also produced significantly larger asymmetries between limbs than accurate kickers (P ≤ 0.028), showing considerably lower lean mass in their support leg. These results illustrate a difference in leg mass characteristics between accurate and inaccurate kickers, highlighting the potential influence these may have on technical proficiency of the drop punt.

Analysis of the electrical noise from the APS kicker magnet power supplies

International Nuclear Information System (INIS)

Carwardine, J.A.; Wang, J.

1995-01-01

The APS kicker magnet power supplies deliver damped sinusoidal currents in excess of 2400A peak with a half-period of 300ns to the kicker magnets. Conducted and radiated electromagnetic interference (EMI) is created by this system in the low megahertz range. This interference affects a number of beam diagnostics in the APS injector. The sources and coupling mechanisms for the EMI generated by this system are described and solutions discussed

Kicker for the SLC electron damping ring

International Nuclear Information System (INIS)

Bartelson, L.; Crawford, C.; Dinkel, J.; Kerns, Q.; Howell, J.; Snowdon, S.; Walton, J.

1987-01-01

The SLC electron damping ring requires two kickers each providing a 5 mr kick at 1.2 GEV to pairs of electron bunches spaced 61.63 nsec apart. The exact shape of the kick is unimportant, but the specification applies to the field the bunches see

Antiproton Accumulator (AA)

CERN Multimedia

Photographic Service

1980-01-01

The AA in its final stage of construction, before it disappeared from view under concrete shielding. Antiprotons were first injected, stochastically cooled and accumulated in July 1980. From 1981 on, the AA provided antiprotons for collisions with protons, first in the ISR, then in the SPS Collider. From 1983 on, it also sent antiprotons, via the PS, to the Low-Energy Antiproton Ring (LEAR). The AA was dismantled in 1997 and shipped to Japan.

Dilution kicker for the SPS beam dump

CERN Multimedia

1974-01-01

In order to reduce thermal stress on the SPS dump material, the fast-ejected beam was swept horizontally across the dump. This was done with the "dilution kicker" MKDH, still in use at the time of writing. The person on the left is Manfred Mayer. See also 7404072X.

Beam coupling impedance of fast stripline beam kickers

International Nuclear Information System (INIS)

Caporaso, G; Chen, Y J; Nelson, A D; Poole, B R

1999-01-01

A fast stripline beam kicker is used to dynamically switch a high current electron beam between two beamlines. The transverse dipole impedance of a stripline beam kicker has been previously determined from a simple transmission line model of the structure. This model did not include effects due to the long axial slots along the structure as well as the cavities and coaxial feed transition sections at the ends of the structure. 3-D time domain simulations show that the simple transmission line model underestimates the low frequency dipole beam coupling impedance by about 20% for our structure. In addition, the end cavities and transition sections can exhibit dipole impedances not included in the transmission line model. For high current beams, these additional dipole coupling terms can provide additional beam-induced steering effects not included in the transmission line model of the structure

A FET based kicker for a charge booster for the TRIUMF ISAC project

International Nuclear Information System (INIS)

Barnes, M.J.; Wait, G.D.

2001-07-01

A charge booster unit is required as part of an upgrade to the ISAC facility at TRIUMF. ISAC is an isotope separator coupled to an accelerator. ISAC is presently capable of accelerating only isotopes with atomic mass up to 30. The charge booster will allow ISAC to accelerate all the masses in the periodic table. A fast kicker system has been built to study the characteristics of an existing charge booster, designed by ISN in Grenoble, to assess the suitability of using this charge booster at TRIUMF. This fast kicker will subsequently be used in the TRIUMF ISAC facility for time of flight separation of the chosen charge and to recycle the higher and lower charges back to the charge booster. This will increase the efficiency from 10% to 60%. The kicker system includes a pair of deflector plates. One plate is charged up to -3.5 kV by a PET based modulator, while the other plate is held at ground potential. The modulator consists of two stacks of FETs operating in push pull with variable output voltage, pulse width, and repetition rate from virtually DC to 52 kHz. The measured high voltage output pulse rise and fall times are 63 ns and the minimum pulse width is 350 ns. The maximum pulse width is dependent upon the repetition rate. The large dynamic range for the repetition rate and pulse width required a novel circuit design and control technique, which also resulted in an energy efficient kicker system. This paper describes the design of the kicker system and shows the results of measurements. (author)

Development of the kicker magnet system for the IHEP accelerator

International Nuclear Information System (INIS)

Andreev, V.N.; Kurnaev, O.V.; Sychev, V.A.; Trofimov, Yu.D.

1982-01-01

The KM-14 kicker magnet intended for joint operation with the KM-16 kicker magnet in the U-70 accelerator fast beam extraction system is described. The main characteristics and specific features of the magnet, pulse generators and power supplies are considered. The total aperture type KM-14 magnet (aperture height is equal to 100 mm, its width amounts 150 mm) consists of four modules which are supplied in pair-parallel by two pulse generators. The length of each module is 0.56 m, the field in a gap amounts 0.045 Tl. Joint use of the KM-14 and KM-16 magnets provides beam shooting into bending septum magnet when operating with the booster and beam extraction in the direction of the storage-accelerator complex

Dealing with abort kicker prefire in the Superconducting Super Collider

International Nuclear Information System (INIS)

Drozhdin, A.I.; Baishev, I.S.; Mokhov, N.V.; Parker, B.; Richardson, R.D.; Zhou, J.

1993-05-01

The Superconducting Super Collider uses a single-turn extraction abort system to divert the circulating beam to a massive graphite absorber at normal termination of the operating cycle or in case of any of a number of predefined fault modes. The Collider rings must be designed to be tolerant to abort extraction kicker prefires and misfires because of the large circulating beam energy. We have studied the consequences of beam loss in the accelerator due to such prefires and misfires in terms of material heating and radiation generation using full scale machine simulations and Monte-Carlo energy deposition calculations. Some results from these calculations as well as possible protective measures for minimizing the damaging effects of kicker prefire and misfire are discussed in this paper

Injection and lessons for 2012

International Nuclear Information System (INIS)

Bracco, C.; Barnes, M.J.; Bartmann, W.; Cornelis, K.; Drosdal, L.N.; Goddard, B.; Kain, V.; Meddahi, M.; Mertens, V.; Uythoven, J.

2012-01-01

Injection of 144 bunches into the LHC became fully operational during the 2011 run and one nominal injection of 288 bunches was accomplished. Several mitigation solutions were put in place to minimise losses from the Transfer Line (TL) collimators and losses from kicking de-bunched beam during injection. Nevertheless, shot-by- shot and bunch-by-bunch trajectory variations, as well as long terms drifts, were observed and required a regular re-steering of the TL implying a non negligible amount of time spent for injection setup. Likely sources of instability have been identified (i.e. MKE and MSE ripples) and possible cures to optimise 2012 operation are presented. Well defined references for TL steering will be defined in a more rigorous way in order to allow a more straightforward and faster injection setup. Encountered and potential issues of the injection system, in particular the injection kickers MKI, are discussed also in view of injections with a higher number of bunches. (authors)

Injection and lessons for 2012

CERN Document Server

Bracco, C; Bartmann, W; Cornelis, K; Drosdal, L N; Goddard, B; Kain, V; Meddahi, M; Mertens, V; Uythoven, J

2012-01-01

Injection of 144 bunches into the LHC became fully operational during the 2011 run and a nominal injection of 288 bunches was accomplished during MD time. Several mitigation solutions were put in place to minimise losses from the transfer line (TL) collimators and losses from kicking debunched beam during injection. Nevertheless, shot-by-shot and bunch-by-bunch trajectory variations, as well as long terms drifts, were observed and required a regular resteering of the TL implying a non negligible amount of time spent for injection setup. Likely sources of instability have been identified (i.e. MKE and MSE ripples) and possible cures to optimise 2012 operation are presented. Well defined references for TL steering will be defined in a more rigorous way in order to allow a more straightforward and faster injection setup. Encountered and potential issues of the injection system, in particular the injection kickers MKI, are discussed also in view of injections with a higher number of bunches.

One magnet module of the full-aperture kicker

CERN Multimedia

CERN PhotoLab

1973-01-01

Nine such modules, in a single vacuum tank, form the complete kicker. Ferrite rings (not visible), in conjunction with the capacitance between the plates, create the electrical equivalent of a transmission line. A fast 40 kV pulse is applied, and field rise times of 70-80 nanoseconds can be obtained.

The Effect of Autologous Activated Platelet Rich Plasma (AA-PRP Injection on Pattern Hair Loss: Clinical and Histomorphometric Evaluation

Directory of Open Access Journals (Sweden)

V. Cervelli

2014-01-01

Full Text Available To investigate the safety and clinical efficacy of AA-PRP injections for pattern hair loss. AA-PRP, prepared from a small volume of blood, was injected on half of the selected patients’ scalps with pattern hair loss. The other half was treated with placebo. Three treatments were given for each patient, with intervals of 1 month. The endpoints were hair re-growth, hair dystrophy as measured by dermoscopy, burning or itching sensation, and cell proliferation as measured by Ki-67 evaluation. At the end of the 3 cycles of treatment, the patients presented clinical improvement in the mean number of hairs, with a mean increase of 18.0 hairs in the target area, and a mean increase in total hair density of 27.7 ( number of hairs/cm2 compared with baseline values. Microscopic evaluation showed the increase of epidermis thickness and of the number of hair follicles two weeks after the last AA-PRP treatment compared to baseline value (P<0.05. We also observed an increase of Ki67+ keratinocytes of epidermis and of hair follicular bulge cells and a slight increase of small blood vessels around hair follicles in the treated skin compared to baseline (P<0.05.

In situ degassing of the kicker magnet in J-PARC RCS

International Nuclear Information System (INIS)

Kamiya, Junichiro; Ogiwara, Norio; Hikichi, Yusuke; Yanagibashi, Toru; Kinsho, Michikazu

2015-01-01

The usual way to reduce outgassing from a device in vacuum is to heat up a whole vacuum chamber containing the device. However, the situation, where this method can be applied, is limited due to the heat expansion of the chamber. Especially in accelerators, where the vacuum chambers are connected with nearby beam pipes, this normal bake-out method may not be applied. If a heat source and heat shields are appropriately installed inside the chamber, heat flux is directed to the device. Therefore the device can be baked out without raising the temperature of the vacuum chamber. One candidate for such bake-out method to be applied is kicker magnets in J-PARC RCS, which are installed in large vacuum chambers. We performed the heating tests with some types of heaters in order to examine the effectiveness of this method and to decide the material and configuration of the heater. As a result, the graphite heater was selected for in-situ bake-out of the kickers in the RCS beam line. Using the method, the each material of kicker magnet was heated up above 100degC with keeping the temperature rise of the vacuum chamber below 30degC. (author)

Transverse beam emittance optimization for the injection into BESSY II

Energy Technology Data Exchange (ETDEWEB)

Kramer, Felix [Helmholtz Zentrum Berlin, Institut Beschleunigerphysik (Germany); Humboldt-Universitaet zu Berlin, Institut fuer Physik (Germany)

2016-07-01

For top up injection into the storage ring BESSY II an average injection efficiency of at least 90% is required. In low alpha mode the injection efficiency does not meet the requirements. Future BESSY II features will include shorter bunches in the storage ring (VSR) and user transparent injection with a non linear kicker. These will raise the demands on the quality of the injected beam even further. This work investigates the development of transverse emittance over the acceleration cycle in the synchrotron and the possibility of transverse emittance exchange by a sequence of skew quadrupoles in the transfer line. Results of emittance measurements and emittance exchange simulations will be given.

Spontaneous, Experimentally Induced, and Transmissible AA Amyloidosis in Japanese Quail ( Coturnix japonica).

Science.gov (United States)

Nakayama, Yumi; Kamiie, Junichi; Watanabe, Gen; Suzuki, Kazuhiko; Murakami, Tomoaki

2017-11-01

The authors describe a spontaneous case of amyloid A (AA) amyloidosis in an adult female Japanese quail ( Coturnix japonica). The bird developed AA amyloidosis secondary to chronic peritonitis caused by a Gram-negative bacillus infection. Mild amyloid deposition was also identified in the intestinal tract of apparently healthy adult individuals, suggesting that quail may develop intestinal amyloidosis with age. Based on these observations, it was hypothesized that quail can develop AA amyloidosis following inflammatory stimulation with lipopolysaccharide (LPS). Therefore, adult quail were repeatedly injected with LPS and the development of AA amyloidosis was confirmed. The amyloid deposition in this model increased when quail amyloid was intravenously injected as an amyloid-enhancing factor. The experiments were repeated with young quail, but amyloid deposits were not observed following LPS injections. However, AA amyloidosis did develop when quail amyloid was injected in addition to LPS. These results indicated that adult quail develop AA amyloidosis after inflammatory stimulation with LPS. Furthermore, quail AA amyloidosis was shown to have transmissibility regardless of age. Interestingly, the authors found that administration of chicken amyloid fibrils also induced AA amyloidosis in young quail. This is the first report of cross-species transmission of avian AA amyloidosis.

Thermal analysis of the LHC injection kicker magnets

Science.gov (United States)

Vega, L.; Abánades, A.; Barnes, M. J.; Vlachodimitropoulos, V.; Weterings, W.

2017-07-01

The CERN Large Hadron Collider LHC is equipped with two fast pulsed magnet systems (MKIs) that inject particle beams coming from the injector chain. Operation with high intensity beams for many hours can lead to significant beam induced heating of the ferrite yokes of the MKIs. When the ferrite exceeds the Curie temperature of 125°C it loses its magnetic properties, preventing further injection until the ferrite cools down, potentially causing a delay of several hours. Hence important upgrades of the beam-screen were implemented after Run 1 of LHC. However, the High-Luminosity (HL) LHC will be operated with significantly higher intensity beams and hence additional measures are required to limit the ferrite temperature. These magnets operate under ultra-high vacuum conditions: convection is negligible and, as a result of low emissivity of the inside of the vacuum tanks, thermal radiation is limited. A detailed study of the thermal behaviour of these magnets is reported and compared with measurements. In addition several options to improve cooling of the ferrites are presented and analysed.

MKI UFOs at Injection

CERN Document Server

Baer, T; Bartmann, W; Bracco, C; Carlier, E; Chanavat, C; Drosdal, L; Garrel, N; Goddard, B; Kain, V; Mertens, V; Uythoven, J; Wenninger, J; Zerlauth, M

2011-01-01

During the MD, the production mechanism of UFOs at the injection kicker magnets (MKIs) was studied. This was done by pulsing the MKIs on a gap in the circulating beam, which led to an increased number of UFOs. In total 43 UFO type beam loss patterns at the MKIs were observed during the MD. The MD showed that pulsing the MKIs directly induces UFO type beam loss patterns. From the temporal characteristics of the loss profile, estimations about the dynamics of the UFOs are made.

(PCL/AA) hydrogel for controlled drug delivery

Indian Academy of Sciences (India)

Administrator

applications, (iii) dental applications, (iv) injectable polymers, (v) ... PCL with AA grafted PCL(PCL-g-AA) on the structure ... porosity. Structure, morphology and crystallinity of PCL/ .... X-ray diffraction patterns were recorded, in reflection,.

The PEP injection system

International Nuclear Information System (INIS)

Brown, K.L.; Avery, R.T.; Peterson, J.M.

1988-01-01

A system to transport 10-to-15-GeV electron and positron beams from the Stanford Linear Accelerator and to inject them into the PEP storage ring under a wide variety of lattice configurations has been designed. Optically, the transport line consists of three 360/degree/ phase-shift sections of FODO lattice, with bending magnets interspersed in such a way as to provide achromaticity, convenience in energy and emittance definition, and independent tuning of the various optical parameters for matching into the ring. The last 360/degree/ of phase shift has 88 milliradians of bend in a vertical plane and deposits the beam at the injection septum via a Lambertson magnet. Injection is accomplished by launching the beam with several centimeters of radial betatron amplitude in a fast bump provided by a triad of pulsed kicker magnets. Radiation damping reduces the collective amplitude quickly enough to allow injection at a high repetition rate

PSR extraction kicker system improvements

International Nuclear Information System (INIS)

Hardek, T.W.

1991-01-01

A program to improve the reliability of hardware required to operate the Los Alamos Proton Storage Ring has been under way for the past three years. The extraction kicker system for the PSR was identified as one candidate for improvement. Pulse modulators produce 50kV pulses 360 nsec in length at up to 24-Hz pulse repetition rate and drive two 4-meter-long stripline electrodes. Sources of difficulty with this system included short width switch tube lifetime, drive cable electrical breakdown, high-voltage connector failure, and occasional electrode breakdown. This paper discusses modifications completed on this system to correct these difficulties. 2 refs., 3 figs

THE RHIC BEAM ABORT KICKER SYSTEM

International Nuclear Information System (INIS)

Hahn, H.

1999-01-01

THE ENERGY STORED IN THE RHIC BEAM IS ABOUT 200 KJ PER RING AT DESIGN ENERGY AND INTENSITY. TO PREVENT QUENCHING OF THE SUPERCONDUCTING MAGNETS OR MATERIAL DAMAGE, THE BEAM WILL BE SAFELY DISPOSED OF BY AN INTERNAL BEAM ABORT SYSTEM, WHICH INCLUDES THE KICKER MAGNETS, THE PULSED POWER SUPPLIES, AND THE DUMP ABSORBER. DISPOSAL OF HEAVY IONS, SUCH AS GOLD, IMPOSES DESIGN CONSTRAINTS MORE SEVERE THAN THOSE FOR PROTON BEAMS OF EQUAL INTENSITY. IN ORDER TO MINIMIZE THE THERMAL SHOCK IN THE CARBON-FIBER DUMP BLOCK, THE BUNCHES MUST BE LATERALLY DISPERSED

Mechanical design of ceramic beam tube braze joints for NOvA kicker magnets

Energy Technology Data Exchange (ETDEWEB)

Ader, C.R.; Reilly, R.E.; Wilson, J.H.; /Fermilab

2010-05-01

The NO?A Experiment will construct a detector optimized for electron neutrino detection in the existing NuMI neutrino beam. The NuMI beam line is capable of operating at 400 kW of primary beam power and the upgrade will allow up to 700 kW. Ceramic beam tubes are utilized in numerous kicker magnets in different accelerator rings at Fermi National Accelerator Laboratory. Kovar flanges are brazed onto each beam tube end, since kovar and high alumina ceramic have similar expansion curves. The tube, kovar flange, end piece, and braze foil alloy brazing material are stacked in the furnace and then brazed. The most challenging aspect of fabricating kicker magnets in recent years have been making hermetic vacuum seals on the braze joints between the ceramic and flange. Numerous process variables can influence the robustness of conventional metal/ceramic brazing processes. The ceramic-filler metal interface is normally the weak layer when failure does not occur within the ceramic. Differences between active brazing filler metal and the moly-manganese process will be discussed along with the applicable results of these techniques used for Fermilab production kicker tubes.

Optimization of speed-up network component values for the 30 Ω resistively terminated prototype kicker magnet

International Nuclear Information System (INIS)

Barnes, M.J.; Wait, G.D.

1993-01-01

Kicker magnets are required for all ring-to-ring transfers in the 5 rings of the proposed KAON factory synchrotron. The kick must rise from 1% to 99% of full strength during the time interval of gaps created in the beam (80 ns to 160 ns) so that the beam can be extracted with minimum losses. In order to achieve the specified rise-time and open-quote flatness close-quote for the kick it is necessary to utilize speed-up networks, comprising a capacitor and a resistor, in the electrical circuit. Speed-up networks may be connected electrically on both the input and output of the kicker magnet. In addition it is advantageous to connect a open-quote speed-up close-quote network on the input of the resistive terminator(s). A sequence which may minimize the number of mathematical simulations required to optimize the values of the 8 possible speed-up components is presented. PE2D has been utilized to determine inductance and capacitance values for the resistive terminator; this data has been used in PSpice transient analyses. Results of the PE2D predictions are also presented. The research has culminated in a predicted kick rise time (1% to 99%) of less than 50 ns for a TRIUMF 10 cell prototype kicker magnet. The proposed improvements are currently being implemented on our prototype kicker system

Injection and extraction techniques in circular accelerators

International Nuclear Information System (INIS)

Tang Jingyu

2008-01-01

Injection and extraction are usually the key systems in circular accelerators. They play important roles in transferring the beam from one stage acceleration to the other or to experimental stations. It is also in the injection and extraction regions where beam losses happen mostly. Due to the tight space and to reduce the perturbation to the circulating orbit, the devices are usually designed to meet special requirements such as compactness, small stray field, fast rise time or fall time, etc. Usual injection and extraction devices include septum magnets, kicker magnets, electrostatic deflectors, slow bump magnets and strippers. In spite of different accelerators and specification for the injection and extraction devices, many techniques are shared in the design and manufacturing. This paper gives a general review on the techniques employed in the major circular accelerators in China. (authors)

Development of an in situ bake-out method of outgassing reduction of kicker ferrite cores

International Nuclear Information System (INIS)

Kamiya, Junichiro; Ogiwara, Norio; Nishikawa, Masaaki; Hikichi, Yusuke; Yanagibashi, Toru; Suganuma, Kazuaki

2012-01-01

The usual way for reduce outgassing of a large structure in vacuum is to bake the whole vacuum chamber containing the structure. However, this method needs a huge heater capacity and there are limits caused by the heat expansion of the chamber. The solution is to raise the temperature of the structure inside without heating the vacuum chamber. This is achieved by installing a heat source inside the chamber and by inserting the heat shield between the structure and the chamber walls to direct the heat to the structure. In the particle accelerator field, it is often required to reduce outgassing of structures inside vacuum chambers. One example is a kicker magnet, which is installed in a vacuum chamber and consists mainly of ferrite and aluminum alloy. As known from former experience the main outgassing component from ferrite is water. We applied the above mentioned method to the outgassing reduction of such a kicker. We are able to direct most of the heat flow toward the kicker magnet by inserting the heat shielding plates and thus outgassing was successfully reduced. (author)

The PS Booster's ejection kicker: full house.

CERN Multimedia

CERN PhotoLab

1971-01-01

The modules of the Booster's four-storied full-aperture kicker pretty much fill their vacuum tank (front cover removed). In the original 800 MeV version, the delay-type modules were pulsed at 30 kV from a Pulse-Forming-Network (PFN), yielding a field risetime as short as 60 ns. The fieldstrength was 0.1 T at a current of 1200 A. The modules are made from steel plates and ferrite slabs. The ferrite's high initial outgassing rate presented a serious vacuum problem for a long time.

The fast extraction kicker power supply for the main ring of J-PARC

Energy Technology Data Exchange (ETDEWEB)

Koseki, Kunio, E-mail: kunio.koseki@kek.jp

2013-11-21

An effect induced by parasitic inductance in a pulsed power supply for a fast extraction kicker was studied. The parasitic inductance in high voltage capacitors for a low impedance pulse forming network disturbs a sharp rise of an excitation current. A high voltage capacitor with a coaxial structure to minimize the parasitic inductance is proposed. The effectiveness was confirmed experimentally. An impedance mismatch by a leakage inductance of a pulse transformer in a transmission line was studied. The effect is serious at the flat-top period of the excitation current. By introducing a compensation circuit, which is composed by a capacitor and a resistor, impedance matching was established. The pulsed power supply for the fast extraction kicker was operated at a charging voltage of 30 kV. A required rise time of less than 1.1 μs was achieved. The flatness was also confirmed to be in an acceptable value of less than 1%. -- Highlights: ●An effect by parasitic inductance of the energy storage capacitor of the PFN was studied. ●A faster rise time was achieved by introducing a coaxial structure for the PFN capacitor. ●An impedance mismatch by a leakage inductance of a pulse transformer was studied. ●Serious deterioration of the pulsed waveform was cured by a compensation circuit. ●The pulsed power supply for the fast extraction kicker was developed and operated successfully.

Design and Testing of a Fast, 50 kV Solid-State Kicker Pulser

International Nuclear Information System (INIS)

Cook, E G; Hickman, B C; Lee, B S; Hawkins, S A; Gower, E J; Allen, F V; Walstrom, P L

2002-01-01

The ability to extract particle beam bunches from a ring accelerator in arbitrary order can greatly extend an accelerator's capabilities and applications. A prototype solid-state kicker pulser capable of generating asynchronous bursts of 50 kV pulses has been designed and tested into a 50(Omega) load. The pulser features fast rise and fall times and is capable of generating an arbitrary pattern of pulses with a maximum burst frequency exceeding 5 MHz If required, the pulse-width of each pulse in the burst is independently adjustable. This kicker modulator uses multiple solid-state modules stacked in an inductive-adder configuration where the energy is switched into each section of the adder by a parallel array of MOSFETs. Test data, capabilities, and limitations of the prototype pulser are described

Longitudinal study of experimental induction of AA amyloidosis in mice seeded with homologous and heterologous AA fibrils.

Science.gov (United States)

Muhammad, Naeem; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka

2016-09-01

To investigate pathogenesis and kinetics of experimentally induced murine AA amyloidosis seeded with homologous (murine) and heterologous (bovine) AA fibrils. Experimental AA amyloidosis was induced by administration of inflammatory stimulus and preformed AA fibrils to a total of 111 female C57/Black mice. In this longitudinal study, heterologous (bovine) as well as homologous (murine) AA fibrils were injected intraperitoneally to mice in various combinations. Re-stimulation was done at 120 or 300 days post first inoculation. To analyze the intensity of amyloid depositions in mice organs, immunohistochemical techniques and image J software were used. Assessment of cytokines level in sera was done using a Mouse Th1/Th2/Th17 Cytokine CBA Kit. Incidence and severity of AA amyloidosis were quite low in mice inoculated with heterologous bovine AA fibrils than homologous murine one. Homologous AA fibrils administration at first and second inoculation caused maximum amount of amyloid depositions and severe systemic form of amyloidosis. Increase in the level of pro-inflammatory cytokine IL-6 was observed after first inoculation, while second inoculation caused a further increase in the level of anti-inflammatory cytokine IL-10. AA amyloidosis can be induced by heterologous as well as homologous AA fibrils. Severity of AA amyloidosis induced with homologous AA fibrils is higher compared to heterologous AA fibrils.

Steel septum magnets for the LHC beam injection and extraction

CERN Document Server

Bidon, S; Guinand, M; Gyr, Marcel; Sassowsky, M; Weisse, E; Weterings, W; Abramov, A; Ivanenko, A I; Kolatcheva, E; Lapyguina, O; Ludmirsky, E; Mishina, N; Podlesny, P; Riabov, A; Tyurin, N

2002-01-01

The Large Hadron Collider (LHC) will be a superconducting accelerator and collider to be installed in the existing underground LEP ring tunnel at CERN. It will provide proton-proton collisions with a centre of mass energy of 14 TeV. The proton beams coming from the SPS will be injected into the LHC at 450 GeV by vertically deflecting kicker magnets and horizontally deflecting steel septum magnets (MSI). The proton beams will be dumped from the LHC with the help of two extraction systems comprising horizontally deflecting kicker magnets and vertically deflecting steel septum magnets (MSD). The MSI and MSD septa are laminated iron-dominated magnets using an all welded construction. The yokes are constructed from two different half cores, called coil core and septum core. The septum cores comprise circular holes for the circulating beams. This avoids the need for careful alignment of the usually wedge-shaped septum blades used in classical Lambertson magnets. The MSI and MSD septum magnets were designed and buil...

First circulating beam in the AA

CERN Multimedia

CERN PhotoLab

1980-01-01

On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.56 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are too numerous to name them all, but the 3 most prominent ones are at the centre (left to right): Roy Billinge (Joint AA Project Leader, with his hand on the control box), Eifionydd Jones (white shirt), Simon van der Meer (spiritus rector and Joint AA Project Leader). The first antiprotons were injected, made to circulate and cooled soon after, on 14 July 1980.

Harmonic Kicker RF Cavity for the Jefferson Lab Electron-Ion Collider EM Simulation, Modification, and Measurements

Science.gov (United States)

Overstreet, Sarah; Wang, Haipeng

2017-09-01

An important step in the conceptual design for the future Jefferson Lab Electron-Ion Collider (JLEIC) is the development of supporting technologies for the Energy Recovery Linac (ERL) Electron Cooling Facility. The Harmonic Radiofrequency (RF) kicker cavity is one such device that is responsible for switching electron bunches in and out of the Circulator Cooling Ring (CCR) from and to the ERL, which is a critical part of the ion cooling process. Last year, a half scale prototype of the JLEIC harmonic RF kicker model was designed with resonant frequencies to support the summation of 5 odd harmonics (95.26 MHz, 285.78 MHz, 476.30 MHz, 666.82 MHz, and 857.35 MHz); however, the asymmetry of the kicker cavity gives rise to multipole components of the electric field at the electron-beam axis of the cavity. Previous attempts to symmetrize the electric field of this asymmetrical RF cavity have been unsuccessful. The aim of this study is to modify the existing prototype for a uniform electric field across the beam pathway so that the electron bunches will experience nearly zero beam current loading. In addition to this, we have driven the unmodified cavity with the harmonic sum and used the wire stretching method for an analysis of the multipole electric field components.

Initial measurements on a prototype inductive adder for the CLIC kicker systems

CERN Document Server

Holma, Janne

2013-01-01

The CLIC study is exploring the scheme for an electron-positron collider with high luminosity and a nominal centre-of-mass energy of 3 TeV. The CLIC pre-damping rings and damping rings will produce, through synchrotron radiation, ultra-low emittance beam with high bunch charge. To avoid beam emittance increase, the damping ring kicker systems must provide extremely flat, high-voltage, pulses. The specifications for the extraction kickers of the DRs are particularly demanding: the flattops of the pulses must be ±12.5 kV with a combined ripple and droop of not more than ±0.02 % (±2.5 V). An inductive adder is a very promising approach to meeting the specifications. To achieve ultra-flat pulses with a fast rise time the output impedance of the inductive adder needs to be well matched to the system impedance. The parasitic circuit elements of the inductive adder have a significant effect upon the output impedance and these values are very difficult to calculate accurately analytically. To predict these paramet...

The Prototype Inductive Adder With Droop Compensation for the CLIC Kicker Systems

CERN Document Server

Holma, J

2014-01-01

The Compact Linear Collider (CLIC) study is exploring the scheme for an electron-positron collider with high luminosity and a nominal center-of-mass energy of 3 TeV. The CLIC predamping rings and damping rings (DRs) will produce, through synchrotron radiation, an ultralow emittance beam with high bunch charge. To avoid beam emittance increase, the DR kicker systems must provide extremely flat, high-voltage, pulses. The specifications for the extraction kickers of the DRs are particularly demanding: the flattops of the pulses must be ±12.5 kV with a combined ripple and droop of not more than ±0.02% (±2.5 V). An inductive adder is a very promising approach to meeting the specifications. Recently, a five-layer prototype has been built at CERN. Passive analog modulation has been applied to compensate the voltage droop, for example of the pulse capacitors. The output waveforms of the prototype inductive adder have been compared with predictions of the voltage droop and pulse shape. Conclusions are drawn concern...

Pulse shape adjustment for the SLC damping ring kickers

International Nuclear Information System (INIS)

Mattison, T.; Cassel, R.; Donaldson, A.; Fischer, H.; Gough, D.

1991-05-01

The difficulties with damping ring kickers that prevented operation of the SLAC Linear Collider in full multiple bunch mode have been overcome by shaping the current pulse to compensate for imperfections in the magnets. The risetime was improved by a peaking capacitor, with a tunable inductor to provide a locally flat pulse. The pulse was flattened by an adjustable droop inductor. Fine adjustment was provided by pulse forming line tuners driven by stepping motors. Further risetime improvement will be obtained by a saturating ferrite pulse sharpener. 4 refs., 3 figs

The AA disappearing under concrete shielding

CERN Multimedia

CERN PhotoLab

1982-01-01

When the AA started up in July 1980, the machine stood freely in its hall, providing visitors with a view through the large window in the AA Control Room. The target area, in which the high-intensity 26 GeV/c proton beam from the PS hit the production target, was heavily shielded, not only towards the outside but also towards the AA-Hall. However, electrons and pions emanating from the target with the same momentum as the antiprotons, but much more numerous, accompanied these through the injection line into the AA ring. The pions decayed with a half-time corresponding to approximately a revolution period (540 ns), whereas the electrons lost energy through synchrotron radiation and ended up on the vacuum chamber wall. Electrons and pions produced the dominant component of the radiation level in the hall and the control room. With operation times far exceeding original expectations, the AA had to be buried under concrete shielding in order to reduce the radiation level by an order of magnitude.

Literature file on 'fast kickers and septa', componenets for deflection and separation of particle beams

International Nuclear Information System (INIS)

Linden, A. van der.

1988-11-01

The File consists of classified and numbered articles from the literature on the following subjects: 1 - Kickers: fast switching (electro-)magnetic or electrostatic components for small deflection; 2 - Septum Magnets: both small and great deflecting components, with the purpose to create or bridge over space between the deflected beam and the other, unperturbed beam; 3 - Electrostatic Septa: low loss, beam splitting components which give small deflection for the extracted part of the beam and no perturbation for the rest of the beam. The articles have been classified per institute or laboratory, eventually with further classification per project. The classified articles are then numbered chronologically. Extension of the File is still possible. The contents of the articles are summarized by means of catchwords. Specifications of the described kickers, septum magnets and electrostatic septa are represented in a tabular form

Abort kicker power supply systems at Fermilab

International Nuclear Information System (INIS)

Krafczyk, G.; Dugan, G.; Harrison, M.; Koepke, K.; Tilles, E.

1985-01-01

Over the past several years, Fermilab has been operating with a single turn proton abort system in both the superconducting Tevatron and the conventional Main Ring. The abort kicker power supply for this system discharges a lumped capacitance into the inductive magnet load, causing the beam to enter the abort channel. A unique feature of this design is the high voltage, high current diode assembly used to clip the recharge of the capacitor bank. This allows the current to decay slowly with the L/R time constant of the magnet and diode series combination. Special attention will be given to the diode characteristics needed for this passive switching element. Operational experience and proposed upgrades will be given for the two operational systems

Role and mechanism of AT1-AA in the pathogenesis of HELLP syndrome.

Science.gov (United States)

Bu, Shurui; Wang, Yuxian; Sun, Shuqing; Zheng, Yanqian; Jin, Zhu; Zhi, Jianming

2018-01-10

HELLP syndrome remains a leading cause of maternal and neonatal mortality and morbidity worldwide, which symptoms include hemolysis, elevated liver enzymes and low platelet count. The objective of this study was to determine whether HELLP is associated with AT1-AA. The positive rate and titer of AT1-AA in plasma from pregnant women were determined, and the correlation of AT1-AA titer with the grade of HELLP was analyzed. A HELLP rat model established by intravenous injection of AT1-AA. Our experimental results show the AT1-AA titer and positive rate were significantly higher in HELLP group, and AT1-AA titer were positively correlated with the level of TNF-α and ET-1 in plasma and the grade of HELLP syndrome. The results of animal experiments showed that the typical features of HELLP in the pregnant rats after AT1-AA injection. The levels of TNF-α and ET-1 in plasma and liver tissue were significantly increased in AT1-AA-treated rats compared with control rats. The HELLP syndrome induced by AT1-AA was attenuated markedly after administration of losartan. These data support the hypothesis that one the potential pathway that AT1-AA induce damage to capillary endothelial cells and liver during pregnancy is through activation of TNF-α and ET-1.

Experimental immunologically mediated aplastic anemia (AA) in mice: cyclosporin A fails to protect against AA

International Nuclear Information System (INIS)

Knospe, W.H.; Steinberg, D.; Gratwohl, A.; Speck, B.

1984-01-01

Immunologically mediated aplastic anemia (AA) in mice was induced by the i.v. injection of 10(7) lymph node cells (LNC) from H-2k identical but Mls mismatched CBA/J donor mice into previously irradiated (600 rad total body gamma) C3H/HeJ mice. Cyclosporin A (CsA), 25 mg/kg, was administered subcutaneously from day -1 to day 30. Control mice included C3H/HeJ mice which received 600 rad alone, C3H/HeJ mice which received 600 rad plus CsA as above, and C3H/HeJ mice which received 600 rad total body irradiation followed by 10(7) LNC from CBA/J donors. CsA failed to prevent lethal AA. These results suggest that the pathogenetic mechanisms operating in immunologically mediated AA differ from the mechanisms operating in rodents transplanted with allogeneically mismatched marrow or spleen cells which develop graft-versus-host disease. The results are consistent with a non-T cell-dependent mechanism causing the AA

Studies on Transverse Painting for H- Injection into the PSB

CERN Document Server

Bracco, C; Fowler, T; Goddard, B; Grawer, G; Lallement, J B; Martini, M; Weterings, W

2011-01-01

Linac4 will inject 160 MeV H- ions into the CERN PS Booster (PSB). This will allow to reduce space charge effects and increase beam intensity but will require a substantial upgrade of the injection region. The PSB has to provide beam to several users with different requirements in terms of beam intensity and emittance. Four kicker magnets (KSW) will be used to accomplish painting in the horizontal phase space to match the injected beams to the required emittances. Multiple linear functions, with varying slopes for each user, have been defined for the KSW generators waveforms according to detailed beam dynamic studies for all target intensities and emittances. Preliminary studies have been carried out to evaluate how to obtain the required vertical emittance and the option of a transverse painting, also in the vertical plane, is explored.

Studies on the construction of a new 80 MeV injector and a new injection scheme for the synchrotron of the Bonn accelerator facility ELSA

International Nuclear Information System (INIS)

Raecke, K.

2001-09-01

At the ELSA Accelerator Facility exists the opportunity to install a 80 MeV linear accelerator as an injector for the 2,5 GeV Booster Synchrotron. Because of its length the new structure cannot replace one of the linacs used today so possibilities to built up the accelerator and the transfer channels are worked out. Calculations comparing the injection efficiency of the present layout and the possible new layout show a recognizable improvement. The injection efficiency can be further improved using a single turn injection scheme. A septum magnet and a fast kicker for this injection scheme is designed. (orig.)

Design and test of the RHIC CMD10 abort kicker

International Nuclear Information System (INIS)

Hahn, H.; Blaskiewicz, M.; Drees, A.; Fischer, W.; Mi, J.; Meng, W.; Montag, C.; Pai, C.; Sandberg, J.; Tsoupas, N.; Tuozzolo, J. E.; Zhang, W.

2015-01-01

In recent RHIC operational runs, planned and unplanned pre-fire triggered beam aborts have been observed that resulted in quenches of SC main ring magnets, indicating a weakened magnet kick strength due to beam-induced ferrite heating. An improvement program was initiated to reduce the longitudinal coupling impedance with changes to the ferrite material and the eddy-current strip geometry. Results of the impedance measurements and of magnet heating tests with CMD10 ferrite up to 190°C are reported. All 10 abort kickers in the tunnel have been modified and were provided with a cooling system for the RUN 15.

Calibration Measurements of the LHC Beam Dumping System Extraction Kicker Magnets

CERN Document Server

Uythoven, J; Ducimetière, L; Goddard, B; Gräwer, G; Olivieri, F; Pereira, L; Vossenberg, Eugène B

2006-01-01

The LHC beam dumping system must protect the LHC machine from damage by reliably and safely extracting and absorbing the circulating beams when requested. Two sets of 15 extraction kicker magnets form the main active part of this system. They have been produced, tested and calibrated by measuring the integrated magnetic field and the magnet current at different beam energies. The calibration data have been analysed, and the critical parameters are compared with the specifications. Implications for the configuration, control and operation of the beam dumping system are discussed.

Measurements on Prototype Inductive Adders with Ultra-Flat-Top Output Pulses for CLIC DR Kickers

CERN Document Server

Holma, J; Belver-Aguilar, C

2014-01-01

The CLIC study is investigating the technical feasibility of an electron-positron collider with high luminosity and a nominal centre-of-mass energy of 3 TeV. The CLIC pre-damping rings and damping rings (DRs) will produce ultra-low emittance beam with high bunch charge. To avoid beam emittance increase, the DR kicker systems must provide extremely flat, high-voltage, pulses. The specifications for the DR extraction kickers call for a 160 ns duration flat-top pulses of ±12.5 kV, 250 A, with a combined ripple and droop of not more than ±0.02 % (±2.5 V). An inductive adder is a very promising approach to meeting the specifications because this topology allows the use of both passive and analogue modulation methods to adjust the output waveform. Recently, two five-layer, 3.5 kV, prototype inductive adders have been built at CERN. The first of these has been used to test the passive and active analogue modulation methods to compensate voltage droop and ripple of the output pulses. Pulse waveforms have been reco...

New beam-based and direct magnetic waveform measurements of the BTx.KFA10(20) vertical recombination kickers and induced emittance blow-up simulations at 1.4 and 2 GeV

CERN Document Server

Forte, Vincenzo; Borburgh, Jan; Sermeus, Luc; CERN. Geneva. ATS Department

2018-01-01

In the framework of the LHC Injectors Upgrade (LIU) project [1], this document summarises a new reconstruction methodology for the measurement of the magnetic waveforms of the vertical re-combination kickers BT1.KFA10, BT4.KFA10 and BT2.KFA20, from data collected during several Machine Development (MD) sessions. The reconstruction has been performed in order to verify the LIU specification of the recombination kickers, which is required for a clean transfer of the longer bunches coming from the PSB after the upgrade. A beam-based methodology was developed to measure the transient magnetics dynamics of the kicker where the bunch length is comparable to the rise and/or fall times. These measurements represent a valuable way to reconstruct the mag-netic waveform of the kickers where removing them to make direct probe measurements is time consuming. A benchmarking of the beam-based measurements with field probe measurements is presented, together with realistic simulations of the vertical emittance blow-up at 1...

Bone Morphogenic Protein 4-Smad-Induced Upregulation of Platelet-Derived Growth Factor AA Impairs Endothelial Function.

Science.gov (United States)

Hu, Weining; Zhang, Yang; Wang, Li; Lau, Chi Wai; Xu, Jian; Luo, Jiang-Yun; Gou, Lingshan; Yao, Xiaoqiang; Chen, Zhen-Yu; Ma, Ronald Ching Wan; Tian, Xiao Yu; Huang, Yu

2016-03-01

Bone morphogenic protein 4 (BMP4) is an important mediator of endothelial dysfunction in cardio-metabolic diseases, whereas platelet-derived growth factors (PDGFs) are major angiogenic and proinflammatory mediator, although the functional link between these 2 factors is unknown. The present study investigated whether PDGF mediates BMP4-induced endothelial dysfunction in diabetes mellitus. We generated Ad-Bmp4 to overexpress Bmp4 and Ad-Pdgfa-shRNA to knockdown Pdgfa in mice through tail intravenous injection. SMAD4-shRNA lentivirus, SMAD1-shRNA, and SMAD5 shRNA adenovirus were used for knockdown in human and mouse endothelial cells. We found that PDGF-AA impaired endothelium-dependent vasodilation in aortas and mesenteric resistance arteries. BMP4 upregulated PDGF-AA in human and mouse endothelial cells, which was abolished by BMP4 antagonist noggin or knockdown of SMAD1/5 or SMAD4. BMP4-impared relaxation in mouse aorta was also ameliorated by PDGF-AA neutralizing antibody. Tail injection of Ad-Pdgfa-shRNA ameliorates endothelial dysfunction induced by Bmp4 overexpression (Ad-Bmp4) in vivo. Serum PDGF-AA was elevated in both diabetic patients and diabetic db/db mice compared with nondiabetic controls. Pdgfa-shRNA or Bmp4-shRNA adenovirus reduced serum PDGF-AA concentration in db/db mice. PDGF-AA neutralizing antibody or tail injection with Pdgfa-shRNA adenovirus improved endothelial function in aortas and mesenteric resistance arteries from db/db mice. The effect of PDGF-AA on endothelial function in mouse aorta was also inhibited by Ad-Pdgfra-shRNA to inhibit PDGFRα. The present study provides novel evidences to show that PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms. Inhibition of PGDF-AA ameliorates vascular dysfunction in diabetic mice. © 2016 American Heart Association, Inc.

NuMI proton kicker extraction magnet termination resistor system

Energy Technology Data Exchange (ETDEWEB)

Reeves, S.R.; Jensen, C.C.; /Fermilab

2005-05-01

The temperature stability of the kicker magnet termination resistor assembly directly affects the field flatness and amplitude stability. Comprehensive thermal enhancements were made to the existing Main Injector resistor assembly design to satisfy NuMI performance specifications. Additionally, a fluid-processing system utilizing Fluorinert{reg_sign} FC-77 high-voltage dielectric was built to precisely control the setpoint temperature of the resistor assembly from 70 to 120F, required to maintain constant resistance during changing operational modes. The Fluorinert{reg_sign} must be continually processed to remove hazardous breakdown products caused by radiation exposure to prevent chemical attack of system components. Design details of the termination resistor assembly and Fluorinert{reg_sign} processing system are described. Early performance results will be presented.

ADVANCEMENT OF THE RHIC BEAM ABORT KICKER SYSTEM

International Nuclear Information System (INIS)

ZHANG, W.; AHRENS, L.; MI, J.; OERTER, B.; SANDBERG, J.; WARBURTON, D.

2003-01-01

As one of the most critical system for RHIC operation, the beam abort kicker system has to be highly available, reliable, and stable for the entire operating range. Along with the RHIC commission and operation, consistent efforts have been spend to cope with immediate issues as well as inherited design issues. Major design changes have been implemented to achieve the higher operating voltage, longer high voltage hold-off time, fast retriggering and redundant triggering, and improved system protection, etc. Recent system test has demonstrated for the first time that both blue ring and yellow ring beam abort systems have achieved more than 24 hours hold off time at desired operating voltage. In this paper, we report break down, thyratron reverse arcing, and to build a fast re-trigger system to reduce beam spreading in event of premature discharge

Biomechanical predictors of ball velocity during punt kicking in elite rugby league kickers

OpenAIRE

Sinclair, Jonathan Kenneth; Taylor, Paul John; Atkins, Stephen; Hobbs, Sarah Jane

2016-01-01

Punt kicking is integral to the attacking and defensive elements of rugby league and the ability to kick the ball with high\\ud velocity is desirable. This study aimed to identify important technical aspects of kicking linked to the generation of ball\\ud velocity. Maximal punt kicks were obtained from six elite rugby league kickers using a 10-camera motion capture system.\\ud Three-dimensional kinematics of the lower extremities was obtained. Regression analysis with ball velocity as criterion\\...

Characteristics of AA amyloidosis patients in San Francisco.

Science.gov (United States)

Lejmi, Hiba; Jen, Kuang-Yu; Olson, Jean L; James, Sam H; Sam, Ramin

2016-04-01

AA amyloidosis due to subcutaneous injection of drugs of abuse has been described in the USA, but all the existing literature is from more than 20 years ago. There is more recent literature from Europe. We have observed a high incidence of AA amyloidosis in the county hospital in San Francisco. Here, we describe 24 patients who had kidney biopsy-proven AA amyloidosis from our hospital from 1998 to 2013. All the patients were thought to have AA amyloidosis from skin popping of illicit drugs after having exhausted the intravenous route. These patients with biopsy-proven AA amyloidosis were analysed further. All patients were found to have hepatitis C infection, hypertension was not common, most had advanced kidney failure, and acidosis was common as was tubulointerstitial involvement on the kidney biopsy. Other organ involvement included hepatomegaly and splenomegaly in a number of patients; direct myocardial involvement was not seen, but pulmonary hypertension, history of deep vein thrombosis and pulmonary embolism were common. The prognosis of these patients was poor. The mortality rate approached 50% 1 year after biopsy, and most of the patient needed dialysis shortly after diagnosis. Cessation of drug use seemed beneficial but rarely achievable. AA amyloidosis from skin popping is common in San Francisco. Most patients with renal involvement end up on dialysis, and mortality rates are exceedingly high. © 2015 Asian Pacific Society of Nephrology.

A preliminary design of the Los Alamos fast Kicker Magnet Pulser and Power Supply

International Nuclear Information System (INIS)

Winje, R.A.

1988-01-01

The technical design of the Kicker Magnet Pulser and Power Supply is based on the switching of a precharged pulse forming network (pfn) into a matched load. Provisions are made through the selection of the main switch tube to accommodate loads that are not matched to the pfn impedance. The paper includes a description of the major components of the power supply and a summary of the performance parameters. 4 figs., 3 tabs

Effects of Ascorbic Acid Injection in Incubated Eggs Submitted to Heat Stress on Incubation Parameters and Chick Quality

Directory of Open Access Journals (Sweden)

S Sgavioli

2015-06-01

Full Text Available Dose-dependent positive effects on hatchability and hatchling weight have been attributed to ascorbic acid (AA when eggs were submitted or not to intermittent heat stress during incubation. Fertile breeder (Cobb(r eggs were used to determine if the pre-incubation injection of AA in ovo affects the incubation and hatchling quality of egg incubated under thermoneutral or intermittent heat stress conditions. Eggs were not injected or injected with 0, 2,4, or 6% AA/100µL water and incubated at continuous thermoneutral (37.5ºC or hot (39.0ºC temperature. Eggshell temperature (EST increased in the second half of the incubation period in all experimental groups. The EST of non-injected eggs and of those injected with water was higher when incubated at 39°C than at 37.5°C, but EST was not different among eggs injected with AA. Egg mass loss and eggshell conductance were higher in the eggs incubated at 39°C than at 37.5°C.Hatchability was lower in the eggs injected with AA. Liver and yolk sac weights were higher, whereas heart and liver weights were lower in hatchlings from eggs incubated at 39°C; however, hatchling weight was not affected by incubation temperature. The results showed that AA doses affected egg conductive heat loss and hatchability, and that they did not minimize the effects of high incubation temperature on liver and heart development.

Transmission line analysis of beam deflection in a BPM stripline kicker

International Nuclear Information System (INIS)

Caporaso, G.J.; Chen, Yu Ju; Poole, B.

1997-05-01

In the usual treatment of impedances of beamline structures the electromagnetic response is computed under the assumption that the source charge trajectory is parallel to the propagation axis and is unaffected by the wake of the structure. For high energy beams of relatively low current this is generally a valid assumption. Under certain conditions the assumption of a parallel source charge trajectory is no longer valid and the effects of the changing trajectory must be included in the analysis. Here the usual transmission line analysis that has been applied to BPM type transverse kickers is extended to include the self-consistent motion of the beam in the structure

Online Measurement of the Energy Spread of Multi-Turn Beam in the Fermilab Booster at Injection

Energy Technology Data Exchange (ETDEWEB)

Nelson, J. [Brown U.; Bhat, C. M. [Fermilab; Hendricks, B. S. [Fermilab

2017-07-01

We have developed a computer program interfaced with the ACNET environment of Fermilab accelerators to measure energy spread of the proton beam from the LINAC at an injection into the Booster. It uses a digitizing oscilloscope and provides users an ability to configure the scope settings for optimal data acquisition from a resistive wall current monitor. When the program is launched, a) a one shot timeline is generated to initiate beam injection into the Booster, b) a gap of about 40 ns is produced in the injected beam using a set of fast kickers, c) collects line charge distribution data from the wall current monitor for the first 200 μs from the injection and d) performs complete data analysis to extract full beam energy spread of the beam. The program also gives the option to store the data for offline analyses. We illustrate a case with an example. We also present results on beam energy spread as a function of beam intensity from recent measurements.

The Low-Level Control System for the CERN PS Multi-Turn Extraction Kickers

CERN Document Server

Schipper, J; Boucly, C; Carlier, E; Fowler, T; Gaudillet, H; Noulibos, R; Sermeus, L

2010-01-01

To reduce the beam losses when preparing high intensity proton beam for the CERN Neutrino to Gran Sasso (CNGS) facility, a new Multi-Turn extraction (MTE) scheme has been implemented in the PS, to replace the present Continuous Transfer (CT) to the SPS. Industrial off-the-shelf components have been used for the low-level part of the MTE kicker control system. National Instruments PXI systems are used to control the high voltage pulse generators and a SIEMENS programmable logic controller (PLC) handles the centralised oil cooling and gas insulation sub-systems

Role of N-Arachidonoyl-Serotonin (AA-5-HT in Sleep-Wake Cycle Architecture, Sleep Homeostasis, and Neurotransmitters Regulation

Directory of Open Access Journals (Sweden)

Eric Murillo-Rodríguez

2017-05-01

Full Text Available The endocannabinoid system comprises several molecular entities such as endogenous ligands [anandamide (AEA and 2-arachidonoylglycerol (2-AG], receptors (CB1 and CB2, enzymes such as [fatty acid amide hydrolase (FAHH and monoacylglycerol lipase (MAGL], as well as the anandamide membrane transporter. Although the role of this complex neurobiological system in the sleep–wake cycle modulation has been studied, the contribution of the blocker of FAAH/transient receptor potential cation channel subfamily V member 1 (TRPV1, N-arachidonoyl-serotonin (AA-5-HT in sleep has not been investigated. Thus, in the present study, varying doses of AA-5-HT (5, 10, or 20 mg/Kg, i.p. injected at the beginning of the lights-on period of rats, caused no statistical changes in sleep patterns. However, similar pharmacological treatment given to animals at the beginning of the dark period decreased wakefulness (W and increased slow wave sleep (SWS as well as rapid eye movement sleep (REMS. Power spectra analysis of states of vigilance showed that injection of AA-5-HT during the lights-off period diminished alpha spectrum across alertness in a dose-dependent fashion. In opposition, delta power spectra was enhanced as well as theta spectrum, during SWS and REMS, respectively. Moreover, the highest dose of AA-5-HT decreased wake-related contents of neurotransmitters such as dopamine (DA, norepinephrine (NE, epinephrine (EP, serotonin (5-HT whereas the levels of adenosine (AD were enhanced. In addition, the sleep-inducing properties of AA-5-HT were confirmed since this compound blocked the increase in W caused by stimulants such as cannabidiol (CBD or modafinil (MOD during the lights-on period. Additionally, administration of AA-5-HT also prevented the enhancement in contents of DA, NE, EP, 5-HT and AD after CBD of MOD injection. Lastly, the role of AA-5-HT in sleep homeostasis was tested in animals that received either CBD or MOD after total sleep deprivation (TSD. The

Effect of kicker circuit inductance on the transmission-line discharging

International Nuclear Information System (INIS)

Feng Deren; Wang Xiangqi; Shang Lei; Pei Yuanji; Fan Kuanjun

2004-01-01

Circuit inductance exists at discharging circuit of transmission-line, it includes the inductance at the main switch of thyratron when conducts, the linking inductance between the linking cables, the matching resistance inductance and the load inductance. When a long pulse is generated by transmission-line, the circuit inductance can be omitted. However, when the pulse is short (such as shorter than 200 ns), especially when ferromagnetic core kicker acts as the load, the effect is obvious. The short pulse current is needed in order to generate long time interval synchronous radiation light pulses by using online assembly of pulse convex orbit and DC convex orbit. This paper analyses the effect and presents several experimental results. It also supposes two practical cases to decrease the rise time of the pulse

Fast and reliable kicker magnets for the SLC damping rings

International Nuclear Information System (INIS)

Mattison, T.S.; Cassel, R.L.; Donaldson, A.R.; Gross, G.

1995-01-01

The design, construction, and operation of a kicker magnet with superior electromagnetic performance and greatly improved radiation tolerance is described. A short flux return of high mu ferrite improves the field strength and linearity with current, and novel metallic field-confining structures minimize the inductance. An 8-cell structure with capacitance integrated into each cell makes the magnet a nearly perfect transmission line. The capacitor dielectric is 1 cm thick alumina-loaded epoxy, processed to eliminate air voids, and cast in a multiple step procedure developed to circumvent epoxy shrinkage. The magnet operates with pulses of up to 40 kV and 3.2 kA at 120 Hz, with magnet transit times of less than 35 nsec and field rise and fall times of less than 60 nsec

A waveguide overloaded cavity as longitudinal kicker for the DA{Phi}NE bunch-by-bunch feedback system

Energy Technology Data Exchange (ETDEWEB)

Gallo, A; Boni, R; Ghigo, A; Marcellini, F; Serio, M; Zobov, M [Instituto Nazionale de Fisica Nucleare, Frascati (Italy). Lab. Nazionale di Frascati

1996-08-01

The multibunch operation of DA{Phi}NE calls for a very efficient feedback system to damp the coupled-bunch longitudinal instabilities. A collaboration program among SLAC, LBL and LNF laboratories on this subject led to the development of a time domain, digital system based on digital signal processors that has been already successfully tested at ALS. The feedback chain ends with the longitudinal kicker, an electromagnetic structure capable of transferring the proper energy correction to each bunch. A cavity kicker for the DA{Phi}NE bunch-by-bunch longitudinal feedback system based on a pill-box loaded by six waveguides has been designed and a full-scale aluminium prototype has been fabricated at LNF. Both simulations and measurements have shown a peak shunt impedance of about 750 ohm and a bandwidth of about 220 MHz. The large shunt impedance allows to economize on the costly feedback power. Moreover, the damping waveguides drastically reduce the device HOM longitudinal and transverse impedances. One cavity pre ring will be sufficient to operate the machine up to 30 bunches while a second device per ring together with a feedback power improvement will be necessary to reach the ultimate current. (G.T.)

The Injection System of SAGA Light Source

CERN Document Server

Iwasaki, Yoshitaka; Ohgaki, Hideaki; Okajima, Toshihiro; Takabayashi, Yuichi; Tomimasu, Takio; Yoshida, Katuhide

2005-01-01

Saga light Source is a 1.4-GeV electron storage ring with a circumference of 75.6m. The injector is a 250-MeV linac producing 1 ms macro-pulse with a peak current of 12mA and repetition rate of 1Hz. The output beam from the linac is transported though a transport line, and injected into the ring though a septum magnet with a bending angle of 20-degree. The transport line consists of two bending magnets, two quadrupole doublelets, and a quadrupole singlet. The bump orbit is formed by four kicker magnets, two of which are installed at both sides of septum magnet, and other two are positioned apart by one magnet cell of the ring. They are excited by sinusoidal electric currents with a half width of 0.5 ms. The beam optics for the injection trajectory is computed and shown at control room, the parameters for which are provided directly from the power supply control server PC. The operator is able to see real-time result of the beam trajectory calculation. This tool is quite effective to optimize the magnets param...

The short circumference damping ring design for the ILC

CERN Document Server

Korostelev, Maxim S; Kuriki, Masao; Kuroda, Shigeru; Naito, Takashi; Ross, Marc; Urakawa, Junji; Zimmermann, Frank

2005-01-01

The ILC damping ring tentative design is driven by the operational scenario of the main linac, the beam-dynamics demand of producing a stable and high-quality beam, the injection/extraction scheme and the kicker performance. In this paper, a short circumference damping ring design based on TME cells is described. The ring accommodates injection kickers which provide a flat top of 280 nsec and a 60 nsec rise and fall time and very fast strip-line kickers for beam extraction with a 2 nsec rise and fall time for 3-MHz operation. The potential impact of collective effects and the possible degradation of the dynamic aperture by nonlinear-wiggler fields are estimated.

Studies on the construction of a new 80 MeV injector and a new injection scheme for the synchrotron of the Bonn accelerator facility ELSA; Studien zum Aufbau eines neuen 80 MeV-Injektors und eines neuen Injektionsschemas fuer das Synchroton der Bonner Beschleunigeranlage ELSA

Energy Technology Data Exchange (ETDEWEB)

Raecke, K.

2001-09-01

At the ELSA Accelerator Facility exists the opportunity to install a 80 MeV linear accelerator as an injector for the 2,5 GeV Booster Synchrotron. Because of its length the new structure cannot replace one of the linacs used today so possibilities to built up the accelerator and the transfer channels are worked out. Calculations comparing the injection efficiency of the present layout and the possible new layout show a recognizable improvement. The injection efficiency can be further improved using a single turn injection scheme. A septum magnet and a fast kicker for this injection scheme is designed. (orig.)

Retinal Astrocytes and GABAergic Wide-Field Amacrine Cells Express PDGFRα: Connection to Retinal Ganglion Cell Neuroprotection by PDGF-AA.

Science.gov (United States)

Takahama, Shokichi; Adetunji, Modupe O; Zhao, Tantai; Chen, Shan; Li, Wei; Tomarev, Stanislav I

2017-09-01

Our previous experiments demonstrated that intravitreal injection of platelet-derived growth factor-AA (PDGF-AA) provides retinal ganglion cell (RGC) neuroprotection in a rodent model of glaucoma. Here we used PDGFRα-enhanced green fluorescent protein (EGFP) mice to identify retinal cells that may be essential for RGC protection by PDGF-AA. PDGFRα-EGFP mice expressing nuclear-targeted EGFP under the control of the PDGFRα promoter were used. Localization of PDGFRα in the neural retina was investigated by confocal imaging of EGFP fluorescence and immunofluorescent labeling with a panel of antibodies recognizing different retinal cell types. Primary cultures of mouse RGCs were produced by immunopanning. Neurobiotin injection of amacrine cells in a flat-mounted retina was used for the identification of EGFP-positive amacrine cells in the inner nuclear layer. In the mouse neural retina, PDGFRα was preferentially localized in the ganglion cell and inner nuclear layers. Immunostaining of the retina demonstrated that astrocytes in the ganglion cell layer and a subpopulation of amacrine cells in the inner nuclear layer express PDGFRα, whereas RGCs (in vivo or in vitro) did not. PDGFRα-positive amacrine cells are likely to be Type 45 gamma-aminobutyric acidergic (GABAergic) wide-field amacrine cells. These data indicate that the neuroprotective effect of PDGF-AA in a rodent model of glaucoma could be mediated by astrocytes and/or a subpopulation of amacrine cells. We suggest that after intravitreal injection of PDGF-AA, these cells secrete factors protecting RGCs.

Acceleration of tendon healing using US guided intratendinous injection of bevacizumab: First pre-clinical study on a murine model

International Nuclear Information System (INIS)

Dallaudière, Benjamin; Lempicki, Marta; Pesquer, Lionel; Louedec, Liliane; Preux, Pierre Marie; Meyer, Philippe; Hess, Agathe; Durieux, Marie Hèlène Moreau; Hummel, Vincent; Larbi, Ahmed; Deschamps, Lydia

2013-01-01

Purpose: Tendinopathy shows early disorganized collagen fibers with neo-angiogenesis on histology. Peri-tendinous injection of corticosteroid is the commonly accepted strategy despite the abscence of inflammation in tendinosis. The aim of our study was to assess the potential of intratendinous injection of an anti-angiogenic drug (bevacizumab, AA) to treat tendinopathy in a murine model of patellar and Achilles tendinopathy, and to evaluate its local toxicity. Materials and method: Forty rats (160 patellar and Achilles tendons) were used for this study. We induced tendinosis (T+) in 80 tendons by injecting under ultrasonography (US) guidance Collagenase 1 ® (day 0 = D0, patellar = 40 and Achilles = 40). Clinical examination and tendon US were performed at D3, immediately followed by either AA (AAT+, n = 40) or physiological serum (PST+, n = 40, control) US-guided intratendinous injection. Follow-up at D6 and D13 using clinical, US and histology, and comparison between the 2 groups were performed. To study AA toxicity we compared the 80 remaining normal tendons (T−) after injecting AA in 40 (AAT−). Results: All AAT+ showed a better joint mobilization compared to PST+ at D6 (p = 0.004) with thinner US tendon diameters (p < 0.004), and less disorganized collagen fibers and neovessels on histology (p < 0.05). There was no difference at D13 regarding clinical status, US tendon diameter and histology (p > 0.05). Comparison between AAT− and T− showed no AA toxicity on tendon (p = 0.18). Conclusion: Our study suggests that high dose mono-injection of AA in tendinosis, early after the beginning of the disease, accelerates tendon's healing, with no local toxicity

Acceleration of tendon healing using US guided intratendinous injection of bevacizumab: First pre-clinical study on a murine model

Energy Technology Data Exchange (ETDEWEB)

Dallaudière, Benjamin, E-mail: bendallau64@hotmail.fr [Service de Radiologie, Hôpital universitaire Bichat, Paris (France); Inserm U698, Hôpital universitaire Bichat, Paris (France); Université de Médecine Paris Diderot (France); Lempicki, Marta [Service de Radiologie, Hôpital universitaire Bichat, Paris (France); Université de Médecine Paris Diderot (France); Pesquer, Lionel [Centre d’Imagerie Ostéo Articulaire, Clinique du Sport de Bordeaux-Mérignac (France); Louedec, Liliane [Inserm U698, Hôpital universitaire Bichat, Paris (France); Preux, Pierre Marie [Laboratoire de Biostatistiques, Faculté de médecine, Limoges (France); Meyer, Philippe [Centre d’Imagerie Ostéo Articulaire, Clinique du Sport de Bordeaux-Mérignac (France); Hess, Agathe [Service de Radiologie, Hôpital universitaire Bichat, Paris (France); Université de Médecine Paris Diderot (France); Durieux, Marie Hèlène Moreau [Centre d’Imagerie Ostéo Articulaire, Clinique du Sport de Bordeaux-Mérignac (France); Hummel, Vincent; Larbi, Ahmed [Service de Radiologie, Hôpital universitaire Bichat, Paris (France); Deschamps, Lydia [Service d’ Anatomopathologie, Hôpital universitaire Bichat, Paris (France); and others

2013-12-01

Purpose: Tendinopathy shows early disorganized collagen fibers with neo-angiogenesis on histology. Peri-tendinous injection of corticosteroid is the commonly accepted strategy despite the abscence of inflammation in tendinosis. The aim of our study was to assess the potential of intratendinous injection of an anti-angiogenic drug (bevacizumab, AA) to treat tendinopathy in a murine model of patellar and Achilles tendinopathy, and to evaluate its local toxicity. Materials and method: Forty rats (160 patellar and Achilles tendons) were used for this study. We induced tendinosis (T+) in 80 tendons by injecting under ultrasonography (US) guidance Collagenase 1{sup ®} (day 0 = D0, patellar = 40 and Achilles = 40). Clinical examination and tendon US were performed at D3, immediately followed by either AA (AAT+, n = 40) or physiological serum (PST+, n = 40, control) US-guided intratendinous injection. Follow-up at D6 and D13 using clinical, US and histology, and comparison between the 2 groups were performed. To study AA toxicity we compared the 80 remaining normal tendons (T−) after injecting AA in 40 (AAT−). Results: All AAT+ showed a better joint mobilization compared to PST+ at D6 (p = 0.004) with thinner US tendon diameters (p < 0.004), and less disorganized collagen fibers and neovessels on histology (p < 0.05). There was no difference at D13 regarding clinical status, US tendon diameter and histology (p > 0.05). Comparison between AAT− and T− showed no AA toxicity on tendon (p = 0.18). Conclusion: Our study suggests that high dose mono-injection of AA in tendinosis, early after the beginning of the disease, accelerates tendon's healing, with no local toxicity.

AA, Inner Conductor of Magnetic Horn

CERN Multimedia

CERN PhotoLab

1979-01-01

Antiprotons emerging at large angles from the production target (hit by an intense 26 GeV proton beam from the PS), were focused into the acceptance of the injection line of the AA by means of a "magnetic horn" (current-sheet lens). Here we see an early protype of the horn's inner conductor, machined from solid aluminium to a thickness of less than 1 mm. The 1st version had to withstand pulses of 150 kA, 15 us long, every 2.4 s. See 8801040 for a later version.

Increased Virulence and Competitive Advantage of a/α Over a/a or α/α Offspring Conserves the Mating System of Candida albicans

Science.gov (United States)

Lockhart, Shawn R.; Wu, Wei; Radke, Joshua B.; Zhao, Rui; Soll, David R.

2005-01-01

The majority of Candida albicans strains in nature are a/α and must undergo homozygosis to a/a or α/α to mate. Here we have used a mouse model for systemic infection to test the hypothesis that a/α strains predominate in nature because they have a competitive advantage over a/a and α/α offspring in colonizing hosts. Single-strain injection experiments revealed that a/α strains were far more virulent than either their a/a or α/α offspring. When equal numbers of parent a/α and offspring a/a or α/α cells were co-injected, a/α always exhibited a competitive advantage at the time of extreme host morbidity or death. When equal numbers of an engineered a/a/α2 strain and its isogenic a/a parent strain were co-injected, the a/a/α2 strain exhibited a competitive advantage at the time of host morbidity or death, suggesting that the genotype of the mating-type (MTL) locus, not associated genes on chromosome 5, provides a competitive advantage. We therefore propose that heterozygosity at the MTL locus not only represses white-opaque switching and genes involved in the mating process, but also affects virulence, providing a competitive advantage to the a/α genotype that conserves the mating system of C. albicans in nature. PMID:15695357

Increased virulence and competitive advantage of a/alpha over a/a or alpha/alpha offspring conserves the mating system of Candida albicans.

Science.gov (United States)

Lockhart, Shawn R; Wu, Wei; Radke, Joshua B; Zhao, Rui; Soll, David R

2005-04-01

The majority of Candida albicans strains in nature are a/alpha and must undergo homozygosis to a/a or alpha/alpha to mate. Here we have used a mouse model for systemic infection to test the hypothesis that a/alpha strains predominate in nature because they have a competitive advantage over a/a and alpha/alpha offspring in colonizing hosts. Single-strain injection experiments revealed that a/alpha strains were far more virulent than either their a/a or alpha/alpha offspring. When equal numbers of parent a/alpha and offspring a/a or alpha/alpha cells were co-injected, a/alpha always exhibited a competitive advantage at the time of extreme host morbidity or death. When equal numbers of an engineered a/a/alpha2 strain and its isogenic a/a parent strain were co-injected, the a/a/alpha2 strain exhibited a competitive advantage at the time of host morbidity or death, suggesting that the genotype of the mating-type (MTL) locus, not associated genes on chromosome 5, provides a competitive advantage. We therefore propose that heterozygosity at the MTL locus not only represses white-opaque switching and genes involved in the mating process, but also affects virulence, providing a competitive advantage to the a/alpha genotype that conserves the mating system of C. albicans in nature.

The 15N-leucine single-injection method allows for determining endogenous losses and true digestibility of amino acids in cecectomized roosters.

Directory of Open Access Journals (Sweden)

Rujiu Hu

Full Text Available This study was conducted to assess the influence of dietary protein content in poultry when using the 15N-leucine single-injection method to determine endogenous amino acid losses (EAALs in poultry. Forty-eight cecectomized roosters (2.39 ± 0.23 kg were randomly allocated to eight dietary treatments containing protein levels of 0, 3%, 6%, 9%, 12%, 15%, 18% and 21%. Each bird was precisely fed an experimental diet of 25 g/kg of body weight. After feeding, all roosters were subcutaneously injected with a 15N-leucine solution at a dose of 20 mg/kg of body weight. Blood was sampled 23 h after the injection, and excreta samples were continuously collected during the course of the 48-h experiment. The ratio of 15N-enrichment of leucine in crude mucin to free leucine in plasma ranged from 0.664 to 0.763 and remained relatively consistent (P > 0.05 across all treatments. The amino acid (AA profiles of total endogenous AAs, except isoleucine, alanine, aspartic acid, cysteine, proline and serine, were not influenced (P > 0.05 by dietary protein contents. The predominant endogenous AAs in the excreta were glutamic acid, aspartic acid, threonine, serine and proline. The order of the relative proportions of these predominant AAs also remained relatively constant (P > 0.05. The endogenous losses of total AAs determined with the 15N-leucine single-injection method increased curvilinearly with the dietary protein contents. The true digestibility of most AAs and total AAs was independent of their respective dietary protein levels. Collectively, the 15N-leucine single-injection method is appropriate for determining EAALs and the true digestibility of AAs in poultry fed varying levels of protein-containing ingredients.

Non-local Fast Extraction from the CERN SPS at 100 and 440 GeV

CERN Document Server

Velotti, F M; Bartmann, W; Carlier, E; Cornelis, K; Efthymiopoulos, I; Goddard, B; Jensen, L K; Kain, V; Kowalska, M; Mertens, V; Steerenberg, R

2013-01-01

The Long Straight Section 2 (LSS2) of the CERN SPS is connected with the North Area (NA), to which the beam to date has always been extracted using a resonant extraction technique. For new proposed short- and long-baseline neutrino experiments, a fast single turn extraction to this experimental area is required. As there are no kickers in LSS2, and the integration of any new kickers with the existing electrostatic septum would be problematic, a solution has been developed to fast extract the beam using non-local extraction with other SPS kickers. Two different kicker systems have been used, the injection kicker in LSS1 and the stronger extraction kicker in LSS6 to extract 100 and 440 GeV beam, respectively. For both solutions a large emittance beam was extracted after 5 or 9 full betatron periods. The concept and simulation details are presented with the analysis of the aperture and beam loss considerations and experimental results collected during a series of beam tests.

Identifying a typology of men who use anabolic androgenic steroids (AAS).

Science.gov (United States)

Zahnow, Renee; McVeigh, Jim; Bates, Geoff; Hope, Vivian; Kean, Joseph; Campbell, John; Smith, Josie

2018-05-01

Despite recognition that the Anabolic Androgenic Steroid (AAS) using population is diverse, empirical studies to develop theories to conceptualise this variance in use have been limited. In this study, using cluster analysis and multinomial logistic regression, we identify typologies of people who use AAS and examine variations in motivations for AAS use across types in a sample of 611 men who use AAS. The cluster analysis identified four groups in the data with different risk profiles. These groups largely reflect the ideal types of people who use AAS proposed by Christiansen et al. (2016): Cluster 1 (You Only Live Once (YOLO) type, n = 68, 11.1%) were younger and motivated by fat loss; Cluster 2 (Well-being type, n = 236, 38.6%) were concerned with getting fit; Cluster 3 (Athlete type, n = 155, 25.4%) were motivated by muscle and strength gains; Cluster 4 (Expert type, n = 152, 24.9%) were focused on specific goals (i.e. not 'getting fit'). The results of this study demonstrate the need to make information about AAS accessible to the general population and to inform health service providers about variations in motivations and associated risk behaviours. Attention should also be given to ensuring existing harm minimisation services are equipped to disseminate information about safe intra-muscular injecting and ensuring needle disposal sites are accessible to the different types. Copyright © 2018 Elsevier B.V. All rights reserved.

Controlled release of bioactive PDGF-AA from a hydrogel/nanoparticle composite.

Science.gov (United States)

Elliott Donaghue, Irja; Shoichet, Molly S

2015-10-01

Polymer excipients, such as low molar mass poly(ethylene glycol) (PEG), have shown contradictory effects on protein stability when co-encapsulated in polymeric nanoparticles. To gain further insight into these effects, platelet-derived growth factor (PDGF-AA) was encapsulated in polymeric nanoparticles with vs. without PEG. PDGF-AA is a particularly compelling protein, as it has been demonstrated to promote cell survival and induce the oligodendrocyte differentiation of neural stem/progenitor cells (NSPCs) both in vitro and in vivo. Here we show, for the first time, the controlled release of bioactive PDGF-AA from an injectable nanoparticle/hydrogel drug delivery system (DDS). PDGF-AA was encapsulated, with high efficiency, in poly(lactide-co-glycolide) nanoparticles, and its release from the drug delivery system was followed over 21 d. Interestingly, the co-encapsulation of low molecular weight poly(ethylene glycol) increased the PDGF-AA loading but, unexpectedly, accelerated the aggregation of PDGF-AA, resulting in reduced activity and detection by enzyme-linked immunosorbent assay (ELISA). In the absence of PEG, released PDGF-AA remained bioactive as demonstrated with NSPC oligodendrocyte differentiation, similar to positive controls, and significantly different from untreated controls. This work presents a novel delivery method for differentiation factors, such as PDGF-AA, and provides insights into the contradictory effects reported in the literature of excipients, such as PEG, on the loading and release of proteins from polymeric nanoparticles. Previously, the polymer poly(ethylene glycol) (PEG) has been used in many biomaterials applications, from surface coatings to the encapsulation of proteins. In this work, we demonstrate that, unexpectedly, low molecular weight PEG has a deleterious effect on the release of the encapsulated protein platelet-derived growth factor AA (PDGF-AA). We also demonstrate release of bioactive PDGF-AA (in the absence of PEG

Simulations of Merging Helion Bunches on the AGS Injection Porch

Energy Technology Data Exchange (ETDEWEB)

Gardner, C. J. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.

2014-08-29

During the setup of helions for the FY2014 RHIC run it was discovered that the standard scheme for merging bunches on the AGS injection porch required an injection kicker pulse shorter than what was available. To overcome this difficulty, K. Zeno proposed and developed an interesting and unusual alternative which uses RF harmonic numbers 12, 4, 2 (rather than the standard 8, 4, 2) to merge 8 helion bunches into 2. In this note we carry out simulations that illustrate how the alternative scheme works and how it compares with the standard scheme. This is done in Sections 13 and 14. A scheme in which 6 bunches are merged into 1 is simulated in Section 15. This may be useful if more helions per merged bunch are needed in future runs. General formulae for the simulations are given in Sections 9 through 12. For completeness, Sections 1 through 8 give a derivation of the turn-by-turn equations of longitudinal motion at constant magnetic field. The derivation is based on the work of MacLachlan. The reader may wish to skip over these Sections and start with Section 9.

Simulations of Merging Helion Bunches on the AGS Injection Porch

International Nuclear Information System (INIS)

Gardner, C. J.

2014-01-01

During the setup of helions for the FY2014 RHIC run it was discovered that the standard scheme for merging bunches on the AGS injection porch required an injection kicker pulse shorter than what was available. To overcome this difficulty, K. Zeno proposed and developed an interesting and unusual alternative which uses RF harmonic numbers 12, 4, 2 (rather than the standard 8, 4, 2) to merge 8 helion bunches into 2. In this note we carry out simulations that illustrate how the alternative scheme works and how it compares with the standard scheme. This is done in Sections 13 and 14. A scheme in which 6 bunches are merged into 1 is simulated in Section 15. This may be useful if more helions per merged bunch are needed in future runs. General formulae for the simulations are given in Sections 9 through 12. For completeness, Sections 1 through 8 give a derivation of the turn-by-turn equations of longitudinal motion at constant magnetic field. The derivation is based on the work of MacLachlan. The reader may wish to skip over these Sections and start with Section 9.

Aa Ah Nak

Science.gov (United States)

Tha, Na Gya; Wus, Thay

2017-01-01

In this article, Aa Ah Nak, the authors' methodology presents not only various reflections but also diverse contradictions about the Aa Nii language as well as language revitalization. This article explores language foundation and how the Aa Nii language revitalization is inextricably linked to the genocide and resulting historic trauma pervasive…

Reduction of outgas from the components of the J-PARC kicker magnet

International Nuclear Information System (INIS)

Kamiya, Junichiro; Ogiwara, Norio; Kinsho, Michikazu; Takayanagi, Tomohiro

2005-01-01

The extraction kickers in Rapid Cycling Synchrotron (RCS) of Japan Proton Accelerator Research Complex (J-PARC) are installed in the vacuum chamber against electrical discharge. Therefore, outgas from the components have large effects on the vacuum system of the accelerator. We have succeeded in reducing the outgas from the components, which are made of ferrite core and aluminum alloy, by baking them before construction of the magnet. The ferrite cores were baked at 200degC in the vacuum about 300 hours, while the components made of aluminum alloy at 150degC about 70 hours. Main outgas from both materials was known to be water by mass spectroscopy, and the pressure after baking has been decreased by two or three order of magnitude. We also report the reduction method for outgas while the magnet is stored in. (author)

Experimental immunologically mediated aplastic anemia (AA) in H-2k identical, Mls (M) locus different mice

Energy Technology Data Exchange (ETDEWEB)

Knospe, W.H.; Steinberg, D.; Speck, B.

1983-07-01

Immunologically mediated aplastic anemia (AA) was experimentally induced in mice by injecting 10(7) lymph node cells (LNC) from donor mice of one inbred strain to another H-2k identical but Mls mismatched strain previously given 600 rad total body gamma irradiation (TBI). AA developed after 2 weeks to 6 months in selected strain combinations used and usually 60 to 90% of the mice died. Clinical signs of graft-versus-host disease did not occur and splenic atrophy rather than splenomegaly was the rule. Histologically these mice had a lesion of the hematopoietic microenvironment characterized by sinusoidal injury and stromal necrosis. Others have demonstrated injury to hematopoietic stem cells. C3H/He LNC induced AA whereas C3H/HeJ LNC failed to induce AA. The C3H/HeJ strain carries a macrophage defect and these results suggest that a macrophage-like cell may be a mediator of immunological injury in this experimental model. Although all strain combinations evaluated were H-2k identical and Mls mismatched, certain Mls combinations resulted in AA and identical Mls mismatched but different strains did not. Both strong (Mlsd) and weak (Mlsc) stimulating LNC induce AA but simple Mls differences do not explain the AA as similar Mls combinations but different strain combinations fail to induce AA.

A Novel Tenebrio molitor Cadherin Is a Functional Receptor for Bacillus thuringiensis Cry3Aa Toxin*

Science.gov (United States)

Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D.; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis

2009-01-01

Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepidopteran cadherin B. thuringiensis receptors. A peptide containing the putative toxin binding region from TmCad1 bound specifically to Cry3Aa and promoted the formation of Cry3Aa toxin oligomers, proposed to be mediators of toxicity in lepidopterans. Injection of TmCad1-specific double-stranded RNA into T. molitor larvae resulted in knockdown of the TmCad1 transcript and conferred resistance to Cry3Aa toxicity. These data demonstrate the functional role of TmCad1 as a Cry3Aa receptor in T. molitor and reveal similarities between the mode of action of Cry toxins in Lepidoptera and Coleoptera. PMID:19416969

Pulse Power Modulator development for the CLIC Damping Ring Kickers

CERN Document Server

Holma, Janne

2012-01-01

The Compact Linear Collider (CLIC) study is exploring the scheme for an electron-positron collider with high luminosity (10-34 – 10-35 cm-2s-1) and a nominal centre-of-mass energy of 3 TeV: CLIC would complement LHC physics in the multi-TeV range. The CLIC design relies on Pre-Damping Rings (PDR) and Damping Rings (DR) to achieve the very low emittance, through synchrotron radiation, needed for the luminosity requirements of CLIC. To limit the beam emittance blow-up due to oscillations, the pulse power modulators for the DR kickers must provide extremely flat, high-voltage pulses: the 2 GHz specification called for a 160 ns duration flat-top of 12.5 kV, 250 A, with a combined ripple and droop of not more than ±0.02 %. In order to meet these demanding specifications, a combination of broadband impedance matching, optimized electrical circuit layout and advanced control techniques is required. A solid-state modulator, the inductive adder, is the most promising approach to meeting the demanding specifications...

Rapid Quantitation of Ascorbic and Folic Acids in SRM 3280 Multivitamin/Multielement Tablets using Flow-Injection Tandem Mass Spectrometry

Energy Technology Data Exchange (ETDEWEB)

Bhandari, Deepak [ORNL; Kertesz, Vilmos [ORNL; Van Berkel, Gary J [ORNL

2013-01-01

RATIONALE: Ascorbic acid (AA) and folic acid (FA) are water-soluble vitamins and are usually fortified in food and dietary supplements. For the safety of human health, proper intake of these vitamins is recommended. Improvement in the analysis time required for the quantitative determination of these vitamins in food and nutritional formulations is desired. METHODS: A simple and fast (~5 min) in-tube sample preparation was performed, independently for FA and AA, by mixing extraction solvent with a powdered sample aliquot followed by agitation, centrifugation, and filtration to recover an extract for analysis. Quantitative detection was achieved by flow-injection (1 L injection volume) electrospray ionization tandem mass spectrometry (ESI-MS/MS) in negative ion mode using the method of standard addition. RESULTS: Method of standard addition was employed for the quantitative estimation of each vitamin in a sample extract. At least 2 spiked and 1 non-spiked sample extract were injected in triplicate for each quantitative analysis. Given an injection-to-injection interval of approximately 2 min, about 18 min was required to complete the quantitative estimation of each vitamin. The concentration values obtained for the respective vitamins in the standard reference material (SRM) 3280 using this approach were within the statistical range of the certified values provided in the NIST Certificate of Analysis. The estimated limit of detections of FA and AA were 13 and 5.9 ng/g, respectively. CONCLUSIONS: Flow-injection ESI-MS/MS was successfully applied for the rapid quantitation of FA and AA in SRM 3280 multivitamin/multielement tablets.

A Computer Program to Measure the Energy Spread of Multi-turn Beam in the Fermilab Booster at Injection

Science.gov (United States)

Nelson, Jovan; Bhat, Chandrashekhara; Hendricks, Brian

2016-03-01

We have developed a computer program interfaced with the ACNET environment for Fermilab accelerators in order to measure the energy spread of the injected proton beam from the LINAC, at the energy of 400 MeV. This program allows the user to configure a digitizing oscilloscope and timing devices to optimize data acquisition from a resistive wall current monitor. When the program is launched, it secures control of the oscilloscope and then generates a ``one-shot'' timeline which initiates injection into the Booster. Once this is complete, a kicker is set to create a notch in the beam and the line charge distribution data is collected by the oscilloscope. The program then analyzes this data in order to obtain notch width, beam revolution period, and beam energy spread. This allows the program to be a possible useful diagnostic tool for the beginning of the acceleration cycle for the proton beam. Thank you to the SIST program at Fermilab.

Constitutive behavior of as-cast AA1050, AA3104, and AA5182

Science.gov (United States)

van Haaften, W. M.; Magnin, B.; Kool, W. H.; Katgerman, L.

2002-07-01

Recent thermomechanical modeling to calculate the stress field in industrially direct-chill (DC) cast-aluminum slabs has been successful, but lack of material data limits the accuracy of these calculations. Therefore, the constitutive behavior of three aluminum alloys (AA1050, AA3104, and AA5182) was determined in the as-cast condition using tensile tests at low strain rates and from room temperature to solidus temperature. The parameters of two constitutive equations, the extended Ludwik equation and a combination of the Sellars-Tegart equation with a hardening law, were determined. In order to study the effect of recovery, the constitutive behavior after prestraining at higher temperatures was also investigated. To evaluate the quantified constitutive equations, tensile tests were performed simulating the deformation and cooling history experienced by the material during casting. It is concluded that both constitutive equations perform well, but the combined hardening-Sellars-Tegart (HST) equation has temperature-independent parameters, which makes it easier to implement in a DC casting model. Further, the deformation history of the ingot should be taken into account for accurate stress calculations.

An Injectable Composite Gelatin Hydrogel with pH Response Properties

Directory of Open Access Journals (Sweden)

Baoguo Chen

2017-01-01

Full Text Available On account of minimally invasive procedure and of filling irregular defects of tissues, injectable hydrogels are increasingly attractive in biomedical fields. However, traditional hydrogel formed by simple physical interaction or in situ crosslinking had inevitably some drawbacks such as low mechanical strength and lack of multifunctional properties. Though many investigations had successfully modified traditional injectable hydrogel to obtain both mechanical and functional properties, an acetalated β-cyclodextrin (Ac-β-CD nanoparticle composite injectable hydrogel designed in the research was another effective and efficient choice to solve the drawbacks. First of all, gelatin derivative (G-AA and Ac-β-CD were synthesized to prepare hydrogel and nanoparticle, respectively. In order to ensure good compatibility between nanoparticle and macromonomer and provide crosslink points between nanoparticle and macromonomer, G-AA was simultaneously functionalized onto the surface of Ac-β-CD nanoparticle during the fabrication of Ac-β-CD nanoparticle using one-step method. Finally, injectable composite hydrogel was obtained by photoinitiated polymerization in situ. Hydrogel properties like gelation time and swelling ratio were investigated. The viscoelastic behavior of hydrogels confirmed that typical characteristics of crosslinked elastomer for all hydrogel and nanoparticle in hydrogel could improve the mechanical property of hydrogel. Moreover, the transparency with time had verified obvious acid-response properties of hydrogels.

The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

Energy Technology Data Exchange (ETDEWEB)

Kubota, Akira [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Bainy, Afonso C.D. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Departamento de Bioquímica, CCB, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Woodin, Bruce R.; Goldstone, Jared V. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States)

2013-10-01

The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

International Nuclear Information System (INIS)

Kubota, Akira; Bainy, Afonso C.D.; Woodin, Bruce R.; Goldstone, Jared V.; Stegeman, John J.

2013-01-01

The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

Experiments on the margin of beam induced quenches a superconducting quadrupole magnet in the LHC

CERN Document Server

Bracco, C; Bednarek, M J; Nebot Del Busto, E; Goddard, B; Holzer, E B; Nordt, A; Sapinski, M; Schmidt, R; Solfaroli Camillocci, M; Zerlauth, M

2012-01-01

Protection of LHC equipment relies on a complex system of collimators to capture injected and circulating beam in case of LHC kicker magnet failures. However, for specific failures of the injection kickers, the beam can graze the injection protection collimators and induce quenches of downstream superconducting magnets. This occurred twice during 2011 operation and cannot be excluded during future operation. Tests were performed during Machine Development periods of the LHC to assess the quench margin of the quadrupole located just downstream of the last injection protection collimator in point 8. In addition to the existing Quench Protection System, a special monitoring instrumentation was installed at this magnet to detect any resistance increase below the quench limit. The correlation between the magnet and Beam Loss Monitor signals was analysed for different beam intensities and magnet currents. The results of the experiments are presented.

Abort kicker power supply systems at Fermilab

International Nuclear Information System (INIS)

Krafczyk, G.; Dugan, G.; Harrison, M.; Koepke, K.; Tilles, E.

1985-06-01

Over the past several years, Fermilab has been operating with a single turn proton abort system in both the superconducting Tevatron and the conventional Main Ring. The abort kicker power supply for this system discharges a lumped capacitance into the inductive magnet load, causing the beam to enter the abort channel. The characteristics of this current waveform are defined by the requirements of the machine operation. The standard fixed target running mode calls for 12 booster batches of beam which leaves a rotating gap in the beams of approx.1.8 μs. The current waveform is required to rise to 90% of I/sub max/ in this time to avoid beam loss from partially deflected beam. Aperture limitations in both the accelerator and the abort channel demand that the current in the magnets stays above this 90% I/sub max/ for the 21 μs needed to ensure all the beam has left the machine. The 25 mm displacement needed to cleanly enter the abort channel at 1 TeV corresponds to a maximum current in each of the 4 modules of approx.20 kA. Similar constraints are needed for the Main Ring and Tevatron antiproton abort systems. A unique feature of this design is the high voltage, high current diode assembly used to clip the recharge of the capacitor bank. This allows the current to decay slowly with the L/R time constant of the magnet and diode series combination. Special attention is given to the diode characteristics needed for this passive switching element. Operational experience and proposed upgrades are given for the two operational systems. 2 refs., 4 figs., 1 tab

Abort kicker power supply systems at Fermilab

International Nuclear Information System (INIS)

Krafczyk, G.; Dugan, G.; Harrison, M.; Koepke, K.; Tilles, E.

1985-01-01

Over the past several years, Fermilab has been operating with a single turn proton abort system in both the superconducting Tevatron and the conventional Main Ring. The abort kicker power supply for this system discharges a lumped capacitance into the inductive magnet load, causing the beam to enter the abort channel. The characteristics of this current waveform are defined by the requirements of the machine operation. The standard fixed target running mode calls for 12 booster batches of beam which leaves a rotating gap in the beam of about1.8 μs. The current waveform is required to rise to 90% of I /SUB max/ in this time to avoid beam loss from partially deflected beam. Aperture limitations in both the accelerator and the abort channel demand that the current in the magnets stays above this 90% I for the 21 μs needed to ensure all the beam has /SUP max/ left the machine. The 25 mm displacement needed to cleanly enter the abort channel at 1 TeV corresponds to a maximum current in each of the 4 modules of about20 kA. Similar constraints are needed for the Main Ring and Tevatron antiproton abort systems. A unique feature of this design is the high voltage, high current diode assembly used to clip the recharge of the capacitor bank. This allows the current to decay slowly with the L/R time constant of the magnet and diode series combination. Special attention will be given to the diode characteristics needed for this passive switching element. Operational experience and proposed upgrades will be given for the two operational systems

A.A., constructivism, and reflecting teams.

Science.gov (United States)

Nevels, B

1997-12-01

Numerous studies and clinical anecdotes reveal a relationship between attendance at A.A. meetings and/or degree of involvement in A.A. and maintenance of sobriety. Hypotheses as to how A.A. and/or the A.A. meeting is helpful to its members have ranged from a focus on factors common to all therapy groups, to aspects of A.A. "treatment" which are behavioral in nature. Presented here is another way of understanding A.A.'s effectiveness within the frame of more recent, constructivistic approaches to family therapy. In particular, the A.A. topic meeting is compared to the reflecting team concept of Tom Anderson.

A mathematical model of a three-gap thyratron simulating turn-on

International Nuclear Information System (INIS)

Barnes, M. J.; Wait, G.D.

1993-06-01

Kicker magnets are required for all ring-to-ring transfers in the 5 rings of the proposed KAON factory synchrotron. The kick must rise/fall from 1% to 99% of full strength during the time interval of gaps created in the beam (80 ns to 160 ns) so that the beam can be extracted with minimum losses. Approximately one-third of the injection and extraction kicker magnets will operate continuously at a rate of 50 pulses per second: the others operate at 10 pulses per second. The kicker magnet PFN voltages will be in the range 50kV to 80kV, hence multi-gap thyratrons will be used for the injection and extraction kicker systems. Displacement current arising from turn-on of a multi-gap thyratron flows in the external circuit and can thus increase the effective rise-time of the kick. A mathematical model of a three-gap thyratron, which includes the drift spaces, has been developed for simulating turn-on, and is described in this paper. The thyratron model has been used to investigate ways to suppress the effects of displacement current on the kick, and to reduce thyratron switching loss. A ferrite saturating inductor may be connected adjacent to each thyratron to reduce switching loss, so that thyratron life can be extended and the kick rise-time improved. This inductor can also be used to reduce the effect of anode displacement current during turn-on of a multi-gap thyratron. The research has culminated in a predicted kick rise time (1% to 99%) of less than 50 ns for a TRIUMF 10 cell prototype kicker magnet. The proposed improvements are currently being implemented on our prototype kicker system. (author). 15 refs., 11 figs

Detection of AA76, a Common Form of Amyloid A Protein, as a Way of Diagnosing AA Amyloidosis.

Science.gov (United States)

Sato, Junji; Okuda, Yasuaki; Kuroda, Takeshi; Yamada, Toshiyuki

2016-01-01

Reactive amyloid deposits consist of amyloid A (AA) proteins, the degradation products of serum amyloid A (SAA). Since the most common species of AA is the amino terminal portion produced by cleavage between residues 76 and 77 of SAA (AA76), the presence of AA76 in tissues could be a consequence of AA amyloid deposition. This study assessed the diagnostic significance of the detection of AA76 for AA amyloidosis using two different approaches. Biopsy specimens (n=130 from 54 subjects) from gastroduodenal mucosa or abdominal fat (n=9 from 9 subjects) of patients who had already been diagnosed with or were suspected of having AA amyloidosis were used. Fixed mucosal sections were subjected to immunohistochemistry using a newly developed antibody recognizing the carboxyl terminal end of AA76 (anti-AA76). The non-fixed materials from gastroduodenal mucosa or abdominal fat were subjected to immunoblotting for detection of the size of AA76. Among the gastroduodenal specimens (n=115) from already diagnosed patients, the positive rates of Congo red staining, immunohistochemistry using anti-AA76, and immunoblotting were 68.4%, 73.0%, and 92.2%, respectively. The anti-AA76 did not stain the supposed SAA in the blood or leakage, which was stained by anti-SAA antibody. AA76 was not detected either by immunohistochemistry or by immunoblot in the materials from patients in whom AA amyloidosis had been ruled out. In the abdominal fat, the immunoblot detected AA76 in 8 materials from 8 already diagnosed patients and did not in 1 patient whose gastroduodenal mucosa was negative. In conclusion, the detection of AA76 may alter the ability to diagnose AA amyloidosis. In immunohistochemistry for fixed specimens, the new anti-AA76 antibody can improve the specificity. Immunoblot for non-fixed materials, which can considerably improve the sensitivity, should be beneficial for small materials like abdominal fat. © 2016 by the Association of Clinical Scientists, Inc.

Development of continuous cooling precipitation diagrams for aluminium alloys AA7150 and AA7020

Energy Technology Data Exchange (ETDEWEB)

Zhang, Y., E-mail: yong.zhang@outlook.com [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia); Milkereit, B. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Kessler, O. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); Schick, C. [University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Rometsch, P.A. [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia)

2014-01-25

Highlights: • The DSC method was used for developing continuous cooling precipitation diagrams. • The quench-induced particles were observed by SEM for alloys AA7150 and AA7020. • There were more quench-induced particles in alloy AA7150. • Quench sensitivity of Al alloys can be evaluated by using the CCP diagrams. -- Abstract: Two commercial 7xxx series aluminium alloys with different solute contents and different quench-induced precipitation behaviour have been investigated by using a specialised differential scanning calorimetry (DSC) technique to record exothermal heat outputs during continuous cooling. Together with hardness testing and microstructural analysis, this DSC method was used to develop continuous cooling precipitation (CCP) diagrams for alloys AA7150 and AA7020. The results show that the total precipitation heat for each alloy decreases with increasing cooling rate. However, the excess specific heat at a given cooling rate in alloy AA7150 is much higher than that in alloy AA7020. It is evident that there are atleast three different quench-induced reactions in different temperature regimes for alloy AA7150 cooled at various linear cooling rates, but only equilibrium MgZn{sub 2} (η-phase) and Al{sub 2}CuMg (S-phase) particles were observed by scanning electron microscopy (SEM). There are at least two main precipitation peaks that can be found for alloy AA7020, which correspond to Mg{sub 2}Si and MgZn{sub 2} (η-phase). Furthermore, a method is developed to evaluate the quench sensitivity of an alloy based on a determination of the critical cooling rate. The maximum hardness values are reached at cooling rates that are faster than or similar to the critical cooling rate.

Control of the MKQA tuning and aperture kickers of the LHC

CERN Document Server

Barlow, R A; Pianfetti, J P; Senaj, V; Cattin, M; CERN. Geneva. TE Department

2009-01-01

The large hadron collider (LHC) at CERN has been equipped with four fast pulsed kicker magnets in RA43 situated at point 4 which are part of the measurement system for the tune and the dynamic aperture of the LHC beam (Beam 1 and Beam 2). For the tune measurement 'Q', the magnets will excite oscillations in part of the beam. This is achieved by means of a generator producing a 5 µs base half-sine pulse of 1.2 kA [1] amplitude, superimposed with a 3rd harmonic to produce a 2 µs flat top. A kick repetition rate of 2 Hz will be possible. To measure the dynamic aperture 'A' of the LHC at different beam energies, the same magnets will also be driven by a more powerful generator which produces a 43 µs base half-sine current pulse of 3.8 kA. For the 'A' mode a thyristor is used as switching element inside the generator. A final third mode named 'AC dipole' will rely on the beam being excited coherently at a frequency close but outside its Eigen-frequencies by an oscillating dipole field. The beam is expected to o...

Determination of arsenic species in human urine using HPLC with on-line photooxidation or microwave-assisted oxidation combined with flow-injection HG-AAS

Energy Technology Data Exchange (ETDEWEB)

Sur, R.; Begerow, J.; Dunemann, L. [Department of Analytical Chemistry, Medizinisches Institut fuer Umwelthygiene, Duesseldorf (Germany)

1999-03-01

An improved analytical procedure is presented for the separation and simultaneous determination of hydride-forming (toxic) and not hydride-forming (non-toxic) arsenic species in human urine. Separation was performed by cation-exchange chromatography using a new solid phase type based on the continuous bed chromatography (CBC) technology. This column permits by a factor of 4 higher flow rates than conventional columns resulting in a drastical reduction of retention times without any loss of resolution. Using this type of column, arsenobetaine (AsBet), arsenocholine (AsChol), and dimethylarsinic acid (DMA) were separated from the more toxic arsenic species arsenous acid (As(III)), arsenic acid (As(V)), and methylarsonic acid (MA) within only 4 min. The HPLC system was coupled via a flow injection system and either a UV or a microwave (MW) reactor to the HG-AAS instrument. UV photolysis and MW digestion were used to transform AsBet and AsChol to hydride-forming species and to make them accessible to HG-AAS. UV photolysis turned out to be more suitable for this application than MW digestion, because the latter technique led to peak broadening and poorer performance. The described procedure was applied to the determination of arsenic species in urine samples of non-occupationally exposed persons before and 12 h after seafood consumption. Detection limits were about 1 {mu}g/L for each arsenic species. After consumption, the AsBet and DMA excretion increased by at least a factor of 150 for AsBet and by a factor of 6 for DMA, respectively, while the excretion of the other species did not increase significantly. This invalidates the use of total urinary arsenic as well as total hydride-forming arsenic as an indicator for exposure to inorganic arsenic. (orig.) With 4 figs., 2 tabs., 13 refs.

Transverse Impedance Model of the CERN-PSB

OpenAIRE

Zannini, Carlo; Iadarola, Giovanni; Jones, Bryan; Li, Kevin; Rijoff, Tatiana; Rumolo, Giovanni

2015-01-01

In the framework of the PS-Booster upgrade project an accurate impedance model is needed in order to determine the effect on the beam stability and assess the impact of the new devices before installation in the machine. This paper describes the PSB impedance model which includes resistive wall, indirect space charge, flanges, step transitions, ejection kicker including cables, injection kickers and cavities. Each impedance contribution has been computed for different energies in the PSB cycl...

High power semiconductor switches in the 12 kV, 50 kA pulse generator of the SPS beam dump kicker system

CERN Document Server

Bonthond, J; Faure, P; Vossenberg, Eugène B

2001-01-01

Horizontal deflection of the beam in the dump kicker system of the CERN SPS accelerator is obtained with a series of fast pulsed magnets. The high current pulses of 50 kA per magnet are generated with capacitor discharge type generators which, combined with a resistive free-wheel diode circuit, deliver a critically damped half-sine current with a rise-time of 25 ms. Each generator consists of two 25 kA units, connected in parallel to a magnet via a low inductance transmission line.

[Risk control of traditional Chinese medicines containing aristolochis acids (AAs) based on influencing factors of content of AAs].

Science.gov (United States)

Tian, Jing-Zhuo; Liang, Ai-Hua; Liu, Jing; Zhang, Bo-Li

2017-12-01

Aristolochic acids (AAs) widely exist in such plants as Aristolochia and Asarum. The renal toxicity of AAs as well as its carcinogenicity to urinary system have been widely known. In 2003 and 2004, China prohibited the use of Aristolochiae Radix, Aristolochiae Manshuriensis Caulis and Aristolochiae Fangchi Radix, and required administering other AAs-containing medicines in accordance with the regulations for prescription drugs. In this paper, we retrieved literatures on the content determination of AAs in recent 10 years in China. It suggested that the AAs content is lower in Asarum herb, especially in its roots and rhizomes, and most of which do not show detectable amount of AA-I. Some of traditional Chinese medicines show fairly small amount of detectable AA-I. The AAs content in Aristolochia herb (including Fructus Aristolochiae, kaempfer dutchmanspipe root) is relatively high; however, there are fewer literatures for studying the content determination of AAs in Chinese patent medicines. There were many factors affecting AAs content, including the parts used, origins, processing methods, extraction process. It suggested that we should pay attention to the toxicity of Chinese medicines containing AAs and use these decoction pieces and traditional Chinese medicines cautiously. In addition, basic studies for the origins, processing methods and extraction process of Chinese patent medicines containing AAs, as well as supervision and detection of AAs content in traditional Chinese medicinal materials, decoction pieces and Chinese patent medicines shall be strengthened for reducing medication risk and guaranteeing clinical medication safety. Copyright© by the Chinese Pharmaceutical Association.

The ELETTRA fast magnets

International Nuclear Information System (INIS)

Tommasini, D.

1992-01-01

The design of the fast magnets to be used to inject the electron beam into the 2 GeV storage ring Elettra is presented and discussed. Injection makes use of two types of fast magnets: the septa and the kickers. There are two identical septa magnets of the so called 'eddy current' type, which will be housed in a vacuum tank. The orbit bump is generated by four identical kicker magnets symmetrically placed around the mid-point of a single straight section: they will be in air with an internal vacuum chamber. Extensive electric and magnetic tests have been performed on prototypes, and the relevant results are presented and discussed. (author) 6 refs.; 6 figs.; 2 tabs

Laboratory Astrophysics Division of The AAS (LAD)

Science.gov (United States)

Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

2012-10-01

The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

Laboratory Astrophysics Division of the AAS (LAD)

Science.gov (United States)

Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

2012-01-01

The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

Simulation, measurement, and mitigation of beam instability caused by the kicker impedance in the 3-GeV rapid cycling synchrotron at the Japan Proton Accelerator Research Complex

Science.gov (United States)

Saha, P. K.; Shobuda, Y.; Hotchi, H.; Harada, H.; Hayashi, N.; Kinsho, M.; Tamura, F.; Tani, N.; Yamamoto, M.; Watanabe, Y.; Chin, Yong Ho; Holmes, J. A.

2018-02-01

The transverse impedance of eight extraction pulsed kicker magnets is a strong beam instability source in the 3-GeV rapid cycling synchrotron (RCS) at the Japan Proton Accelerator Research Complex. Significant beam instability occurs even at half of the designed 1 MW beam power when the chromaticity (ξ ) is fully corrected for the entire acceleration cycle by using ac sextupole (SX) fields. However, if ξ is fully corrected only at the injection energy by using dc SX fields, the beam is stable. In order to study realistic beam instability scenarios, including the effect of space charge and to determine practical measures to accomplish 1 MW beam power, we enhance the orbit particle tracking code to incorporate all realistic time-dependent machine parameters, including the time dependence of the impedance itself. The beam stability properties beyond 0.5 MW beam power are found to be very sensitive to a number of parameters in both simulations and measurements. In order to stabilize a beam at 1 MW beam power, two practical measures based on detailed and systematic simulation studies are determined, namely, (i) proper manipulation of the betatron tunes during acceleration and (ii) reduction of the dc SX field to reduce the ξ correction even at injection. The simulation results are well reproduced by measurements, and, as a consequence, an acceleration to 1 MW beam power is successfully demonstrated. In this paper, details of the orbit simulation and the corresponding experimental results up to 1 MW of beam power are presented. To further increase the RCS beam power, beam stability issues and possible measures beyond 1 MW beam power are also considered.

NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-04-0001 gb|AAS74960.1| 5-HT2 [Drosophila melanogaster] gb|AAS74962.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74964.1| 5-HT2 [Drosophila melanogaster] gb|AAS74966.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74970.1| 5-HT2 [Drosophila melanogaster] gb|AAS74972.1| 5-HT2 [Drosophila melanogaster]... gb|AAS74976.1| 5-HT2 [Drosophila melanogaster] gb|AAS74978.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74979.1| 5-HT2 [Drosophila melanogaster] gb|AAS74980.1| 5-HT2 [Drosophila melanogaster

NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-156 96% ...

NCBI nr-aa BLAST: CBRC-DMEL-04-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-165 100% ...

AA, radiation shielding curtain along the target area

CERN Multimedia

CERN PhotoLab

1980-01-01

At the far left is the beam tube for the high-intensity proton beam from the 26 GeV PS. The tube ends in a thin window and the proton beam continues in air through a hole in the shielding blocks (see also 8010308), behind which the target (see 7905091, 7905094)was located. After the target followed the magnetic horn, focusing the antiprotons, and the first part of the injection line with a proton dump. The antiprotons, deflected by a magnet, left the target area through another shielding wall, to make their way to the AA ring. Laterally, this sequence of components was shielded with movable, suspended, concrete blocks: the "curtain". Balasz Szeless, who had constructed it, is standing at its side.

Conceptual Design of the LHC Beam Dumping Protection Elements TCDS and TCDQ

CERN Document Server

Goddard, B; Sans-Merce, M; Weterings, W

2004-01-01

The Beam Dumping System for the Large Hadron Collider, presently under construction at CERN, consists, per ring, of a set of horizontally deflecting extraction kicker magnets, vertically deflecting steel septa, dilution kickers and finally, a couple of hundred metres further downstream, an absorber block. A fixed diluter (TCDS) will protect the septa in the event of a beam dump that is not synchronised with the particle free gap or a spontaneous firing of the extraction kickers which will cause the beam to sweep over the septum. Another, mobile, diluter block (TCDQ) will protect the superconducting quadrupole immediate downstream of the extraction as well as the arc at injection energy and the triplet aperture at top energy from bunches with small impact parameters. This paper describes the conceptual design of the protection elements.

NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-02-0049 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0053 gb|AAS74380.1| 5-HT1B [Drosophila melanogaster] gb|AAS74382.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74389.1| 5-HT1B [Drosophila melanogaster] gb|AAS74402.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74403.1| 5-HT1B [Drosophila melanogaster] gb|AAS74405.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74406.1| 5-HT1B [Drosophila melanogaster] gb|AAS74411.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74412.1| 5-HT1B [Drosophila melanogaster] gb|AAS74413.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-02-0049 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0053 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0056 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0057 gb|AAS74185.1| 5-HT1A [Drosophila melanogaster] gb|AAS74209.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74210.1| 5-HT1A [Drosophila melanogaster] gb|AAS74211.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74224.1| 5-HT1A [Drosophila melanogaster] gb|AAS74234.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74254.1| 5-HT1A [Drosophila melanogaster] gb|AAS74258.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74262.1| 5-HT1A [Drosophila melanogaster] gb|AAS74278.1| 5-HT1A [Drosophila mela

NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0056 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

AA magnet measurement team

CERN Multimedia

CERN PhotoLab

1978-01-01

Quickly improvised measurement equipment for the AA (Antiproton Accumulator) was all the tight schedule permitted, but the high motivation of the team made up for the lack of convenience. From left to right: Roy Billinge (Joint AA Project Leader, the other one was Simon van der Meer); Bruno Autin, Brian Pincott, Colin Johnson.

A descriptive study of step alignment and foot positioning relative to the tee by professional rugby union goal-kickers.

Science.gov (United States)

Cockcroft, John; Van Den Heever, Dawie

2016-01-01

This study describes foot positioning during the final two steps of the approach to the ball amongst professional rugby goal-kickers. A 3D optical motion capture system was used to test 15 goal-kickers performing 10 goal-kicks. The distance and direction of each step, as well as individual foot contact positions relative to the tee, were measured. The intra- and inter-subject variability was calculated as well as the correlation (Pearson) between the measurements and participant anthropometrics. Inter-subject variability for the final foot position was lowest (placed 0.03 ± 0.07 m behind and 0.33 ± 0.03 m lateral to the tee) and highest for the penultimate step distance (0.666 ± 0.149 m), performed at an angle of 36.1 ± 8.5° external to the final step. The final step length was 1.523 ± 0.124 m, executed at an external angle of 35.5 ± 7.4° to the target line. The intra-subject variability was very low; distances and angles for the 10 kicks varied per participant by 1.6-3.1 cm and 0.7-1.6°, respectively. The results show that even though the participants had variability in their run-up to the tee, final foot position next to the tee was very similar and consistent. Furthermore, the inter- and intra-subject variability could not be attributed to differences in anthropometry. These findings may be useful as normative reference data for coaching, although further work is required to understand the role of other factors such as approach speed and body alignment.

NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0057 gb|AAS74195.1| 5-HT1A [Drosophila melanogaster] gb|AAS74276.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74292.1| 5-HT1A [Drosophila melanogaster] gb|AAS74298.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74303.1| 5-HT1A [Drosophila melanogaster] gb|AAS74304.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74321.1| 5-HT1A [Drosophila melanogaster] gb|AAS74359.1| 5-HT1A [Drosophila melanogaster] AAS74195.1 1e-176 97% ...

40 CFR Appendix A to Subpart Aa of... - Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA

Science.gov (United States)

2010-07-01

... (40 CFR Part 63, Subpart A) to Subpart AA A Appendix A to Subpart AA of Part 63 Protection of... Hazardous Air Pollutants From Phosphoric Acid Manufacturing Plants Pt. 63, Subpt. AA, App. A Appendix A to Subpart AA of Part 63—Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA 40 CFR...

Effect of supplementation of arachidonic acid (AA) or a combination of AA plus docosahexaenoic acid on breastmilk fatty acid composition

NARCIS (Netherlands)

Smit, EN; Koopmann, M; Boersma, ER; Muskiet, FAJ

We investigated whether supplementation with arachidonic acid (20:4 omega 6; AA), ora combination of AA and docosahexaenoic acid (22:6 omega 3; DHA) would affect human milk polyunsaturated fatty acid (PUFA) composition. Ten women were daily supplemented with 300 mg AA, eight with 300 mg AA, 110 mg

Activity of vegetative insecticidal proteins Vip3Aa58 and Vip3Aa59 of Bacillus thuringiensis against lepidopteran pests.

Science.gov (United States)

Baranek, Jakub; Kaznowski, Adam; Konecka, Edyta; Naimov, Samir

2015-09-01

Vegetative insecticidal proteins (Vips) secreted by some isolates of Bacillus thuringiensis show activity against insects and are regarded as insecticides against pests. A number of B. thuringiensis strains harbouring vip3A genes were isolated from different sources and identified by using a PCR based approach. The isolates with the highest insecticidal activity were indicated in screening tests, and their vip genes were cloned and sequenced. The analysis revealed two polymorphic Vip protein forms, which were classified as Vip3Aa58 and Vip3Aa59. After expression of the vip genes, the proteins were isolated and characterized. The activity of both toxins was estimated against economically important lepidopteran pests of woodlands (Dendrolimus pini), orchards (Cydia pomonella) and field crops (Spodoptera exigua). Vip3Aa58 and Vip3Aa59 were highly toxic and their potency surpassed those of many Cry proteins used in commercial bioinsecticides. Vip3Aa59 revealed similar larvicidal activity as Vip3Aa58 against S. exigua and C. pomonella. Despite 98% similarity of amino acid sequences of both proteins, Vip3Aa59 was significantly more active against D. pini. Additionally the effect of proteolytic activation of Vip58Aa and Vip3Aa59 on toxicity of D. pini and S. exigua was studied. Both Vip3Aa proteins did not show any activity against Tenebrio molitor (Coleoptera) larvae. The results suggest that the Vip3Aa58 and Vip3Aa59 toxins might be useful for controlling populations of insect pests of crops and forests. Copyright © 2015 Elsevier Inc. All rights reserved.

Aluminium Alloy AA6060 surface treatment with high temperature steam containing chemical additives

DEFF Research Database (Denmark)

Din, Rameez Ud; Tabrizian, Naja; Jellesen, Morten S.

2015-01-01

The steam treatment process was employed to produce a conversion coating on aluminium alloy AA6060. The changes in microstructure and its effect on corrosion resistance properties were investigated. Various concentrations of KMnO4 containing Ce(NO3)3 was injected into the steam and its effect...... on the formation of steam-based conversion coating was evaluated. The use of Mn-Ce into the steam resulted in incorporation of these species into the conversion coating, which resulted in improved corrosion resistance of the alloy substrate....

NCBI nr-aa BLAST: CBRC-DMEL-02-0054 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0054 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 0.0 100% ...

NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-02-0048 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 1e-163 91% ...

NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0057 gb|AAS74196.1| 5-HT1A [Drosophila melanogaster] gb|AAS74220.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74309.1| 5-HT1A [Drosophila melanogaster] gb|AAS74310.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74335.1| 5-HT1A [Drosophila melanogaster] AAS74196.1 1e-176 97% ...

NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0057 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-177 97% ...

Comparison of susceptibility to pitting corrosion of AA2024-T4, AA7075-T651 and AA7475-T761 aluminium alloys in neutral chloride solutions using electrochemical noise analysis

International Nuclear Information System (INIS)

Na, Kyung-Hwan; Pyun, Su-Il

2008-01-01

The susceptibility to pitting corrosion of AA2024-T4, AA7075-T651 and AA7475-T761 aluminium alloys was investigated in aqueous neutral chloride solution for the purpose of comparison using electrochemical noise measurement. The experimentally measured electrochemical noises were analysed based upon the combined stochastic theory and shot-noise theory using the Weibull distribution function. From the occurrence of two linear regions on one Weibull probability plot, it was suggested that there existed two stochastic processes of uniform corrosion and pitting corrosion; pitting corrosion was distinguished from uniform corrosion in terms of the frequency of events in the stochastic analysis. Accordingly, the present analysis method allowed us to investigate pitting corrosion independently. The susceptibility to pitting corrosion was appropriately evaluated by determining pit embryo formation rate in the stochastic analysis. The susceptibility was decreased in the following order: AA2024-T4 (the naturally aged condition), AA7475-T761 (the overaged condition) and AA7075-T651 (the near-peak-aged condition)

Microstructural features of friction stir welded dissimilar Aluminium alloys AA2219-AA7475

Science.gov (United States)

Zaman Khan, Noor; Ubaid, Mohammed; Siddiquee, Arshad Noor; Khan, Zahid A.; Al-Ahmari, Abdulrahman; Chen, Xizhang; Haider Abidi, Mustufa

2018-05-01

High strength, good corrosion resistance, light weight make aluminium alloys a material of choice in many industrial sectors like aerospace, marine etc. Problems associated with welding of these alloys by fusion welding processes restricted their use in various industries. Friction stir welding (FSW), a clean solid-state joining process, easily overcomes various difficulties encountered during conventional fusion welding processes. In the present work, the effect of rotational speed (710 rpm, 900 rpm and 1120 rpm) on micro-hardness distribution and microstructure of FSWed dissimilar aluminium alloy joints were analyzed. Plates of AA7475-T761 and AA2219-O having thickness of 2.5 mm were welded by fixing AA7475 on retreating side (RS) and AA2219 on advancing side (AS). Welded joints were characterized by Vickers micro-hardness testing, scanning electron microscopy (SEM) and optical microscopy (OM). Results revealed that rotational speed significantly affects the micro-hardness due to increase in grain size, coarsening and dissolution of strengthening precipitates and re-precipitation. Higher micro-hardness values were observed in stir zone due to grain refinement and re-precipitation. Minimum micro-hardness value was observed at the TMAZ/HAZ of advancing side due to thermal softening.

AA Index

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa index provides a long climatology of global geomagnetic activity using 2 antipodal observatories at Greenwich and Melbourne- IAGA Bulletin 37,...

Experimental investigation of hardness of FSW and TIG joints of Aluminium alloys of AA7075 and AA6061

Directory of Open Access Journals (Sweden)

Chetan Patil

2016-07-01

Full Text Available This paper reports hardness testing conducted on welded butt joints by FSW and TIG welding process on similar and dissimilar aluminium alloys. FSW joints were produced for similar alloys of AA7075T651 and dissimilar alloys of AA7075T651- AA6061T6. The Friction stir welds of AA7075 & AA6061 aluminium alloy were produced at different tool rotational speeds of 650,700, 800, 900, 1000 and transverse speed of 30, 35, 40 mm/min. TIG welding was conducted along the rolling direction of similar and dissimilar aluminium plates. The Brinell hardness testing techniques were employed to conduct the tests; these tests were conducted on the welds to ascertain the joint integrity before characterization to have an idea of the quality of the welds

Partially melted zone cracking in AA6061 welds

International Nuclear Information System (INIS)

Prasad Rao, K.; Ramanaiah, N.; Viswanathan, N.

2008-01-01

Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043

Partially melted zone cracking in AA6061 welds

Energy Technology Data Exchange (ETDEWEB)

Prasad Rao, K. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai (India)], E-mail: kpr@iitm.ac.in; Ramanaiah, N. [Sri Kalahasteeswara Institute of Technology, Srikalahasti (India); Viswanathan, N. [Defence Research and Development Laboratory, Hyderabad (India)

2008-07-01

Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043.

Study for a failsafe trigger generation system for the Large Hadron Collider beam dump kicker magnets

CERN Document Server

Rampl, M

1999-01-01

The 27 km-particle accelerator Large Hadron Collider (LHC), which will be completed at the European Laboratory for Particle Physics (CERN) in 2005, will work with extremely high beam energies (~334 MJ per beam). Since the equipment and in particular the superconducting magnets must be protected from damage caused by these high energy beams the beam dump must be able to absorb this energy very reliable at every stage of operation. The kicker magnets that extract the particles from the accelerator are synchronised with the beam by the trigger generation system. This thesis is a first study for this electronic module and its functions. A special synchronisation circuit and a very reliable electronic switch were developed. Most functions were implemented in a Gate-Array to improve the reliability and to facilitate modifications during the test stage. This study also comprises the complete concept for the prototype of the trigger generation system. During all project stages reliability was always the main determin...

Obesity is a significant susceptibility factor for idiopathic AA amyloidosis.

Science.gov (United States)

Blank, Norbert; Hegenbart, Ute; Dietrich, Sascha; Brune, Maik; Beimler, Jörg; Röcken, Christoph; Müller-Tidow, Carsten; Lorenz, Hanns-Martin; Schönland, Stefan O

2018-03-01

To investigate obesity as susceptibility factor in patients with idiopathic AA amyloidosis. Clinical, biochemical and genetic data were obtained from 146 patients with AA amyloidosis. Control groups comprised 40 patients with long-standing inflammatory diseases without AA amyloidosis and 56 controls without any inflammatory disease. Patients with AA amyloidosis had either familial Mediterranean fever (FMF) or long-standing rheumatic diseases as underlying inflammatory disease (n = 111, median age 46 years). However, in a significant proportion of patients with AA amyloidosis no primary disease was identified (idiopathic AA; n = 37, median age 60 years). Patients with idiopathic AA amyloidosis were more obese and older than patients with AA amyloidosis secondary to FMF or rheumatic diseases. Serum leptin levels correlated with the body mass index (BMI) in all types of AA amyloidosis. Elevated leptin levels of more than 30 µg/l were detected in 18% of FMF/rheumatic + AA amyloidosis and in 40% of patients with idiopathic AA amyloidosis (p = .018). Finally, the SAA1 polymorphism was confirmed as a susceptibility factor for AA amyloidosis irrespective of the type of the disease. Obesity, age and the SAA1 polymorphism are susceptibility factors for idiopathic AA amyloidosis. Recent advances in treatment of FMF and rheumatic disorders will decrease the incidence of AA amyloidosis due to these diseases. Idiopathic AA, however, might be an emerging problem in the ageing and increasingly obese population.

Dissimilar friction stir welds in AA5083-AA6082: The effect of process parameters on residual stress

International Nuclear Information System (INIS)

Steuwer, A.; Peel, M.J.; Withers, P.J.

2006-01-01

The effect of tool traverse and rotation speeds on the residual stresses are quantified for welds between non-age-hardening AA5083 and age-hardening AA6082 and compared to single alloy joints made from each of the two constituents. The residual stresses have been characterised non-destructively by neutron diffraction and synchrotron X-ray diffraction. The region around the weld line was characterised by significant tensile residual stress fields which are balanced by compressive stresses in the parent material. The rotation speed of the tool has been found to have a substantially greater influence than the transverse speed on the properties and residual stresses in the welds, particularly on the AA5083 side where the location of the peak stress moves from the stir zone to beyond the edge of the tool shoulder. The changes in residual stress are related to microstructural and hardness changes as determined in a previous study . In particular the larger stresses under the weld tool on the AA5083 side compared to the AA6082 side are related to a transient reduction in yield stress due to dissolution of the hardening precipitates during welding prior to natural aging after welding

Ascorbic acid (AA) metabolism in protection against radiation damage

International Nuclear Information System (INIS)

Rose, R.C.; Koch, M.J.

1986-01-01

The possibility is considered that AA protects tissues against radiation damage by scavenging free radicals that result from radiolysis of water. A physiologic buffer (pH 6.7) was incubated with 14 C-AA and 1 mM thiourea (to slow spontaneous oxidation of AA). Aliquots were assayed by HPLC and scintillation spectrometry to identify the 14 C-label. Samples exposed to Cobalt-60 radiation had a half time of AA decay of 30 minutes) indicating that AA scavenges radiation-induced free radicals and forms the ascorbate free radical (AFR). Pairs of 14 C-AFR disproportionate, with the net effect of 14 C-dehydroascorbic acid formation from 14 C-AA. Having established that AFR result from ionizing radiation in an aqueous solution, the possibility was evaluated that a tissue factor reduces AFR. Cortical tissue from the kidneys of male rats was minced, homogenized in buffer and centrifuged at 8000 xg. The supernatant was found to slow the rate of radiation-induced AA degradation by > 90% when incubated at 23 0 C in the presence of 15 μM 14 C-AA. Samples of supernatant maintained at 100 0 C for 10 minutes or precipitated with 5% PCA did not prevent radiation-induced AA degradation. AA may have a specific role in scavenging free radicals generated by ionizing radiation and thereby protect body tissues

Influencia de los parámetros de la soldadura metálica fría en las aleaciones AA5083 y AA6061//Influence of the colt metal welding parameters on the AA5083 and AA6061 aluminum

Directory of Open Access Journals (Sweden)

René Eduardo de‐Luna‐Alanís

2015-01-01

Full Text Available El trabajo tuvo como objetivo evaluar la influencia de la velocidad de la soldadura y de las correcciones del arco y pulso en el proceso de Transferencia Metálica Fría sobre las propiedades mecánicas de las aleaciones AA5083 y AA6061. Se desarrolló un diseño experimental de tipo factorial multinivel, con 4 factores independientes (Corrección de Arco, Pulso, Velocidad de Soldadura y Aleación. Los parámetros fundamentales fueron: Corriente de base 250 A; Voltaje de arco 21 V y Polaridad (Direct current electrode positive, DCEP. La evaluación se realizó a través de un ensayo de tracción transversal sobre probetas planas obtenidas de los cupones soldados. Se demuestra que el modelo aplicado es adecuado, revelándose en los experimentos diferencias sustanciales en las propiedades Tensión de fluencia 29,56 %, Módulo de elasticidad 51,16 % y Trabajo específico de deformación elástica 42,30 %, el cual no posee una dependencia lineal con elresto de las propiedades anteriores.Palabras claves: transferencia metálica fría, aleación AA5083, aleación AA6061, propiedades mecánicas._______________________________________________________________________________AbstractThe work objective was to evaluatethe influence of Cold Metal Transfer process arc and pulse corrections and welding speed on the mechanical properties of AA5083 and AA6061 aluminum alloys. For it, a Factorial Multilevel experimental design whit 4 independent factor (arc correction, pulse correction, welding speed and alloy was developed. The essential welding parameters employed were: base current 250 A; arc voltage 21 V and polarity (DCEP. The evaluation was made whit a transverse traction test of plate welded coupons. The experimental model applied wasadequate and substantial differences was showed between yield tensile strength 29,56 %, elasticity module (51,16 % and specific work of elastic deformation 42,30 %, which it does not possess a lineal dependence whit the rest

Side effects of AAS abuse: an overview.

Science.gov (United States)

Turillazzi, E; Perilli, G; Di Paolo, M; Neri, M; Riezzo, I; Fineschi, V

2011-05-01

Anabolic - androgenic steroids (AAS) were originally developed to promote growth of skeletal muscle. AAS abuse is commonly associated with bodybuilders, weightlifters, and other athletes. The issue of AAS toxicity is not yet completely understood since the adverse effects outline a varied scenario with side effects reported affecting many organs and systems in humans. The true incidence of AAS related medical problems is not known, due to several drawbacks in human studies. The entity of side effects depends on the sex, the dose, the duration of treatment, whether they are taken during exercise training or under sedentary conditions, and the susceptibility of the individuals themselves to androgen exposure partly depending on genetic factors. Both the acute and the chronic effects can lead to toxicity, but generally the serious and even fatal effects depend on the time and the duration of AAS administration. A limitation of human studies is represented by the fact that information about the intake of steroids are, generally, self reported and it is hardly possible to assess the exact dosage. AAS are often used in combination with other dugs or substances, so it is difficult to separate their toxic effects from those caused by the other drugs abused. Hence experimental studies conducted on animal models are mandatory to investigate the mechanisms underlying to AAS toxicity and the organ alterations due to these substances. Finally, clinicians should be aware of the complex and varied pattern of toxicity so as to be able to perform correct diagnoses and treatments.

Measurement and correction of the working points during the energy ramp at the stretcher ring of ELSA

International Nuclear Information System (INIS)

Eberhartdt, Maren

2010-12-01

At the electron stretcher accelerator ELSA of Bonn University, an external beam is supplied to hadron physics experiments. In order to correct dynamic effects caused by eddy currents induced during the fast energy ramp, the transversal tunes have to be measured in situ with high precision. These measurements are based on the excitation of coherent oscillations generated by a pulsed kicker magnet. Horizontal oscillations were excited using one of the injection kicker magnets. Since its installation a newly designed kicker magnet enables measurements in the vertical plane as well. Oscillation frequencies are derived from a fast Fourier transform of the demodulated BPM signals, showing a well pronounced peak at the tune frequency. Using this technique, tune shifts were measured and corrected successfully. Measurement and correction of coherent longitudinal oscillations is feasible as well, utilizing a quite similar technique. Coherent oscillations are excited by a phase jump of the acceleration voltage using an electrical phase shifter in the reference RF signal path. (orig.)

Measurement and correction of the working points during the energy ramp at the stretcher ring of ELSA; Messung und Korrektur der Arbeitspunkte waehrend der Energierampe am Stretcherring von ELSA

Energy Technology Data Exchange (ETDEWEB)

Eberhartdt, Maren

2010-12-15

At the electron stretcher accelerator ELSA of Bonn University, an external beam is supplied to hadron physics experiments. In order to correct dynamic effects caused by eddy currents induced during the fast energy ramp, the transversal tunes have to be measured in situ with high precision. These measurements are based on the excitation of coherent oscillations generated by a pulsed kicker magnet. Horizontal oscillations were excited using one of the injection kicker magnets. Since its installation a newly designed kicker magnet enables measurements in the vertical plane as well. Oscillation frequencies are derived from a fast Fourier transform of the demodulated BPM signals, showing a well pronounced peak at the tune frequency. Using this technique, tune shifts were measured and corrected successfully. Measurement and correction of coherent longitudinal oscillations is feasible as well, utilizing a quite similar technique. Coherent oscillations are excited by a phase jump of the acceleration voltage using an electrical phase shifter in the reference RF signal path. (orig.)

Upgrade of the LHC Beam Dumping Protection Elements

CERN Document Server

Weterings, W; Balhan, B; Borburgh, J; Goddard, B; Maglioni, C; Versaci, R

2012-01-01

The Beam Dumping System for the Large Hadron Collider comprises for each ring a set of horizontally deflecting extraction kicker magnets, vertically deflecting steel septa, dilution kickers and finally, a couple of hundred meters further downstream, an absorber block. A mobile diluter (TCDQ) protects the superconducting quadrupole immediately downstream of the extraction as well as the arc at injection energy and the triplet aperture at top energy from bunches with small impact parameters, in case of a beam dump that is not synchronized with the particle free gap or a spontaneous firing of the extraction kickers. Simulations have shown that an asynchronous dump of a 7 TeV nominal beam into the TCDQ absorber blocks could damage it. This paper describes the proposed changes to this device in order to maintain the protection for the downstream elements while reducing the risk of damaging the TCDQ in case of such a beam loss.

Studies on the distribution of 125I-labelled Hemorrhagic toxin from agkistrodon acutus (125I-AaT) in rabbits and its pharmacokinetic characters

International Nuclear Information System (INIS)

Huang Yuchu; Jiang Bo; Wang Yuzheng; Xu Xun

1988-01-01

125 I-AaT, prepared by oxidant-chloroamine T from the related venom of Agkistrodon Acutus, is given to a rabbit by intravenous injection, and then, the distribution of the toxin in the rabbit and its pharmacokinetic characters have been studied.The rabbit is killed five hours after the injection, and the radioactivity in each tissue calculated. The result indicates that the blood-brain barrier exist in the body, and large quantity of by-products of 125 I-AaT metabolism is eliminated from urine by the kidney. For pharmacokinetics, the computer simulated curve demonstrates that the result conforms to the Two Compartment Model. The fast component half-life T 1/2α is 3.15 mins. , the slow component half-life T 1/2β is 165 mins. , and the biological half-life T 1/2 is 75.2 mins.V d33 , V t and V e have been analyzed, and the author thinks preliminarily that there must have been a corresponding receptor to the toxin in the body

Comparison of calculated and experimentally determined SID of CP and AA in complex diets differing in AA contents for grower finisher pigs.

Science.gov (United States)

Büsing, K; Berk, A; Müller, S; Kieckhäven, S; Krüger, K; Zeyner, A

2017-10-01

In practice, the content of standardized ileal digestible AA in complex feeds for pigs is calculated on the basis of tabulated values for individual feedstuffs. It comes into question, however, whether this truly reflects an accurate content based upon the estimate made for the individual feedstuffs. The objective of this study was to compare standardized ileal digestibility (SID) of crude protein (CP) and selected AA in complex feeds for grower and finisher pigs either calculated or experimentally determined. Six diets with increasing AA levels were prepared for grower (BW from 30 to 70 kg) and finisher (BW from 70 to 120 kg) feed. Crystalline L-lys, DL-met and L-thr were added to both diets, L-trp and L-val only to the grower feed. SID of both CP and AA was calculated from feed tables and experimentally determined in six adult minipigs (MINILEWE) with ileorectal anastomosis. With increasing AA levels, experimentally determined SID of supplemented AA increased (p AA via tabulated values for individual feedstuffs, however, seems to be acceptable for practical use. Journal of Animal Physiology and Animal Nutrition © 2017 Blackwell Verlag GmbH.

Dicty_cDB: FC-AA02 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AA02 (Link to dictyBase) - - - Contig-U16527-1 FC-AA02Z (Li...nk to Original site) - - FC-AA02Z 458 - - - - Show FC-AA02 Library FC (Link to library) Clone ID FC-AA02 (Link to dic...linum small subunit ribosomal RNA gene, partial sequence. 149 2e-47 2 AY179984 |AY179984.1 Uncultured alveo... CP000930_2283( CP000930 |pid:none) Heliobacterium modesticaldum Ic... 33 2.3 AP009386_1894( AP009386 |pid:none) Burkholderia multi... EU955514 |pid:none) Zea mays clone 1535262 hypothetica... 50 2e-05 BA000023_1285

Bardoxolone methyl (BARD) ameliorates aristolochic acid (AA)-induced acute kidney injury through Nrf2 pathway.

Science.gov (United States)

Wu, Juan; Liu, Xinhui; Fan, Jinjin; Chen, Wenfang; Wang, Juan; Zeng, Youjia; Feng, Xiaorang; Yu, Xueqing; Yang, Xiao

2014-04-06

Bardoxolone methyl (BARD) is an antioxidant modulator that acts through induction of the nuclear factor erythroid 2-related factor 2 (Nrf2) signaling pathway. This study aimed to investigate the role of BARD in protecting kidneys from aristolochic acid (AA)-induced acute kidney injury (AKI). Male C57BL/6 mice received intraperitoneal (i.p.) injections of aristolochic acid I (AAI) (5mg/kg/day) for 5 days to produce acute AA nephropathy (AAN) model. BARD (10mg/kg/day, i.p.) was applied for 7 consecutive days, starting 2 days prior to AAI administration. The mice in the AA group showed AKI as evidenced by worsening kidney function evaluated by blood urea nitrogen (BUN) and serum creatinine (SCr) levels, and severe tubulointerstitial injury marked by massive tubule necrosis in kidney tissues. BARD significantly reduced BUN and SCr levels which were elevated by AAI. Additionally, AAI-induced histopathological renal damage was ameliorated by BARD. Furthermore, the expression of Nrf2 was reduced, and its repressor Kelch-like ECH-associated protein 1 (Keap1) was increased significantly, whereas heme oxygenase-1 (HO-1) was upregulated and NAD(P)H quinone oxidoreductase-1 (NQO1) was barely increased in the cytoplasm of tubules in kidneys after treatment with AAI. BARD significantly upregulated renal Nrf2, NQO1 and HO-1 expression and downregulated Keap1 expression compared with those in the AA group. Moreover, it was found that Nrf2 was expressed both in the cytoplasm and nuclear of glomeruli and tubules, whereas NQO1 and HO-1 were localized in the cytoplasm of tubules only. In conclusion, AA-induced acute renal injury was associated with impaired Nrf2 activation and expression of its downstream target genes in renal tissues. BARD prevented renal damage induced by AAI, and this renoprotective effect may be exerted by activating the Nrf2 signaling pathway and increasing expression of the downstream target genes. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Lamination sheet of AA BST magnet

CERN Multimedia

CERN PhotoLab

1979-01-01

The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.

Geomagnetic aa Indices

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa indices are the continuation of the series beginning in the year 1868. A full description of these indices is given in the International...

States' Flexibility Waiver Plans for Alternate Assessments Based on Alternate Achievement Standards (AA-AAS). Synthesis Report 96

Science.gov (United States)

Lazarus, Sheryl S.; Edwards, Lynn M.; Thurlow, Martha L.; Hodgson, Jennifer R.

2014-01-01

All states have alternate assessments based on alternate achievement standards (AA-AAS) for students with the most significant cognitive disabilities. For accountability purposes, the Elementary and Secondary Education Act (ESEA) allows up to 1% of students to be counted as proficient with this assessment option. In 2011 the U.S. Department of…

[AA amyloidosis: a little-known complication of chronic leg ulcer].

Science.gov (United States)

Waton, J; Fays-Michel, S; Chandeclerc, M L; Corby, S; Cuny, J F; Barbaud, A; Schmutz, J-L

2008-02-01

AA amyloidosis, secondary to inflammatory chronic diseases like rheumatoid arthritis, is often complicated by renal failure. Chronic inflammatory dermatoses constitute rare causes of AA amyloidosis. We describe two cases of AA amyloidosis discovered after renal failure in patients presenting leg ulcers for several years. AL amyloidosis was suspected in both cases because of a history of monoclonal gammopathy in one patient and of plasmocytoma in the other. The diagnosis of AA amyloidosis was confirmed on renal histology through the detection of AA antibodies in amyloid deposits. No extrarenal amyloidosis was seen in either patient and there were no inflammatory diseases other than chronic leg ulcers. AA amyloidosis is caused by serum amyloid protein A (SAA), a reactive inflammatory protein. AA amyloidosis is thus caused by chronic inflammatory diseases, but only rarely by cutaneous inflammatory diseases. To our knowledge, the literature contains only seven other published cases of AA amyloidosis secondary to chronic leg ulcers. A review of the literature does not indicate whether cure of ulcers has any effect on the accompanying renal failure. We imagine that AA amyloidosis secondary to leg ulcer is in fact under-diagnosed. However, since the first specific treatment for AA amyloidosis is currently being evaluated by the Food and Drug Administration, it is essential that this serious complication of chronic leg ulcers be widely recognised.

Abia, AA

African Journals Online (AJOL)

Abia, AA. Vol 4, No 6 (2010) - Articles Studies on the kinetics and intraparticle diffusivities of BOD, colour and TSS reduction from palm oil mill effluent (POME) using boiler fly ash. Abstract PDF. ISSN: 1996-0786. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

Microsolvation of the acetanilide cation (AA(+)) in a nonpolar solvent: IR spectra of AA(+)-L(n) clusters (L = He, Ar, N2; n ≤ 10).

Science.gov (United States)

Schmies, Matthias; Patzer, Alexander; Schütz, Markus; Miyazaki, Mitsuhiko; Fujii, Masaaki; Dopfer, Otto

2014-05-07

Infrared photodissociation (IRPD) spectra of mass-selected cluster ions of acetanilide (N-phenylacetamide), AA(+)-Ln, with the ligands L = He (n = 1-2), Ar (n = 1-7), and N2 (n = 1-10) are recorded in the hydride stretch (amide A, νNH, νCH) and fingerprint (amide I-III) ranges of AA(+) in its (2)A'' ground electronic state. Cold AA(+)-Ln clusters are generated in an electron impact ion source, which predominantly produces the most stable isomer of a given cluster ion. Systematic vibrational frequency shifts of the N-H stretch fundamentals (νNH) provide detailed information about the sequential microsolvation process of AA(+) in a nonpolar (L = He and Ar) and quadrupolar (L = N2) solvent. In the most stable AA(+)-Ln clusters, the first ligand forms a hydrogen bond (H-bond) with the N-H proton of trans-AA(+) (t-AA(+)), whereas further ligands bind weakly to the aromatic ring (π-stacking). There is no experimental evidence for complexes with the less stable cis-AA(+) isomer. Quantum chemical calculations at the M06-2X/aug-cc-pVTZ level confirm the cluster growth sequence derived from the IR spectra. The calculated binding energies of De(H) = 720 and 1227 cm(-1) for H-bonded and De(π) = 585 and 715 cm(-1) for π-bonded Ar and N2 ligands in t-AA(+)-L are consistent with the observed photofragmentation branching ratios of AA(+)-Ln. Comparison between charged and neutral AA((+))-L dimers indicates that ionization switches the preferred ion-ligand binding motif from π-stacking to H-bonding. Electron removal from the HOMO of AA(+) delocalized over both the aromatic ring and the amide group significantly strengthens the C[double bond, length as m-dash]O bond and weakens the N-H bond of the amide group.

Enhancement of distribution of dermal multipotent stem cells to bone marrow in rats of total body irradiation by platelet-derived growth factor-AA treatment

International Nuclear Information System (INIS)

Zong Zhaowen; Ren Yongchuan; Shen Yue; Chen Yonghua; Ran Xinze; Shi Chunmeng; Cheng Tianmin

2011-01-01

Objective: To observe whether dermal multipotent stem cells (dMSCs) treated with platelet-derived growth factor-AA (PDGF-AA) could distribute more frequently to the bone marrow in rats of total body irradiation (TBI). Methods: Male dMSCs were isolated and 10 μg/L PDGF-AA was added to the culture medium and further cultured for 2 h. Then the expression of tenascin-C were examined by Western blot, and the migration ability of dMSCs was assessed in transwell chamber. The pre-treated dMSCs were transplanted by tail vein injection into female rats administered with total body irradiation, and 2 weeks after transplantation, real-time PCR was employed to measure the amount of dMSCs in bone marrow. Non-treated dMSCs served as control.Results PDGF-AA treatment increased the expression of tenascin-C in dMSCs, made (1.79 ± 0.13) × 10 5 cells migrate to the lower chamber under the effect of bone marrow extract, and distributed to bone marrow in TBI rats, significantly more than (1.24 ± 0.09) ×10 5 in non-treated dMSCs (t=8.833, P<0.01). Conclusions: PDGF-AA treatment could enhance the migration ability of dMSCs and increase the amount of dMSCs in bone marrow of TBI rats after transplantation. (authors)

The Antiproton Accumulator (AA)

CERN Multimedia

1980-01-01

Section 06 - 08*) of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A vacuum-tank, two bending magnets (BST06 and BST07 in blue) with a quadrupole (QDN07, in red) in between, another vacuum-tank, a wide quadrupole (QFW08) and a further tank . The tanks are covered with heating tape for bake-out. The tank left of BST06 contained the stack core pickup for stochastic cooling (see 7906193, 7906190, 8005051), the two other tanks served mainly as vacuum chambers in the region where the beam was large. Peter Zettwoch works on BST06. *) see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984)

Effect of pressurized steam on AA1050 aluminium

DEFF Research Database (Denmark)

Jariyaboon, Manthana; Møller, Per; Ambat, Rajan

2012-01-01

Purpose - The purpose of this paper is to understand the effect of pressurized steam on surface changes, structures of intermetallic particles and corrosion behavior of AA1050 aluminium. Design/methodology/approach - Industrially pure aluminium (AA1050, 99.5 per cent) surfaces were exposed...... reactivities was observed due to the formation of the compact oxide layer. Originality/value - This paper reveals a detailed investigation of how pressurized steam can affect the corrosion behaviour of AA1050 aluminium and the structure of Fe-containing intermetallic particles....

Reinforcement with alumina particles at the interface region of AA6101-T6 and AA1350 alloys during friction stir welding

Science.gov (United States)

Ashok Kumar, R.; Thansekhar, M. R.

2018-04-01

This paper deals the combinational effect of friction stir welding and friction stir processing on dissimilar AA6101-T6 and AA1350 aluminium alloys. For that, alumina particles are reinforced at interface region of AA6101-T6 and AA1350 aluminium alloys. Friction Stir Welding and Friction Stir Processing are done simultaneously for various sizes of groove. To analyze the welding quality and surface modifications, mechanical, wear and microstructural tests are carried out. Among these, smallest groove of 0.5 mm width and 1 mm depth reveals highest tensile and bending strengths and largest groove of 2 mm width and 3 mm depth gives maximum hardness and wear resistance. Taguchi technique shows that groove width is most influencing parameter. Developed second order models with interaction predict the responses with minimum error.

Simon van der Meer in the AA Control Room

CERN Multimedia

CERN PhotoLab

1984-01-01

Simon van der Meer, spiritus rector of the Antiproton Accumulator, in the AA Control Room. Inventor of stochastic cooling, on which the AA was based, and of the magnetic horn, with which the antiprotons were focused, he also wrote most of the software with which the AA was controlled, and spent uncountable numbers of hours in this chair to tickle the AA to top performance. 8 months after this picture was taken, he received, in October 1984, the Nobel prize, together with Carlo Rubbia, the moving force behind the whole Proton-Antiproton Collider project that led to the discovery, in 1983, of the W and Z intermediate bosons.

Inclusive cross sections in AA collisions at high energies

International Nuclear Information System (INIS)

Braun, M.A.

1988-01-01

Inclusive cross sections in AA collisions at high energies are considered in the Glauber multiple scattering theory taking into account many-nucleon collisions. Correspondence is found between the AA amplitude and the effective action of the two-dimensional quantum field theory with exponential interaction. The tree and one-loop contributions are calculated in this formalism. The rules are derived, which relate the absorption part of the AA-collision amplitudes associated with various inclusive cross sections to the absorption parts of NN amplitudes. These rules generalize the well-known Agranowsky-Gribov-Kanchelli rules for hh and hA collisions. Formulas are written for single and double inclusive cross sections in AA collisions

Fast risetime BLT switches for accelerators applications

International Nuclear Information System (INIS)

Kirkman-Amemiya, G.; Reinhardt, N.; Choi, M.S.; Gundersen, M.A.

1991-01-01

Several particle accelerator systems require repetitive switches capable to switching peak currents of several kA with short risetimes, in particular kicker magnets used to transfer particle beams from one section of an accelerator to another require current pulses that rise from zero to 100% in a time determined by the separation between particle bunches which can be only 10's of nsec in some applications. One particular application is the injection and extraction kickers for the low energy booster (LEB) of the superconducting super collider (SSC) which requires < 50nsec 0-99% risetime. Another system with similarly strict risetime requirement is the kicker for the Stanford Linear Collider electron damping rings. In this work, a fast risetime BLT switch which has demonstrated 17kA at 30kV with < 60nsec risetime, 1.5kA at 20kV with < 18nsec risetime, and up to 240Hz operation at 20kV, 7kA is reported. A tetrode triggering method is described which reduces risetime by eliminating prepulse behavior

Bake hardening of nanograin AA7075 aluminum alloy

International Nuclear Information System (INIS)

Dehghani, Kamran

2011-01-01

Highlights: ► The bake hardening behavior of AA7075 was studied and compared with its coarse-grain counterpart. ► Nanograin AA7075 exhibited 88–100% increase in bake hardenability. ► Nanograin AA7075 exhibited 36–38% increase in final yield strength after baking. ► Maximum bake hardenability and final yield stress were about 185 MPa and 719 MPa. - Abstract: In the present work, the bake hardening of nanostructured AA7075 aluminum alloy was compared with that of its coarse-grain counterpart. Surface severe plastic deformation (SSPD) was used to produce nanograin layers on both surfaces of workpieces. The nanostructured layers were characterized using scanning electron microscopy (SEM) and atomic force microscopy (AFM) techniques. The thickness of nanostructured layer, having the grains of 50–110 nm, was about 75 μm on each side of workpiece. The bake hardenability of nanograin and coarse-grain AA7075 was then compared by pre-straining to 2, 4 and 6% followed by baking at 100 °C and 200 °C for 20 min. Comparing to coarse-grain case, there was about 88–100% increase in bake hardenability and about 36–38% increase in yield strength after the bake hardening of present nanograin AA7075. Such an increase in bake hardenability and strength was achieved when the thickness of two nanograin layers was about only one-tenth of the whole thickness.

Mechanical and corrosion properties of AA8011 sheets and foils:

OpenAIRE

Asanović, Vanja; Dalijić, Kemal; Radonjić, Dragan

2006-01-01

The mechanical and corrosion properties of a twin-roll cast Al-Fe-Si aluminum alloy with 0.74 % Fe and 0.52 % Si (AA8011) were investigated. The influence of the thermo-mehanical processing route on the mechanical behavior of AA8011 sheets was determined. Comparisons were made with AA3003 and A199.5 sheets. The restoration of the mechanical properties was used in the analysis of the recrystallization behavior of the twin-roll cast AA8011 alloy deformed under cold-working conditions and subseq...

Fred-Jaiyesimi, AA

African Journals Online (AJOL)

Fred-Jaiyesimi, AA. Vol 12 (2008) - Articles Hypoglycaemic And Alpha-Amylase Inhibitory Activities Of Fermented Seeds Of Parkia Biglobosa (Jacq) Benth Abstract. ISSN: 1118-6267. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

Anabolic Androgenic Steroid (AAS) related deaths: autoptic, histopathological and toxicological findings.

Science.gov (United States)

Frati, Paola; Busardò, Francesco P; Cipolloni, Luigi; Dominicis, Enrico De; Fineschi, Vittorio

2015-01-01

Anabolic androgenic steroids (AASs) represent a large group of synthetic derivatives of testosterone, produced to maximize anabolic effects and minimize the androgenic ones. AAS can be administered orally, parenterally by intramuscular injection and transdermally. Androgens act by binding to the nuclear androgen receptor (AR) in the cytoplasm and then translocate into the nucleus. This binding results in sequential conformational changes of the receptor affecting the interaction between receptor and protein, and receptor and DNA. Skeletal muscle can be considered as the main target tissue for the anabolic effects of AAS, which are mediated by ARs which after exposure to AASs are up-regulated and their number increases with body building. Therefore, AASs determine an increase in muscle size as a consequence of a dose-dependent hypertrophy resulting in an increase of the cross-sectional areas of both type I and type II muscle fibers and myonuclear domains. Moreover, it has been reported that AASs can increase tolerance to exercise by making the muscles more capable to overload therefore shielding them from muscle fiber damage and improving the level of protein synthesis during recovery. Despite some therapeutic use of AASs, there is also wide abuse among athletes especially bodybuilders in order to improve their performances and to increase muscle growth and lean body mass, taking into account the significant anabolic effects of these drugs. The prolonged misuse and abuse of AASs can determine several adverse effects, some of which may be even fatal especially on the cardiovascular system because they may increase the risk of sudden cardiac death (SCD), myocardial infarction, altered serum lipoproteins, and cardiac hypertrophy. The aim of this review is to focus on deaths related to AAS abuse, trying to evaluate the autoptic, histopathological and toxicological findings in order to investigate the pathophysiological mechanism that underlines this type of death, which

Displaying Now-Understanding: The Finnish Change-of-State Token "aa"

Science.gov (United States)

Koivisto, Aino

2015-01-01

This article discusses the use of the Finnish change-of-state token "aa" that has previously not been identified. The central claim is that even though "aa" indicates a cognitive shift experienced by the speaker, it does not function as a receipt of new information. Instead, the token "aa" indicates that the speaker…

Dynamic Response and Microstructure Evolution of AA2219-T4 and AA2219-T6 Aluminum Alloys

Science.gov (United States)

Olasumboye, A.; Owolabi, G.; Odeshi, A.; Zeytinci, A.; Yilmaz, N.

2018-02-01

In this study, the dynamic deformation behavior of AA2219 aluminum alloy was investigated in two different temper conditions: T4 and T6, with a view to determining the effect of heat treatment on the microstructure and flow behavior of the material under high strain rates. Split Hopkinson pressure bar experiment was used in determining the dynamic response of the alloy while a digital image correlation system was employed in visualizing and tracking the surface deformation of the specimens. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. The results obtained showed heterogeneous deformation of the alloy in the two temper conditions. It was observed that the dynamic mechanical behavior of each sample preparation was dependent on its strength properties due to aging type, which in turn controls the metamorphosis of the strengthening precipitates and the initial microstructure. At the maximum strain rate of 3500 s-1, transformed bands leading to crack nucleation was observed in the AA2219-T4 aluminum alloy while AA2219-T6 had fractured at the same strain rate. The modes of crack formation and growth in the two alloys were found to be similar: nucleation, growth and coalescence of voids. However, shear band bifurcation phenomenon was observed only in the AA2219-T6 alloy.

MD on UFOs at MKIs and MKQs

CERN Document Server

Baer, T; Bartmann, W; Bracco, C; Carlier, E; Dehning, B; Garrel, N; Goddard, B; Jackson, S; Jimenez, M; Kain, V; Mertens, V; Misiowiec, M; Nordt, A; Papotti, G; Uythoven, J; Wenninger, J; Zerlauth, M; Zamantzas, C; Zimmermann, F

2012-01-01

UFOs ("Unidentified Falling Objects") are expected to be one of the major known performance limitation of the LHC. In this MD, the production mechanism and the dynamics of UFOs at the injection kicker magnets (MKIs) and the tune kicker magnets (MKQs) were studied. This was done by pulsing the MKIs and MKQs on a gap in the partly filled machine. During the MD, in total 58 UFO-type beam loss patterns were observed directly after pulsing the MKIs. None were observed after pulsing the MKQs, which provides important input for possible mitigation strategies. The temporal and spatial distribution of the UFO events could be determined by using a dedicated BLM Study Buffer, the implications for the UFO dynamics are discussed.

AA Attendance and Abstinence for Dually Diagnosed Patients: A Meta-Analytic Review.

Science.gov (United States)

Scott Tonigan, J; Pearson, Matthew R; Magill, Molly; Hagler, Kylee J

2018-05-29

There is consensus that best clinical practice for dual diagnosis (DD) is integrated mental health and substance use treatment augmented with Alcoholics Anonymous (AA) attendance. This is the first quantitative review of the direction and magnitude of the association between AA attendance and alcohol abstinence for DD patients. A systematic literature search (1993-2017) identified 22 studies yielding 24 effect sizes that met our inclusion criteria (8,075 patients). Inverse-variance weighting of correlation coefficients (r) was used to aggregate sample-level findings and study aims were addressed using random and mixed effect models. Sensitivity and publication bias analyses were conducted to assess the likelihood of bias in the overall estimate of AA-related benefit. AA exposure and abstinence for DD patients were significantly and positively associated (r w =.249; 95% CI.203-.293; Tau=.097). There was also significant heterogeneity in the distribution of effect sizes, (Q(23)=90.714, pAA-related benefit did not differ between 6 (k=7) and 12 (k=12) month follow-up, (Q=.068, pAA benefit was not adversely or substantively impacted by pooling RCT and observational samples (Q=.763, pAA (Q=.023, pAA) is common and, in many cases, DD patients who attend AA will report higher rates of alcohol abstinence relative to DD patients who do not attend AA. This article is protected by copyright. All rights reserved.

Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo.

Science.gov (United States)

Jing, Yue; Wang, Gang; Xiao, Qi; Zhou, Yachun; Wei, Yingjie; Gong, Zhunan

2018-01-01

Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA) has demonstrated anticancer properties and we suspect this might be attributable to an effect on angio-genesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-L-proline methyl ester (AA-PMe), has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs). First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF) present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2)-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP) transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline phosphatase assay. VEGFR2 expression in whole embryos following AA-PMe treatment was also determined. We found AA-PMe decreased cell viability and inhibited migration and tube formation in a dose-dependent manner in HUVECs. Similarly, AA-PMe disrupted the formation of intersegmental vessels, the dorsal aorta, and the posterior cardinal vein in zebrafish embryos. Both in vitro and in vivo AA-PMe surpassed AA in its ability to block angiogenesis by suppressing VEGF-induced phosphorylation of VEGFR2 and disrupting downstream extracellular regulated protein kinase and AKT signaling. For the first time

Seconday-emission profile monitors at LEAR injection

CERN Multimedia

CERN PhotoLab

1982-01-01

This is a view against the direction of the beams. Through the right, smaller, opening the beams (protons, antiprotons, H-, later Pb-ions) entered and, after being put on central orbit with septum and kicker, reappeared as circulating beam through the left, larger, opening. Horizontal and vertical position and density profile of the incoming beam were measured with secondary emission grids. The same measurements were made on the beam after it had completed the first turn in the machine. For this purpose it was prevented from circulating with a beam stopper, mounted through the port at left (not mounted at the time the picture was taken).

Magnetic horn of the Antiproton Accumulator (AA)

CERN Multimedia

Photographic Service

1988-01-01

In the 1960s, the invention of this "current sheet lens" has helped to greatly improve the flux of neutrino beams. It was used again at the AA, collecting antiprotons from the production target at angles too large to fit into the acceptance of the AA. It was machined from aluminium to a thickness of 1.4 mm and pulsed at 400 kA for 15 microseconds (half-sine).

Inhibitory effect of propolis on the development of AA amyloidosis.

Science.gov (United States)

Harata, Daichi; Tsuchiya, Yuya; Miyoshi, Tomoyuki; Yanai, Tokuma; Suzuki, Kazuhiko; Murakami, Tomoaki

2018-04-01

In the several types of amyloidoses, participation of oxidative stresses in the pathogenesis and the effect of antioxidants on amyloidosis have been reported. Meanwhile, the relationship between oxidative stresses and pathogenesis of amyloid A (AA) amyloidosis is still unclear. In this study, we used an antioxidant, Brazilian propolis, to investigate the inhibitory effects on AA amyloidosis. The results showed that AA deposition was inhibited by administration of propolis. Increased expression of antioxidant markers was detected in molecular biological examinations of mice treated with propolis. Although serum amyloid A (SAA) levels were strongly correlated with the immunoreactive area of AA deposits in the control group, the correlation was weaker in the propolis-treated groups. In addition, there were no changes in SAA levels between the control group and the propolis-treated groups. The results indicate that propolis, an antioxidant, may induce inhibitory effects against AA amyloidosis.

NCBI nr-aa BLAST: CBRC-XTRO-01-0674 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0674 ref|YP_001022362.1| putative heme O oxygenase (cytochrome aa3-controlling...) transmembrane protein [Methylibium petroleiphilum PM1] gb|ABM96127.1| putative heme O oxygenase (cytochrome aa3-controlling

Outcomes From AAS Hack Day at the 227th AAS Meeting

Science.gov (United States)

Kohler, Susanna

2016-01-01

Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts

Corrosion issues of powder coated AA6060 aluminium profiles

DEFF Research Database (Denmark)

Din, Rameez Ud; Valgarðsson, Smári; Jellesen, Morten Stendahl

2015-01-01

In this study detailed microstructural investigation of the reason for unexpected corrosion of powder coated aluminium alloy AA6060 windows profiles has been performed. The results from this study reveals that the failure of the window profiles was originated from the surface defects present...... on the extruded AA6060 aluminium profile after metallurgical process prior to powder coating. Surface defects are produced due to intermetallic particles in the alloy, which disturb the flow during the extrusion process. The corrosion mechanism leading to the failure of the powder coated AA6060 aluminium profiles...

Wideband Precision Current Transformer for the Magnet Current of the Beam Extraction Kicker Magnet of the Large Hadron Collider

CERN Document Server

Gräwer, G

2004-01-01

The LHC beam extraction system is composed of 15 fast kicker magnets per beam to extract the particles in one turn of the collider and to safely dispose them on external absorbers. Each magnet is powered by a separate pulse generator. The generator produces a magnet current pulse with 3 us rise time, 20 kA amplitude and 1.8 ms fall time, of which 90 us are needed to dump the beam. The beam extraction system requires a high level of reliability. To detect any change in the magnet current characteristics, which might indicate a slow degradation of the pulse generator, a high precision wideband current transformer will be installed. For redundancy reasons, the results obtained with this device will be cross-checked with a Rogowski coil, installed adjacent to the transformer. A prototype transformer has been successfully tested at nominal current levels and showed satisfactory results compared with the output of a high frequency resistive coaxial shunt. The annular core of the ring type transformer is composed of...

Core–corona PSt/P(BA–AA) composite particles by two-stage emulsion polymerization

Energy Technology Data Exchange (ETDEWEB)

Xie, Delong; Ren, Xiaolin; Zhang, Xinya, E-mail: cexyzh@scut.edu.cn; Liao, Shijun [South China University of Technology, School of Chemistry and Chemical Engineering (China)

2016-03-15

Raspberry-shaped composite particles with polystyrene (PSt) as core and poly(n-butyl acrylate-co-acrylic acid) (P(BA–AA)) as corona were synthesized via emulsion polymerization. The random copolymer, P(BA–AA), was pre-prepared and used as a polymeric surfactant, its emulsifying properties adjusted by changing the mass ratio of BA and AA. The morphology of the resulting core–corona composite particles, P(St/P(BA–AA)), could be regulated and controlled by varying the concentrations of P(BA–AA) or the mass ratio of BA:AA in P(BA–AA). The experimental results indicate that 3.0–6.0 wt% of P(BA–AA) is required to obtain stable composite emulsions, and P(BA–AA) with a mass ratio of BA:AA = 1:2 is able to generate distinct core–corona structures. A mechanism of composite particle formation is proposed based on the high affinity between the PSt core and the hydrophobic segments of P(BA–A). The regular morphology of the colloidal film is expected to facilitate potential application of core–corona particles in the field of light scattering. Furthermore, the diversity of core–corona particles can be expanded by replacing P(BA–AA) corona particles with other amphiphilic particles.

Microstructure, mechanical properties and texture of an AA6061/AA5754 composite fabricated by cross accumulative roll bonding

Energy Technology Data Exchange (ETDEWEB)

Verstraete, K., E-mail: kevin.verstraete@u-psud.fr [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Helbert, A.L. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Brisset, F. [Université Paris-Sud, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Benoit, A.; Paillard, P. [Institut des Matériaux Jean Rouxel (IMN), UMR 6502, Polytech’Nantes, Nantes Cedex (France); Baudin, T. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France)

2015-07-29

AA6061 alloy is a widely used material in the automotive and aerospace industries, but is prone to hot cracking, which limits its weldability. To prevent this phenomenon, the AA6061/AA5754 composite was formed using a severe plastic deformation technique, Cross Accumulative Roll Bonding (CARB), at an elevated temperature (350 °C) to ensure good bonding between layers. This technique was efficient to maintain a small grain size, even under the process temperature conditions, and consequently, preserve good mechanical properties. The composite had better mechanical properties than the initial aluminium alloys. Microstructure and texture remained stable after two cycles and yield stress tended towards an equal value in the rolling and the transverse directions. After two cycles, the main component was the {001}〈110〉 rotated Cube, which was maintained for up to 10 cycles. Diffusion was more effective as the strain increased. Finally, a tungsten inert gas (TIG) welding process was performed on the composite and confirmed resistance to hot cracking.

Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo

Directory of Open Access Journals (Sweden)

Jing Y

2018-04-01

Full Text Available Yue Jing,1,2,* Gang Wang,1,* Qi Xiao,1 Yachun Zhou,1 Yingjie Wei,3 Zhunan Gong1 1Center for New Drug Research and Development, College of Life Science, Nanjing Normal University, Nanjing, China; 2Central Laboratory of Stomatology, Nanjing Stomatological Hospital, Medical School of Nanjing University, Nanjing, China; 3Key Laboratory of Oral Drug Delivery System of Chinese Materia Medica of State Administration of Traditional Chinese Medicine, Jiangsu Branch of China Academy of Chinese Medical Science, Nanjing, China *These authors contributed equally to this work Abstract: Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA has demonstrated anticancer properties and we suspect this might be attributable to an effect on angiogenesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl-L-proline methyl ester (AA-PMe, has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. Methods: In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs. First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline

Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease

Science.gov (United States)

Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi

2008-01-01

AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were different from those of the liver with regard to molecular weight and shape and had greater transmissibility. The infectious activity of fecal AA amyloid fibrils was reduced or abolished by the protein denaturants 6 M guanidine·HCl and formic acid or by AA immunodepletion. Thus, we propose that feces are a vehicle of transmission that may accelerate AA amyloidosis in captive cheetah populations. These results provide a pathogenesis for AA amyloidosis and suggest possible measures for rescuing cheetahs from extinction. PMID:18474855

The Impedance of Multi-layer Vacuum Chambers

CERN Document Server

Vos, L

2003-01-01

Many components of the LHC vacuum chamber have multi-layered walls : the copper coated cold beam screen, the titanium coated ceramic chamber of the dump kickers, the ceramic chamber of the injection kickers coated with copper stripes, only to name a few. Theories and computer programs are available for some time already to evaluate the impedance of these elements. Nevertheless, the algorithm developed in this paper is more convenient in its application and has been used extensively in the design phase of multi-layer LHC vacuum chamber elements. It is based on classical transmission line theory. Closed expressions are derived for simple layer configurations, while beam pipes involving many layers demand a chain calculation. The algorithm has been tested with a number of published examples and was verified with experimental data as well.

Measurements of quadrupole frequency shift in the SPS at 26 GeV/c

CERN Document Server

Bohl, T; Shaposhnikova, E; Tückmantel, Joachim; CERN. Geneva. AB Department

2008-01-01

Measurements of the quadrupole frequency shift with intensity at 26 GeV/c using the peak detected signal were performed in the SPS from 1999 to monitor the evolution of the low-frequency longitudinal impedance [1]. While the large changes, first, due to the impedance reduction and then due to the re-installation of the MKE kickers,are easy to see, to observe small variations of impedance (as shielding or removal of a few kickers) much higher accuracy of measurements is required. This was difficult to achieve so far, mainly due to the insufficient reproducibility of the longitudinal parameters of the injected beam for different intensities as well as for different MDs. In this Note the important role of longitudinal emittance in addition to the bunch length is also revealed.

Large magnetoresistance in (AA')2FeReO6 double perovskites

International Nuclear Information System (INIS)

Teresa, J.M. de; Serrate, D.; Blasco, J.; Ibarra, M.R.; Morellon, L.

2005-01-01

We review the main structural, magnetic and magnetotransport properties of the intriguing (AA') 2 FeReO 6 magnetic double perovskites. As the average cation size decreases, the crystallographic structure at room temperature evolves from cubic [(AA') 2 =Ba 2 , Ba 1.5 Sr 0.5 , BaSr, Ba 0.5 Sr 1.5 ] to tetragonal [(AA') 2 =Sr 2 ] and monoclinic [(AA') 2 =Ca 0.5 Sr 1.5 , CaSr, Ca 1.5 Sr 0.5 , Ca 2 ]. The Curie temperature increases anomalously from ∼303K for Ba 2 to ∼522K for Ca 2 in sharp contrast with the observed behaviour in the isostructural compounds (AA') 2 FeMoO 6 . Other anomalous features in the (AA') 2 FeReO 6 series are: the large magnetic anisotropy, the large magnetoelastic coupling and the semiconducting behaviour of the monoclinic compounds. The monoclinic compounds undergo a structural/magnetic transition at T S below 125K. Three different magnetoresistance mechanisms have been identified: the intergrain negative magnetoresistance effect, which is present across the whole series of compounds, and in the case of the monoclinic compounds below T S a negative magnetoresistance effect associated to the melting of the low-temperature phase and a positive magnetoresistance effect only present in (AA') 2 =Ca 2 below T∼50K

The Drentsche Aa valley system

International Nuclear Information System (INIS)

Gans, W. de.

1981-01-01

This thesis is composed of five papers concerned with Late Quaternary geology and geomorphology of the Aa valley system. The correlation and chronostratigraphic position of the layers have been established by radiocarbon dating. (Auth.)

AaERF1 positively regulates the resistance to Botrytis cinerea in Artemisia annua.

Directory of Open Access Journals (Sweden)

Xu Lu

Full Text Available Plants are sessile organisms, and they can not move away under abiotic or biotic stresses. Thus plants have evolved a set of genes that response to adverse environment to modulate gene expression. In this study, we characterized and functionally studied an ERF transcription factor from Artemisia annua, AaERF1, which plays an important role in biotic stress responses. The AaERF1 promoter had been cloned and GUS staining results of AaERF1 promoter-GUS transgenic A. annua showed that AaERF1 is expressed ubiquitiously in all organs. Several putative cis-acting elements such as W-box, TGA-box and Py-rich element, which are involved in defense responsiveness, are present in the promoter. The expression of AaERF1 can be induced vigorously by methyl jasmonate as well as by ethephon and wounding, implying that AaERF1 may activate some of the defense genes via the jasmonic acid and ethylene signaling pathways of A. annua. The results of electrophoretic mobility shift assay (EMSA and yeast one-hybrid experiments showed that AaERF1 was able to bind to the GCC box cis-acting element in vitro and in yeast. Ectopic expression of AaERF1 could enhance the expression levels of the defense marker genes PLANT DEFENSIN1.2 (PDF1.2 and BASIC CHITINASE (ChiB, and increase the resistance to Botrytis cinerea in the 35S::AaERF1 transgenic Arabidopsis. The down-regulated expression level of AaERF1 evidently reduced the resistance to B. cinerea in A. annua. The overall results showed that AaERF1 positively regulated the resistance to B. cinerea in A. annua.

Direct microcomputer controlled determination of zinc in human serum by flow injection atomic absorption spectrometry

DEFF Research Database (Denmark)

Simonsen, Kirsten Wiese; Nielsen, Bent; Jensen, Arne

1986-01-01

A procedure is described for the direct determination of zinc in human serum by fully automated, microcomputer controlled flow injection atomic absorption spectrometry (Fl-AAS). The Fl system is pumpless, using the negative pressure created by the nebuliser. It only consists of a three-way valve......, programmable from the microcomputer, to control the sample volume. No pre-treatment of the samples is necessary. The limit of detection is 0.14 mg l–1, and only small amounts of serum (

AA amyloidosis complicating the hereditary periodic fever syndromes.

Science.gov (United States)

Lane, Thirusha; Loeffler, Jutta M; Rowczenio, Dorota M; Gilbertson, Janet A; Bybee, Alison; Russell, Tonia L; Gillmore, Julian D; Wechalekar, Ashutosh D; Hawkins, Philip N; Lachmann, Helen J

2013-04-01

AA amyloidosis is a life-threatening complication of the hereditary periodic fever syndromes (HPFS), which are otherwise often compatible with normal life expectancy. This study was undertaken to determine the characteristics, presentation, natural history, and response to treatment in 46 patients who had been referred for evaluation at the UK National Amyloidosis Centre. Disease activity was monitored by serial measurement of serum amyloid A. Renal function was assessed by measurement of serum creatinine and albumin levels, the estimated glomerular filtration rate, and proteinuria from 24-hour urine collections. The amyloid load was measured by serum amyloid P scintigraphy. Twenty-four patients had familial Mediterranean fever, 12 patients had tumor necrosis factor receptor-associated periodic syndrome, 6 patients had cryopyrin-associated periodic syndromes, and 4 patients had mevalonate kinase deficiency. The median age at onset of HPFS was 5 years; median age at presentation with AA amyloidosis was 38 years. Diagnosis of an HPFS had not been considered prior to presentation with AA amyloidosis in 23 patients (50%). Eleven patients (24%) had end-stage renal failure (ESRF) at presentation; of these, 3 had received transplants prior to referral. A further 13 patients developed ESRF over the followup period, with 10 undergoing renal transplantation. The median time to progression to ESRF from onset of AA amyloidosis was 3.3 years (interquartile range [IQR] 2-8), with a median time to transplant of 4 years (IQR 3-6). Eleven patients (24%) died. The median survival in the entire cohort was 19 years from diagnosis of AA amyloidosis. Of the 37 patients who were treated successfully, or in whom at least partial suppression of the underlying HPFS was achieved, 17 (46%) showed amyloid regression, 14 (38%) showed a stable amyloid load, and 2 (5%) showed increased amyloid deposition over the followup period. AA amyloidosis remains a challenging and serious late complication

Failure analysis of fusion clad alloy system AA3003/AA6xxx sheet under bending

Energy Technology Data Exchange (ETDEWEB)

Shi, Y., E-mail: shiyh@mcmaster.ca [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Jin, H. [Novelis Global Technology Center, P.O. Box 8400, Kingston, Ontario, Canada K7L 5L9 (Canada); Wu, P.D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Lloyd, D.J. [Aluminum Materials Consultants, 106 Nicholsons Point Road, Bath, Ontario, Canada K0H 1G0 (Canada); Embury, D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada)

2014-07-29

An ingot of AA6xxx Al–Si–Mg–Cu alloy clad with AA3003 Al–Mn alloy was co-cast by Fusion technology. Bending tests and numerical modeling were performed to investigate the potential for sub-surface cracking for this laminate system. To simulate particle-induced crack initiation and growth, both random and stringer particles have been selected to mimic the particle distribution in the tested samples. The morphology of cracking in the model was similar to that observed in clad sheet tested in the Cantilever bend test. The crack initiated in the core close to the clad-core interface where the strain in the core is highest, between particles or near particles and propagates along local shear bands in the core, while the clad layer experiences extreme thinning before failure.

An Analysis of the Rise and Fall of the AA-MAS Policy

Science.gov (United States)

Lazarus, Sheryl S.; Thurlow, Martha L.; Ysseldyke, James E.; Edwards, Lynn M.

2015-01-01

In 2005, to address concerns about students who might fall in the "gap" between the regular assessment and the alternate assessment based on alternate achievement standards (AA-AAS), the U.S. Department of Education announced that states could develop alternate assessments based on modified achievement standards (AA-MAS). This article…

Modelling and Pareto optimization of mechanical properties of friction stir welded AA7075/AA5083 butt joints using neural network and particle swarm algorithm

International Nuclear Information System (INIS)

Shojaeefard, Mohammad Hasan; Behnagh, Reza Abdi; Akbari, Mostafa; Givi, Mohammad Kazem Besharati; Farhani, Foad

2013-01-01

Highlights: ► Defect-free friction stir welds have been produced for AA5083-O/AA7075-O. ► Back-propagation was sufficient for predicting hardness and tensile strength. ► A hybrid multi-objective algorithm is proposed to deal with this MOP. ► Multi-objective particle swarm optimization was used to find the Pareto solutions. ► TOPSIS is used to rank the given alternatives of the Pareto solutions. -- Abstract: Friction Stir Welding (FSW) has been successfully used to weld similar and dissimilar cast and wrought aluminium alloys, especially for aircraft aluminium alloys, that generally present with low weldability by the traditional fusion welding process. This paper focuses on the microstructural and mechanical properties of the Friction Stir Welding (FSW) of AA7075-O to AA5083-O aluminium alloys. Weld microstructures, hardness and tensile properties were evaluated in as-welded condition. Tensile tests indicated that mechanical properties of the joint were better than in the base metals. An Artificial Neural Network (ANN) model was developed to simulate the correlation between the Friction Stir Welding parameters and mechanical properties. Performance of the ANN model was excellent and the model was employed to predict the ultimate tensile strength and hardness of butt joint of AA7075–AA5083 as functions of weld and rotational speeds. The multi-objective particle swarm optimization was used to obtain the Pareto-optimal set. Finally, the Technique for Order Preference by Similarity to the Ideal Solution (TOPSIS) was applied to determine the best compromised solution.

Determination of As(III) and As(V) by Flow Injection-Hydride Generation-Atomic Absorption Spectrometry via On-line Reduction of As(V) by KI

DEFF Research Database (Denmark)

Nielsen, Steffen; Hansen, Elo Harald

1997-01-01

A volume-based flow injection (FI) procedure is described for the determination and speciation of trace inorganic arsenic, As(III) and As(V), via hydride generation-atomic absorption spectrometry (HG-AAS) of As(III). The determination of total arsenic is obtained by on-line reduction of As(V) to As...

INAA and flame AAS of various vegetable reference materials

International Nuclear Information System (INIS)

Djingova, R.; Arpadjan, S.; Kuleff, I.

1991-01-01

INAA and flame AAS have been used for the analysis of a large number of vegetable reference materials. Out of all determined elements (28 by INAA and 11 by AAS) nine are common for both methods (Ca, Cd, Co, Cu, Fe, Mg, Mn, Na, Zn) and for these the possibilities of the two methods have been compared. (orig.)

PDGF-AA-induced filamentous mitochondria benefit dermal papilla cells in cellular migration.

Science.gov (United States)

Mifude, C; Kaseda, K

2015-06-01

Human dermal papilla cells (HDPCs) play essential roles in hair follicular morphogenesis and postnatal hair growth cycles. Previous reports demonstrated that platelet-derived growth factor-AA (PDGF-AA) enhanced the formation of dermal condensates in hair follicular development. Additionally, PDGF-AA induces/maintains the anagen phase of the hair cycle. It is likely that mitochondrial morphology and functions are tightly coupled with maintenance of these energy-demanding activities. However, little is known about the mitochondrial regulation in HDPCs. Thus, we investigated the PDGF-involved mitochondrial regulation in HDPCs. The mitochondrial morphologies of HDPCs were examined in the presence or absence of PDGF-AA under a fluorescent microscope. ATP production and cellular motility were investigated. The relationship between mitochondrial morphology and the cellular functions was discussed. We observed that primary HDPCs contained mitochondria with filamentous and/or rounded morphologies. Both types of mitochondria showed similar membrane potentials. Interestingly, in the presence of PDGF-AA, but not PDGF-BB, the balance between the two morphologies shifted towards the filamentous form. Concomitantly, both mitochondrial enzymatic activity and total cellular ATP level were augmented by PDGF-AA. These two parameters were closely correlated, suggesting the mitochondrial involvement in the PDGF-augmented ATP production. Moreover, PDGF-AA accelerated the migration of HDPCs in a gap-filling assay, but did not change the rate of cellular proliferation. Notably, filamentous mitochondria dominated migrating HDPCs. PDGF-AA benefits HDPCs in the process of migration, by increasing the number of filamentous mitochondria. © 2014 Society of Cosmetic Scientists and the Société Française de Cosmétologie.

Determination of trace amounts of cadmium in zirconium and its alloys by graphite furnace AAS

International Nuclear Information System (INIS)

Takashima, Kyoichiro; Toida, Yukio

1994-01-01

Trace amount of cadmium in zirconium and its alloys was determined by graphite furnace atomic absorption spectrometry (GF-AAS) after ion exchange separation. A 2g chip sample was decomposed with 20ml of hydrofluoric acid (1+9) and a few drops of nitric acid. A trace amount of cadmium was separated from zirconium by strongly acidic cation-exchange resin (MCI GEL CK 08P) using 50ml of hydrochloric acid as an eluent. The solution was gently evaporated to dryness on an electric hot plate heater and under an infrared lamp. The residue was dissolved in 1ml of nitric acid (1+14) and diluted to 10ml in a volumetric glass flask with distilled water. Ten microliters of this solution was injected into a graphite furnace and then atomized at 2200degC for 4s in argon at a flow rate of 3.0l/min. Acids used in the analytical procedure were purified by azeotropic distillation and cation-exchange resin. The limit of determination (3σ BK ) for cadmium was 0.5ngCd/g and the relative standard deviation (RSD) at 1ngCd/g level was less than 20% for the GF-AAS. The accuracy of this technique was confirmed by NIST SRM 1643b (trace elements in water). (author)

[A review for recent advances in AA amyloid research and therapeutic approach to AA amyloidosis complicating rheumatoid arthritis].

Science.gov (United States)

Tamura, Hiroaki; Hasegawa, Kiminori

2009-02-01

AA amyloidosis is a life threatening clinical complication of chronic inflammatory diseases such as rheumatoid arthritis. It has been demonstrated biochemically that amyloidosis resulted from abnormal folding of proteins, which are deposited as insoluble fibrils in extracellular tissue, leading to the disruption of their normal function. In this regard, amyloidosis has been recognized as a conformation disorder. Interestingly, genetic polymorphisms of amyloid precursor protein (SAA) have been reported to associate with increased risk for AA amyloidosis. Also recent biochemical research revealed that SAA is synthesized under the influence of the proinflammatory cytokines, such as IL-6, TNF-alpha, IL-1. Additionally, it was suggested that amyloid deposits in extracellular tissue could reflect to the serum level of SAA in the reversible fashion, leading to the hypothesis that the control of the SAA synthesis could be beneficial to the treatment of amyloidosis. In this context, anti-cytokine therapies may be most effective. Especially the inhibition of IL-6 is critical to suppression of SAA production, so treatment with a humanized monoclonal antibody against human IL-6 receptor may not only ameliorate RA disease activity but also pave the way for the treatment of AA amyloidosis.

Yield and flow properties of aluminum alloy AA 8001

International Nuclear Information System (INIS)

Lyons, J.S.; Johnson, H.W.; Han, E.G.

1995-01-01

Aluminum alloy AA 8001 is being used at the Westinghouse Savannah River Company (WSRC) for nuclear reactor fuel and target components. The objective of this research was to determine parameters for predictive models of the compressive flow properties of AA 8001. Seventy-five true strain-rate, hot compression tests were performed. New, quantitative information about the yield and flow behavior of aluminum alloy AA 8001 was determined. Parameters were determined to use in a hyperbolic sine constitutive law so that the yield stress, the peak stress, and the peak strain can be predicted from the temperature-compensated strain-rate, Z. It was found that the onset of strain softening was more strongly dependent on Z than the onset of yielding was

Absorption spectra of AA-stacked graphite

International Nuclear Information System (INIS)

Chiu, C W; Lee, S H; Chen, S C; Lin, M F; Shyu, F L

2010-01-01

AA-stacked graphite shows strong anisotropy in geometric structures and velocity matrix elements. However, the absorption spectra are isotropic for the polarization vector on the graphene plane. The spectra exhibit one prominent plateau at middle energy and one shoulder structure at lower energy. These structures directly reflect the unique geometric and band structures and provide sufficient information for experimental fitting of the intralayer and interlayer atomic interactions. On the other hand, monolayer graphene shows a sharp absorption peak but no shoulder structure; AA-stacked bilayer graphene has two absorption peaks at middle energy and abruptly vanishes at lower energy. Furthermore, the isotropic features are expected to exist in other graphene-related systems. The calculated results and the predicted atomic interactions could be verified by optical measurements.

On-line dynamic extraction and automated determination of readily bioavailable hexavalent chromium in solid substrates using micro-sequential injection bead-injection lab-on-valve hyphenated with electrothermal atomic absorption spectrometry

DEFF Research Database (Denmark)

Long, Xiangbao; Miró, Manuel; Hansen, Elo Harald

2006-01-01

A novel and miniaturized micro-sequential injection bead injection lab-on-valve (μSI-BI-LOV) fractionation system was developed for in-line microcolumn soil extraction under simulated environmental scenarios and accurate monitoring of the content of easily mobilisable hexavalent chromium in soil...... environments at the sub-low parts-per-million level. The flow system integrates dynamic leaching of hexavalent chromium using deionized water as recommended by the German Standard DIN 38414-S4 method; on-line pH adjustment of the extract by a 0.01 mol L-1 Tris-HNO3 buffer solution; isolation of the chromate...... polluted agricultural soil material (San Joaquin Soil-Baseline Trace Element Concentrations) with water-soluble Cr(VI) salts at different concentration levels. The potential of the μSI-BI-LOV set-up with renewable surfaces for flame-AAS determination of high levels of readily bioavailable chromate...

Association between AA-NAT gene polymorphism and reproductive performance in sheep

OpenAIRE

Ding-ping,Bai; Cheng-jiang,Yu; Yu-lin,Chen

2012-01-01

Arylalkylamine N-acetyltransferase (AA-NAT) is critical enzyme in Melatonin (MLT) biosynthesis for MLT regulating the animal seasonal breeding. In this study, DNA sequencing methods were applied to detect the polymorphisms of the AA-NAT gene in 179 Chinese sheep belonging to two non-seasonal reproduction breeds and two seasonal reproduction breeds. One mutation at exon 3 (NM_001009461:c.486A > G) was firstly described at the sheep AA-NAT locus. Hence, we described the SmaI PCR-RFLP m...

Systemic AA amyloidosis in the red fox (Vulpes vulpes).

Science.gov (United States)

Rising, Anna; Cederlund, Ella; Palmberg, Carina; Uhlhorn, Henrik; Gaunitz, Stefan; Nordling, Kerstin; Ågren, Erik; Ihse, Elisabet; Westermark, Gunilla T; Tjernberg, Lars; Jörnvall, Hans; Johansson, Jan; Westermark, Per

2017-11-01

Amyloid A (AA) amyloidosis occurs spontaneously in many mammals and birds, but the prevalence varies considerably among different species, and even among subgroups of the same species. The Blue fox and the Gray fox seem to be resistant to the development of AA amyloidosis, while Island foxes have a high prevalence of the disease. Herein, we report on the identification of AA amyloidosis in the Red fox (Vulpes vulpes). Edman degradation and tandem MS analysis of proteolyzed amyloid protein revealed that the amyloid partly was composed of full-length SAA. Its amino acid sequence was determined and found to consist of 111 amino acid residues. Based on inter-species sequence comparisons we found four residue exchanges (Ser31, Lys63, Leu71, Lys72) between the Red and Blue fox SAAs. Lys63 seems unique to the Red fox SAA. We found no obvious explanation to how these exchanges might correlate with the reported differences in SAA amyloidogenicity. Furthermore, in contrast to fibrils from many other mammalian species, the isolated amyloid fibrils from Red fox did not seed AA amyloidosis in a mouse model. © 2017 The Protein Society.

Chang'aa Drinking in Kibera Slum: The Harmful Effects of ...

African Journals Online (AJOL)

Chang'aa Drinking in Kibera Slum: The Harmful Effects of Contemporary Changes in the Production and Consumption of Traditional Spirits. ... African Journal of Drug and Alcohol Studies ... This article examines the harmful effects of drinking chang'aa, an illegal spirit produced locally, in Kibera slum in Nairobi, Kenya.

Changes in depression mediate the effects of AA attendance on alcohol use outcomes.

Science.gov (United States)

Wilcox, Claire E; Tonigan, J Scott

2018-01-01

Depression may contribute to increased drinking in individuals with alcohol use disorder. Although Alcoholics Anonymous (AA) attendance predicts drinking reductions, there is conflicting information regarding the intermediary role played by reductions in depression. We explored whether AA attendance reduces depressive symptoms, the degree to which improvement in depression results in reductions in drinking, and in which subgroups these effects occur. 253 early AA affiliates (63% male) were recruited and assessed at baseline 3, 6, 9, 12, 18, and 24 months. Depression was measured using the Beck Depression Inventory (BDI) and was administered at baseline 3, 6, 12, 18, and 24 months. AA attendance and alcohol use outcomes were obtained with the Form 90. Mediation analyses were performed at early (3, 6, and 9 months) and late (12, 18, and 24 months) follow-up to investigate the degree to which reductions in depression mediated the effect of AA attendance on drinking, controlling for concurrent drinking. In addition, a series of moderated mediation analyses were performed using baseline depression severity as a moderator. At early follow-up, reductions in depression (6 months) mediated the effects of AA attendance (3 months) on later drinking (drinks per drinking day) (9 months) (b = -0.02, boot CI [-0.055, -0.0004]), controlling for drinking at 6 months. Baseline depression severity did not moderate the degree to which BDI mediated the effects of AA attendance on alcohol use (ps > .05). These findings provide further evidence that depression reduction is a mechanism by which AA attendance leads to reductions in alcohol use. Improving depression may help reduce alcohol use in individuals with AUD, and AA attendance may be an effective way to achieve that goal.

Wide-range voltage modulation

International Nuclear Information System (INIS)

Rust, K.R.; Wilson, J.M.

1992-06-01

The Superconducting Super Collider's Medium Energy Booster Abort (MEBA) kicker modulator will supply a current pulse to the abort magnets which deflect the proton beam from the MEB ring into a designated beam stop. The abort kicker will be used extensively during testing of the Low Energy Booster (LEB) and the MEB rings. When the Collider is in full operation, the MEBA kicker modulator will abort the MEB beam in the event of a malfunction during the filling process. The modulator must generate a 14-μs wide pulse with a rise time of less than 1 μs, including the delay and jitter times. It must also be able to deliver a current pulse to the magnet proportional to the beam energy at any time during ramp-up of the accelerator. Tracking the beam energy, which increases from 12 GeV at injection to 200 GeV at extraction, requires the modulator to operate over a wide range of voltages (4 kV to 80 kV). A vacuum spark gap and a thyratron have been chosen for test and evaluation as candidate switches for the abort modulator. Modulator design, switching time delay, jitter and pre-fire data are presented

The PS Booster, PS and SPS Magnets for the next 25 years

CERN Document Server

Tommasini, D

2010-01-01

This note provides information and analysis on the present status of the magnets installed in the CERN Proton Synchrotron Booster (PSB), the Proton Synchrotron (PS) and the Super Proton Synchrotron (SPS) in view of their possible operation for the next 25 years. The note does not cover the magnets installed in the transfer lines, neither it covers the fast injection/extraction magnets (septa and kickers).

Preparation and Characteristics of Corn Straw-Co-AMPS-Co-AA Superabsorbent Hydrogel

Directory of Open Access Journals (Sweden)

Wei-Min Cheng

2015-11-01

Full Text Available In this study, the corn straw after removing the lignin was grafted with 2-acrylamido-2-methylpropanesulfonic acid (AMPS to prepare sulfonated cellulose. The grafting copolymerization between the sulfonated cellulose and acrylic acid (AA was performed using potassium persulfate and N,N′-methylenebisacrylamide as the initiator and crosslinking agent, respectively, to prepare corn straw-co-AMPS-co-AA hydrogels. The structure and properties of the resulting hydrogels were characterized by Fourier transform infrared spectroscopy, X-ray diffraction, scanning electron microscopy, thermogravimetric analysis, and dynamic rheometry. The effects of initiator, crosslinker, monomer neutralization degree, and temperature on the swelling ratio of the hydrogels were studied. The water retention, salt resistance, and recyclability of the corn straw-co-AMPS-co-AA hydrogels were also investigated. The optimum water absorptivity of the corn straw hydrogels was obtained at a polymerization temperature of 50 °C with 1.2% crosslinker, 1:7 ratio of the pretreated corn straw and AA, 2% initiator, and 50% neutralized AA.

INVESTIGATION OF EFFECT OF COOLING CONDITIONS ON HARDNESS OF THE AA 2024 AND AA 2014 WROUGHT ALUMINIUM ALLOYS

Directory of Open Access Journals (Sweden)

Hülya KAÇAR DURMUŞ

2003-01-01

Full Text Available Mechanical properties of some aluminum alloys can be changed with precipitation hardening. This intermetallic precipitates are incoherent with the main structure and increased mechanical properties. Cooling rates after solid solution process effects properties after precipitation. In applications, however this is not taken into consideration. In this study, AA 2014 and AA 2024 Aluminium Alloy specimens were hold for one hour at 495±3 0C and formed a solid solution. Specimens were quenched at this temperature with different cooling rtes . later artificial aging was applied at 150 0C and 180 0C. The hardness and microstructure variations of the specimens were investigated depending on the cooling rates and artificial aging temperatures.

AA, bending magnet, BLG

CERN Multimedia

CERN PhotoLab

1980-01-01

The very particular lattice of the AA required 2 types of dipole (bending magnets; BLG, long and narrow; BST, short and wide). The BLG had a steel length of 4.70 m, a good field width of 0.24 m, and a weight of about 70 t. Jean-Claude Brunet inspects the lower half of a BLG. For the BST magnets see 7811105 and 8006036.

Microstructural characterization of fly ash particulate reinforced AA6063 aluminium alloy for aerospace applications

Science.gov (United States)

Razzaq, A. M.; Majid, D. L. Abang Abdul; Ishak, M. R.; Uday, M. B.

2017-12-01

Aluminium-fly ash (FA) particulate reinforced composites (AA6063-FA) have been used in automotive and aerospace industries because of their low density and good mechanical properties. Three different weight fraction of FA: 2%, 4% and 6% are added to AA6063 alloy using compocasting method. The effect of FA particulates on microstructure, density and compression strength of AA6063- FA composites are investigated. Field Emission Scanning Electron Microscope (FESEM) micrographs reveal that the FA particulates are uniformly distributed in AA6063 alloy. The results also show that density, compression strength and microstructure of the AA6063-FA composites are significantly influenced by the FA amount. The increase in the weight fraction of FA will improve the microstructure and enhance the compression strength. The density of AA6063-FA composites decreases as the incorporation of FA increases.

AAS 227: Day 1

Science.gov (United States)

Kohler, Susanna

2016-01-01

Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto

Efficacy of etanercept in patients with AA amyloidosis secondary to rheumatoid arthritis.

Science.gov (United States)

Nakamura, T; Higashi, S; Tomoda, K; Tsukano, M; Baba, S

2007-01-01

The efficacy of biological therapies in rheumatoid arthritis (RA) is well known, but their hypothetical benefit in amyloid A (AA) amyloidosis secondary to RA still remains to be considered. We evaluated the efficacy and safety of etanercept in serum amyloid A (SAA) 1.3 allele Japanese patients with AA amyloidosis secondary to RA. Seven RA patients with histologically confirmed AA amyloidosis and renal involvement who were treated with etanercept were enrolled. They all had the SAA1.3 allele, which has been shown to be a risk factor not only for the association of AA amyloidosis but also for a poor prognosis in Japanese RA patients. Efficacy was assessed as a sustained decrease in RA inflammation and an amelioration of renal function. RA inflammation and AA amyloidosis were improved and stabilized after 43.4 +/- 16.5 weeks. At week 20 the number of tender (p = 0.017) and swollen (p = 0.017) joints, and levels of serum C-reactive protein (p = 0.018) and albumin (p = 0.045) had improved. The values for SAA, serum creatinine, calculated creatinine clearance, and proteinuria also ameliorated. No severe adverse events were observed. One patient eventually had to go on hemodialysis but her tolerance of etanercept remained stable. Etanercept can be used safely and effectively in AA amyloidosis secondary to RA with renal involvement, and is of clinical benefit in the short-term, even in patients on hemodialysis. It appears that SAA1.3 allele may be used as a clinical parameter for the introduction of etanercept in Japanese RA with AA amyloidosis.

Overview of the Antiproton Accumulator (AA)

CERN Multimedia

1982-01-01

See photo 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

A Status Report on the AAS Astronomy Ambassadors Program

Science.gov (United States)

Fienberg, Richard Tresch; Fraknoi, Andrew; Gurton, Suzanne; Hurst, Anna; Schatz, Dennis L.

2014-06-01

The American Astronomical Society, in partnership with the Astronomical Society of the Pacific (ASP), has launched a series of professional-development workshops and a community of practice designed to improve early-career astronomers’ ability to communicate effectively with students and the public. Called AAS Astronomy Ambassadors, the program provides training and mentoring for young astronomers, from advanced undergraduates to beginning faculty; it also provides them access to resources and a network of contacts within the astronomy education and public outreach (EPO) community. Ambassadors are provided with a library of outreach activities and resource materials suitable for a range of venues and audiences. For much of this library we are using resources developed by organizations such as the ASP, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. After a period of evaluation and revision, the program’s “Menu of Outreach Opportunities for Science Education” (MOOSE) is now posted on the AAS website at http://aas.org/outreach/moose-menu-outreach-opportunities-science-education.The first two Astronomy Ambassadors workshops were held at AAS meetings in January 2013 and January 2014; each served 30 young astronomers chosen from about twice that many applicants. Web-based follow-up activities are being provided through a website at the ASP designed to keep cohorts of educators trained in their programs in touch with one another. The AAS is exploring ways to fund additional workshops at future winter meetings; suggestions are most welcome. Meanwhile, the Astronomy Ambassadors trained to date have logged more than 150 outreach events, reaching many thousands of children and adults across the U.S. and Canada.

The Effect of Applied Tensile Stress on Localized Corrosion in Sensitized AA5083

Science.gov (United States)

2015-09-01

corrosion, but if exposed to elevated temperature for prolonged periods of time the alloy becomes sensitized. Since the β phase is more anodic than the...degree of localized corrosion for sensitized AA5083 under an applied tensile stress. AA5083 is an aluminum -magnesium alloy that experiences severe...direction. 14. SUBJECT TERMS Aluminum alloy , AA5083, IGSCC, intergranular stress corrosion cracking, localized corrosion, sensitized aluminum 15

Astrocytes mediated the nootropic and neurotrophic effects of Sarsasapogenin-AA13 via upregulating brain-derived neurotrophic factor.

Science.gov (United States)

Dong, Dong; Mao, Yu; Huang, Cui; Jiao, Qian; Pan, Hui; Ma, Lei; Wang, Rui

2017-01-01

Rhizoma Anemarrhena , a widely used traditional Chinese medicine, has previously been shown to have neuroprotective effect. Sarsasapogenin-AA13 (AA13) is a novel synthetic derivative of Sarsasapogenin, which is extracted from Rhizoma Anemarrhena . The aim of this study is to investigate the nootropic and neurotrophic effects of AA13 and underlying mechanisms. In vitro , cell viability of rat primary astrocytes treated with AA13 and neurons cultured with conditioned medium of AA13-treated rat primary astrocytes was tested by MTT assays. In vivo , a pharmacological model of cognitive impairment induced by scopolamine was employed and spatial memory of the mice was assessed by Morris water maze. This study found that AA13 increased cell viability of primary astrocytes and AA13-treated astrocyte-conditioned medium enhanced the survival rate of primary neurons. Interestingly, AA13 markedly enhanced the level of BDNF in astrocytes. Furthermore, AA13 (6 mg/kg) improved the cognitive deficits in animal models (p<0.05) and BDNF and PSD95 levels were increased in brain. Therefore, we hypothesize that AA13 exerts nootropic and neurotrophic activities through astrocytes mediated upregulation of BDNF secretion. The results suggest that AA13 could be a potential compound for cognitive impairment after further research.

AAS 228: Day 4

Science.gov (United States)

Kohler, Susanna

2016-06-01

a star. Speaking of transits, Kepler was one of the shining stars of this meeting. The original mission observed 150,000 stars continually for months during its first run, as it was designed to be a statistical mission. But can its findings be considered fully complete in planet radii and orbital periods? Joseph Catanzarite (SETI Institute) aims to answer this question by performing numerous simulations (injections) in order to validate our estimations of planet occurrence rates from transit data. During Keplers primary mission, it was relatively easy to identify eclipsing binaries which are a common type of false positive in exoplanet detection owing to the spacecrafts stability. Fergal Mullally (Kepler Science Office) points out that this is not true for K2, due to its continual drift from the pressure of sunlight. They are currently developing dave, a Python program that aims to find and vet planets from K2 data.Mullally: If you think youve found an exoplanet transit in K2 please get in touch with the @NASAKepler team and they will help you! #aas228 Meredith Rawls (@merrdiff) June 16, 2016Another tool being developed for K2 data analysis is Robovetter, which was introduced by Susan Thompson (SETI Institute, NASA Ames). This new software will allow astronomers to fully and uniformly automate the creation of the final KOI (Kepler Object of Interest) catalog. And what about the science being done by K2? Jessie Christiansen (NASA Exoplanet Science Institute, Caltech) explains that it will not look for Earth-like exoplanets, but will instead be more flexible in the types of targets and their positions on the sky, allowing us to build a census of planets in the galactic plane.Black Holes and Supernovae (by Ashley Villar)There are still many open questions about supernovae and their progeny, black holes. Some of these questions will hopefully be answered by LIGO, though many will be solved using the electromagnetic radiation we detect from these sources.Anthony Piro

Adverse effects of doping with anabolic androgenic steroids (AAS) in competitive athletics, recreational sports and bodybuilding.

Science.gov (United States)

Vorona, Elena; Nieschlag, Eberhard

2018-02-19

Despite the fact that sports organizations and legislators have introduced various mechanisms to discourage athletes from using performance and appearance enhancing substances a high percentage of athletes admits to their unabated application. In competitive athletics, bodybuilding and in recreational sports anabolic androgenic steroids (AAS) continue to be the substances most abused. This review summarizes the side effects of AAS abuse on organs and system functions in both sexes. High doses of AAS cause a significant increase of erythrocytes und haemoglobin concentration, which may lead to thromboembolism, intracardiac thrombosis and stroke. Long-term AAS abusers have a higher incidence of arrhythmias, atherosclerosis, concentric left-ventricular myocardial hypertrophy with impaired diastolic function and also sudden cardiac death. Changes of liver function and structure, up to hepatocellular carcinoma, have been described, mainly in cases of chronic misuse of 17α-alkylated AAS. Sleeplessness, increased irritability, depressive mood status are often observed in AAS abuse. In former AAS abusers depression, anxiety and melancholy may persist for many years. Due to negative feedback in the regulation of the hypothalamic-pituitary-gonadal axis AAS can cause reversible suppression of spermatogenesis up to azoospermia. In women the changes most often caused by AAS abuse are hirsutism, irreversible deepening of voice, dysmenorrhoea, secondary amenorrhoea with anovulation and infertility. AAS abuse notwithstanding, under clinical conditions testosterone remains the most important hormone for substitution therapy of male hypogonadism.

Determination of tellurium in lead and lead alloy using flow injection-hydride generation atomic absorption spectrometry

International Nuclear Information System (INIS)

Mesko, Marcia F.; Pozebon, Dirce; Flores, Erico M.M.; Dressler, Valderi L.

2004-01-01

A method based on flow injection-hydride generation atomic absorption spectrometry (FI-HG AAS) for the determination of trace amount of Te in lead and lead alloy is described. A flow injection system (FI) and related analytical parameters as well as Te determination and interference caused by Pb, Bi and Ag on Te were investigated. The Pb interference could be overcome by using a small sample volume, while the Bi interference could be overcome by thiourea. However, it was not possible to minimise the interference caused by Ag on Te. The optimised conditions for Te determination in the analysed samples were: 6 mol l -1 HCl as sample carrier solution, 0.75% (m/v) sodium tetrahydroborate as Te reductant, 40 μl of sample solution, and 200 ml min -1 Ar flow rate as carrier gas. The limit of quantification (LOQ) was 1.0 μg g -1 Te (using 250 mg of sample in 50 ml final solution), the limit of detection (LOD) was 2.5 μg l -1 and the relative standard deviation (RSD) was 6% for five consecutive measurements of sample solution. The standard addition calibration method was used. Relatively high sample throughput (ca. 45 sample runs can be performed in a working hour), reduced sample manipulation since matrix separation is not necessary, and minor waste generation are the main advantages of the proposed method for Te determination by FI-HG AAS

76 FR 6794 - 30-Day Submission Period for Requests for ONC-Approved Accreditor (ONC-AA) Status

Science.gov (United States)

2011-02-08

... Accreditor (ONC-AA) Status AGENCY: Office of the National Coordinator for Health Information Technology... submission of requests for ONC-Approved Accreditor (ONC-AA) status. Authority: 42 U.S.C. 300jj-11. DATES: The... for ONC-AA status may be submitted. The 30-day period for submission of requests for ONC-AA status...

AAS 228: Day 3 afternoon

Science.gov (United States)

Kohler, Susanna

2016-06-01

Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our

Effects of chronic ethanol ingestion on arachidonic acid (AA) metabolism in rat macrophages

International Nuclear Information System (INIS)

Chanmugam, P.; Boudreau, M.; Hymel, G.; Jeffers, G.; Hwang, D.H.

1986-01-01

In a previous report, preincubation of rat platelets with ethanol resulted in dose dependent inhibition of AA metabolites whereas chronic ingestion of ethanol enhanced the synthesis of AA metabolites. Thus, the authors studied whether chronic ethanol ingestion also affects AA metabolism in MACS. Two groups of rats (10 each) were fed DeCarli/Lieber liquid diet containing 36 caloric % ethanol for 3 weeks. The control group was pair fed the same diet made isocaloric with dextrin-maltose. Resident MACS were collected by peritoneal lavage. The monolayers of MACS were incubated for 20 min with calcium ionophore (5μg/ml), and the incubation stopped with 4 vol. of ethanol. PGE 2 , LTB 4 and 5-HETE were assayed by radioimmunoassay. The results indicated that chronic ethanol ingestion did not affect the capacity of MACS to synthesize AA metabolites. There was also no difference in the levels of AA metabolites in heart and lung homogenates between the two groups

Coarsening of AA6013-T6 Precipitates During Sheet Warm Forming Applications

Science.gov (United States)

Di Ciano, M.; DiCecco, S.; Esmaeili, S.; Wells, M. A.; Worswick, M. J.

2018-03-01

The use of warm forming for AA6xxx-T6 sheet is of interest to improve its formability; however, the effect warm forming may have on the coarsening of precipitates and the mechanical strength of these sheets has not been well studied. In this research, the coarsening behavior of AA6013-T6 precipitates has been explored, in the temperature range of 200-300 °C, and time of 30 s up to 50 h. Additionally, the effect of warm deformation on coarsening behavior was explored using: (1) simulated warm forming tests in a Gleeble thermo-mechanical simulator and (2) bi-axial warm deformation tests. Using a strong obstacle model to describe the yield strength (YS) evolution of the AA6013-T6 material, and a Lifshitz, Slyozov, and Wagner (LSW) particle coarsening law to describe the change in precipitate size with time, the coarsening kinetics were modeled for this alloy. The coarsening kinetics in the range of 220-300 °C followed a trend similar to that previously found for AA6111 for the 180-220 °C range. There was strong evidence that coarsening kinetics were not altered due to warm deformation above 220 °C. For warm forming between 200 and 220 °C, the YS of the AA6013-T6 material increased slightly, which could be attributed to strain hardening during warm deformation. Finally, a non-isothermal coarsening model was used to assess the potential reduction in the YS of AA6013-T6 for practical processing conditions related to auto-body manufacturing. The model calculations showed that 90% of the original AA6013-T6 YS could be maintained, for warm forming temperatures up to 280 °C, if the heating schedule used to get the part to the warm forming temperature was limited to 1 min.

Dipyrone metabolite 4-MAA induces hypothermia and inhibits PGE2 -dependent and -independent fever while 4-AA only blocks PGE2 -dependent fever.

Science.gov (United States)

Malvar, David do C; Aguiar, Fernando A; Vaz, Artur de L L; Assis, Débora C R; de Melo, Miriam C C; Jabor, Valquíria A P; Kalapothakis, Evanguedes; Ferreira, Sérgio H; Clososki, Giuliano C; de Souza, Glória E P

2014-08-01

The antipyretic and hypothermic prodrug dipyrone prevents PGE2 -dependent and -independent fever induced by LPS from Escherichia coli and Tityus serrulatus venom (Tsv) respectively. We aimed to identify the dipyrone metabolites responsible for the antipyretic and hypothermic effects. Male Wistar rats were treated i.p. with indomethacin (2 mg·kg(-1) ), dipyrone, 4-methylaminoantipyrine (4-MAA), 4-aminoantipyrine (4-AA) (60-360 mg·kg(-1) ), 4-formylaminoantipyrine, 4-acethylaminoantipyrine (120-360 mg·kg(-1) ) or vehicle 30 min before i.p. injection of LPS (50 μg·kg(-1) ), Tsv (150 μg·kg(-1) ) or saline. Rectal temperatures were measured by tele-thermometry and dipyrone metabolite concentrations determined in the plasma, CSF and hypothalamus by LC-MS/MS. PGE2 concentrations were determined in the CSF and hypothalamus by elisa. In contrast to LPS, Tsv-induced fever was not followed by increased PGE2 in the CSF or hypothalamus. The antipyretic time-course of 4-MAA and 4-AA on LPS-induced fever overlapped with the period of the highest concentrations of 4-MAA and 4-AA in the hypothalamus, CSF and plasma. These metabolites reduced LPS-induced fever and the PGE2 increase in the plasma, CSF and hypothalamus. Only 4-MAA inhibited Tsv-induced fever. The higher doses of dipyrone and 4-MAA also induced hypothermia. The presence of 4-MAA and 4-AA in the CSF and hypothalamus was associated with PGE2 synthesis inhibition and a decrease in LPS-induced fever. 4-MAA was also shown to be an antipyretic metabolite for PGE2 -independent fever induced by Tsv suggesting that it is responsible for the additional antipyretic mechanism of dipyrone. Moreover, 4-MAA is the hypothermic metabolite of dipyrone. © 2014 The British Pharmacological Society.

Long-term biases in geomagnetic K and aa indices

Science.gov (United States)

Love, J.J.

2011-01-01

Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0-2009.0, solar cycles 11-23. The K data show persistent biases, especially for high (low) K-activity levels at British (Australian) observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4. ?? 2011 Author(s).

Long-term biases in geomagnetic K and aa indices

Directory of Open Access Journals (Sweden)

J. J. Love

2011-08-01

Full Text Available Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0–2009.0, solar cycles 11–23. The K data show persistent biases, especially for high (low K-activity levels at British (Australian observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4.

Relationship between patient-reported outcomes and clinical outcomes in metastatic castration-resistant prostate cancer: post hoc analysis of COU-AA-301 and COU-AA-302.

Science.gov (United States)

Cella, D; Traina, S; Li, T; Johnson, K; Ho, K F; Molina, A; Shore, N D

2018-02-01

Patient-reported outcomes (PROs) are used to assess benefit-risk in drug development. The relationship between PROs and clinical outcomes is not well understood. We aim to elucidate the relationships between changes in PRO measures and clinical outcomes in metastatic castration-resistant prostate cancer (mCRPC). We investigated relationships between changes in self-reported fatigue, pain, functional well-being (FWB), physical well-being (PWB) and prostate cancer-specific symptoms with overall survival (OS) and radiographic progression-free survival (rPFS) after 6 and 12 months of treatment in COU-AA-301 (N = 1195) or COU-AA-302 (N = 1088). Eligible COU-AA-301 patients had progressed after docetaxel and had Eastern Cooperative Oncology Group performance status (ECOG PS) ≤ 2. Eligible COU-AA-302 patients had no prior chemotherapy and ECOG PS 0 or 1. Patients were treated with abiraterone acetate (1000 mg/day) plus prednisone (10 mg/day) or prednisone alone daily. Association between self-reported fatigue, pain and functional status, and OS and/or rPFS, using pooled data regardless of treatment, was assessed. Cox proportional hazard regression modeled time to death or radiographic progression. In COU-AA-301 patients, PRO improvements were associated with longer OS and longer time to radiographic progression versus worsening or stable PROs (P AA-302 patients, worsening PROs were associated with higher likelihood of radiographic progression (P ≤ 0.025) compared with improved or stable PROs. In multivariate models, worsening PWB remained associated with worse rPFS. The 12-month analysis confirmed the 6-month results. PROs are significantly associated with clinically relevant time-to-event efficacy outcomes in clinical trials and may complement and help predict traditional clinical practice methods for monitoring patients for disease progression. © The Author 2017. Published by Oxford University Press on behalf of the European Society for

Effect of gaussian beam on microstructural and mechanical properties of dissimilarlaser welding ofAA5083 and AA6061 alloys

Science.gov (United States)

Srinivas, B.; Cheepu, Muralimohan; Sivaprasad, K.; Muthupandi, V.

2018-03-01

The present study focuses on a sheet thickness of 4 mm using different laser power and welding rate by the laser beam welding (LBW) at a beam size180 μm. The observations on the weldments are showing that thermal conductivity of the materials plays a major role on microstructural changes. The as-welded mechanical properties were studied by correlation with its microstructures. Due to the steeper temperature gradient during the laser beam welding AA6061 was showing the greater variation compares with AA5083 side in the micro hardness studies.Also, the tensile strength of 241 MPa has been reported as highest with the welds made of laser powerat 3.5 kW and welding rate at 3.5 mmin-1.

Raadioteatril elu sees. Elu sees? / Mart Aas, Tõnis Leemets ; interv. Kutt Kommel

Index Scriptorium Estoniae

Aas, Mart

2007-01-01

Eesti Raadio raadioteatri 78. sünnipäeval esietendus Vikerraadios dokumentaalkuuldemäng "Elu sees" Aleksander Alleni (hilisema nimega Aleksander Aas) mälestuste põhjal. Theatrumi lavastuse on raadiole seadnud Mart Aas, Marius Peterson, Toomas Lõhmuste ja Tõnis Leemets

AAS Publishing News: Astronomical Software Citation Workshop

Science.gov (United States)

Kohler, Susanna

2015-07-01

Do you write code for your research? Use astronomical software? Do you wish there were a better way of citing, sharing, archiving, or discovering software for astronomy research? You're not alone! In April 2015, AAS's publishing team joined other leaders in the astronomical software community in a meeting funded by the Sloan Foundation, with the purpose of discussing these issues and potential solutions. In attendance were representatives from academic astronomy, publishing, libraries, for-profit software sharing platforms, telescope facilities, and grantmaking institutions. The goal of the group was to establish “protocols, policies, and platforms for astronomical software citation, sharing, and archiving,” in the hopes of encouraging a set of normalized standards across the field. The AAS is now collaborating with leaders at GitHub to write grant proposals for a project to develop strategies for software discoverability and citation, in astronomy and beyond. If this topic interests you, you can find more details in this document released by the group after the meeting: http://astronomy-software-index.github.io/2015-workshop/ The group hopes to move this project forward with input and support from the broader community. Please share the above document, discuss it on social media using the hashtag #astroware (so that your conversations can be found!), or send private comments to julie.steffen@aas.org.

Overall view of AA (Bld 193)

CERN Multimedia

1980-01-01

See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

The beam-kicker system of the synchrotron Saturne. Magnetic field and particle orbit computations. Experimental results (1963); Le percuteur de faisceau de Saturne. Calcul du champ magnetique et des trajectoires. Verifications experimentales (1963)

Energy Technology Data Exchange (ETDEWEB)

Gouttefangeas, M; Katz, A; Rastoix, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1963-07-01

In this report is briefly described the beam-kicker system of the synchrotron Saturne. An analysis of its operation based on the sampling method is given, as well as two methods for computing toe magnetic field produced by a set of endless conductors in the neighbourhood of a conducting shield where eddy currents are circulating. The first method leads to the resolution of a bi-dimensional Laplace equation with first kind boundary conditions (Dirichlet problem); the second one translates to electromagnetism the electrical images method currently used in electrostatics and yields the magnetic field as the sum of a triple series expansion in the general case of a set of conductors located in a parallelepipedal box. Finally are given the results obtained in computing on IBM 7090 the perturbation of the particle motion due to the beam-kicker. These results are compared with the experimental data. (authors) [French] Ce rapport decrit brievement le dispositif percuteur de faisceau mis en place sur le synchrotron Saturne. On y trouvera une analyse de se fonctionnement a partir de la theorie des echantillonnages. On indique egalment deux methodes de calcul du champ magnetique produit par un system de conducteurs indefinis en presence d'un blindage conducteur parcouru par des courants de Foucault: la premiere se ramene a la resolution d'une equation de Laplace a deux dimensions avec des conditions aux limites de premiere espece (probleme de Dirichlet), la seconde transpose en electromagnetisme la methode des images electriques classique en electrostatique et permet d'exprimer le champ magnetique sous la forme de la somme d'une serie triple dans le cas general d'un systeme de conducteurs contenus dans un blindage parallelepipedique. Pour terminer, on mentionne les resultats du calcul numerique de la perturbation de la trajectoire des particules sous l'effet du percuteur et on compare ces resultats aux resultats experimentaux. (auteurs)

The use of CR1aa for ovine in vitro embryo production

Directory of Open Access Journals (Sweden)

Yulnawati

2006-06-01

Full Text Available The aim of this study was to investigate the capacity of CR1aa as a simple medium for maturation, fertilization and culture of ovine embryo in vitro. Oocytes were collected by slicing method in Phosphate Buffer Saline (PBS supplemented with 5% Fetal Bovine Serum (FBS and 100 IU/ml penicillin streptomycin. Oocytes were matured in Tissue Culture Medium (TCM-199 as control or CR1aa as treatment medium. Both maturation medium were supplemented with 10% Fetal Bovine Serum (FBS, 10 IU/ml Follicle Stimulating Hormone (FSH, 10 IU/ml Luteinizing Hormone (LH, 1 μg/ml Estradiol and 100 IU/ml penicillin-streptomycin. Oocytes were incubated in 5% CO2 incubator, 38˚C for 24 h. Matured oocytes were fertilized in BO or CR1aa medium, supplemented with 2.5 mM caffeine benzoate and 20 mg /ml heparin. After 18 h in vitro fertilization, oocytes were cultured in TCM-199 or CR1aa medium, both supplemented with 5% FBS, 5 mg/ml insulin and 100 IU/ml penicillin streptomycin. Results showed that the highest maturation rate was found in TCM-199 medium (73.27% and significantly different (P0.05 between cleavage rate of ovine embryos in TCM-199 and CR1aa medium (39.45% vs 50.94%. In conclusion, optimum result on ovine in vitro embryo production can be achieved from a combination of TCM-199 as maturation medium and CR1aa as fertilization and culture medium.

NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-07-0067 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-12-0016 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0074 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1883 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-1734 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-10-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-10-0006 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1522 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-1020 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-GACU-18-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-18-0022 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1332 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-14-0023 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

Development of a longitudinal feedback cavity for the beam feedback system

International Nuclear Information System (INIS)

Huang Gang; Chen Huaibi; Huang Wenhui; Tong Dechun; Lin Yuzheng; Zhao Zhentang

2003-01-01

Longitudinal beam feedback system is widely used to damp coupling bunch instability. Kicker is one of the key components of the longitudinal feedback system. A prototype cavity of longitudinal feedback kicker is developed according to the parameter of BEPC II. The usage of nose cone in the kicker design increased the shunt impedance. In order to avoid the extra tapper in the storage ring, the racetrack shape beam pipe is applied in the kicker. The impedance and the bandwidth of the kicker is measured by the coaxial line impedance measurement platform and the result achieved the design goals

Lu AA21004, a novel multimodal antidepressantwith activity exerted through serotonergic targets

DEFF Research Database (Denmark)

Mork, A.; Pehrson, A.; Montezinho, L. C. P.

2012-01-01

Background: Lu AA21004 is a multimodal antidepressant that functions as a 5-HT3 and 5-HT7 receptor antagonist, 5-HT1B receptor partial agonist, 5-HT1A receptor agonist and inhibitor of the 5-HT transporter in vitro. Here we investigated preclinical effects of Lu AA21004 1) on target occupancies, 2...... (5-HT), noradrenaline (NA), dopamine (DA), acetylcholine (ACh), histamine (Hist)] were measured by microdialysis. Antidepressant potential was assessed in the forced swim test using Flinders Sensitive Line (FSL) rats. Moreover, effects of Lu AA21004 on acquisition, consolidation and recall...

AAS 227: Day 2

Science.gov (United States)

Kohler, Susanna

2016-01-01

Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new

Vip3Aa induces apoptosis in cultured Spodoptera frugiperda (Sf9) cells.

Science.gov (United States)

Jiang, Kun; Mei, Si-Qi; Wang, Ting-Ting; Pan, Jin-Hua; Chen, Yue-Hua; Cai, Jun

2016-09-15

The vegetative insecticidal proteins (Vip) secreted by many Bacillus thuringiensis strains during their vegetative growth stage are regarded as second generation insecticidal proteins, as they share no sequence or structural homology with known crystal insecticidal proteins (Cry) and have a broad insecticidal spectrum. Compared with insecticidal crystal proteins (ICPs), the insecticidal mechanisms of Vips have been little studied. Here we investigated the mechanism responsible for Vip3Aa toxicity in cultured insect cells. Using, flow cytometry analyzes, TUNEL staining and DNA fragmentation assays, we show that Vip3Aa can induce apoptosis in Spodoptera frugiperda (Sf9) cells and cause cells to arrest at the G2/M phase. We also show that Vip3Aa can disrupt mitochondrial membrane potential (ΔΨm), leading to the activation of Sf-caspase-1, suggesting that a mitochondrial mediated and caspase dependent pathway may be involved in Vip3Aa-induced apoptosis in Sf9 cells. Copyright © 2016 Elsevier Ltd. All rights reserved.

Development of an abort gap monitor for high-energy proton rings

International Nuclear Information System (INIS)

Beche, Jean-Francois; Byrd, John; De Santis, Stefano; Denes, Peter; Placidi, Massimo; Turner, William; Zolotorev, Max

2004-01-01

The fill pattern in proton synchrotrons usually features an empty gap, longer than the abort kicker raise time, for machine protection. This gap is referred to as the ''abort gap'' and any particles, which may accumulate in it due to injection errors and diffusion between RF buckets, would be lost inside the ring, rather than in the beam dump, during the kicker firing. In large proton rings, due to the high energies involved, it is vital to monitor the build up of charges in the abort gap with a high sensitivity. We present a study of an abort gap monitor based on a photomultiplier with a gated microchannel plate, which would allow for detecting low charge densities by monitoring the synchrotron radiation emitted. We show results of beam test experiments at the Advanced Light Source using a Hamamatsu 5916U MCP-PMT and compare them to the specifications for the Large Hadron Collider

Development of an Abort Gap Monitor for High-Energy Proton Rings

International Nuclear Information System (INIS)

Beche, J.-F.; Byrd, J.; De Santis, S.; Denes, P.; Placidi, M.; Turner, W.; Zolotorev, M.

2004-01-01

The fill pattern in proton synchrotrons usually features an empty gap, longer than the abort kicker raise time, for machine protection. This gap is referred to as the 'abort gap', and any particles, which may accumulate in it due to injection errors and diffusion between RF buckets, would be lost inside the ring, rather than in the beam dump, during the kicker firing. In large proton rings, due to the high energies involved, it is vital to monitor the build up of charges in the abort gap with a high sensitivity. We present a study of an abort gap monitor based on a photomultiplier with a gated microchannel plate, which would allow for detecting low charge densities by monitoring the synchrotron radiation emitted. We show results of beam test experiments at the Advanced Light Source using a Hamamatsu 5916U MCP-PMT and compare them to the specifications for the Large Hadron Collider

Rectification induced in N2AA-doped armchair graphene nanoribbon device

International Nuclear Information System (INIS)

Chen, Tong; Wang, Ling-Ling; Luo, Kai-Wu; Xu, Liang; Li, Xiao-Fei

2014-01-01

By using non-equilibrium Green function formalism in combination with density functional theory, we investigated the electronic transport properties of armchair graphene nanoribbon devices in which one lead is undoped and the other is N 2 AA -doped with two quasi-adjacent substitutional nitrogen atoms incorporating pairs of neighboring carbon atoms in the same sublattice A. Two kinds of N 2 AA -doped style are considered, for N dopants substitute the center or the edge carbon atoms. Our results show that the rectification behavior with a large rectifying ratio can be found in these devices and the rectifying characteristics can be modulated by changing the width of graphene nanoribbons or the position of the N 2 AA dopant. The mechanisms are revealed to explain the rectifying behaviors.

Cell volume regulation in hemoglobin CC and AA erythrocytes

International Nuclear Information System (INIS)

Berkowitz, L.R.; Orringer, E.P.

1987-01-01

Swelling hemoglobin CC erythrocytes stimulates a ouabain-insensitive K flux that restores original cell volume. Studies were performed with the K analog, 86 Rb. This volume regulatory pathway was characterized for its anion dependence, sensitivity to loop diuretics, and requirement for Na. The swelling-induced K flux was eliminated if intracellular chloride was replaced by nitrate and both swelling-activated K influx and efflux were partially inhibited by 1 mM furosemide or bumetanide. K influx in swollen hemoglobin CC cells was not diminished when Na in the incubation medium was replaced with choline, indicating Na independence of the swelling-induced flux. Identical experiments with hemoglobin AA cells also demonstrated a swelling-induced increase in K flux, but the magnitude and duration of this increase were considerably less than that seen with hemoglobin CC cells. The increased K flux in hemoglobin AA cells was likewise sensitive to anion replacement and to loop diuretics and did not require the presence of Na. These data indicate that a volume-activated K pathway with similar transport characteristics exists in both hemoglobin CC and AA red cells

Somatic effects of AAS abuse: A 30-years follow-up study of male former power sports athletes.

Science.gov (United States)

Lindqvist Bagge, A S; Rosén, T; Fahlke, C; Ehrnborg, C; Eriksson, B O; Moberg, T; Thiblin, I

2017-09-01

The aim of the present study was to investigate the association between somatic health and former abuse of AAS in former elite male athletes 30 years after the end of their active sports career. Retrospective follow-up study. N=996 former elite male athletes were sent a questionnaire concerning sociodemographic variables, previous and past sport activity and lifetime prevalence of seeking professional help for health problems. N=683 (68.6%) answered the questionnaire. The lifetime prevalence of AAS-abuse was 21% (n=143), while 79% (n=540) did not admit having ever used AAS. Former AAS-abuse was associated with tendon ruptures (p=0.01), depression (p=0.001), anxiety (p=0.01) and lower prevalence of prostate hypertrophy (p=0.01) and decreased libido (p=0.01). Former advanced AAS-abusers had higher anxiety (p=0.004) compared to the former less advanced AAS-abusers. Moreover, former advanced AAS-abusers, compared to AAS-naïves, reported more psychiatric problems (p=0.002), depression (p=0.003) and anxiety (p=0.00). A former AAS-abuse seems to be associated with some somatic and mental health problem, although a former less advanced AAS-abuse is related to lower incidence of prostate hypertrophy. The results raise the question whether some of these associations might be dose- and frequency dependent. These findings should however be seen as hypothesis generating and further studies are needed. Copyright © 2017 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

Microstructure and hardness performance of AA6061 aluminium composite using friction stir processing

Science.gov (United States)

Marini, C. D.; Fatchurrohman, N.

2018-04-01

Rice husk ash (RHA) is an industrial waste that has become a potential reinforced material for aluminium matrix composite (AMCs) due to low cost and abundantly available resources. Friction stir processing (FSP) has been introduced as a method to modify surface properties of the metal and alloy including theirs composite as well. The present work reports the production and characterization of AA6061 and AA6061/5 vol% RHA using FSP using parameters rotation speed 1000 rpm and traversed speed 25 mm/min. The microstructure was studied using optical microscopy (OM). A homogenous dispersion of RHA particles was obtained in the composite. No agglomeration or segregation was observed. The produced composite exhibited a fine grain structure. An improvement in hardness profile was observed as AA6061/5 vol% RHA improves in hardness compared to FSPed of AA6061 without reinforcement.

Feasibility of the UV/AA process as a pretreatment approach for bioremediation of dye-laden wastewater.

Science.gov (United States)

Yang, Minghui; Wu, Bingdang; Li, Qiuhao; Xiong, Xiaofeng; Zhang, Haoran; Tian, Yu; Xie, Jiawen; Huang, Ping; Tan, Suo; Wang, Guodong; Zhang, Li; Zhang, Shujuan

2018-03-01

Biodegradability and toxicity are two important indexes in considering the feasibility of a chemical process for environmental remediation. The acetylacetone (AA) mediated photochemical process has been proven as an efficient approach for dye decolorization. Both AA and its photochemical degradation products had a high bioavailability. However, the biocompatibility and ecotoxicology of the UV/AA treated solutions are unclear yet. In the present work, we evaluated the biocompatibility and toxicity of the UV/AA treated solutions at both biochemical and organismal levels. The biodegradability of the treated solution was evaluated with the ratio of 5-d biological oxygen demand (BOD 5 ) to chemical oxygen demand (COD) and a 28-d activated sludge assay (Zahn-Wellens tests). The UV/AA process significantly improved the biodegradability of the tested dye solutions. Toxicity was assessed with responses of microorganisms (microbes in activated sludge and Daphnia magna) and plants (bok choy, rice seed, and Arabidopsis thaliana) to the treated solutions, which showed that the toxicity of the UV/AA treated solutions was lower or comparable to that of the UV/H 2 O 2 counterparts. The results are helpful for us to determine whether the UV/AA process is applicable to certain wastewaters and how the UV/AA process could be effectively combined into a sequential chemical-biological water treatment. Copyright © 2017 Elsevier Ltd. All rights reserved.

Dual roles for CoAA and its counterbalancing isoform CoAM in human kidney cell tumorigenesis

Science.gov (United States)

Kang, Yun Kyoung; Schiff, Rachel; Ko, Lan; Wang, Tao; Tsai, Sophia Y.; Tsai, Ming-Jer; W. O’Malley, Bert

2008-01-01

Co-Activator Activator (CoAA) has been reported to be a coactivator that regulates steroid receptor-mediated transcription and alternative RNA splicing. Herein we show that CoAA is a dual-function coregulator that inhibits G1/S transition in human kidney cells and suppresses anchorage independent growth and xenograft tumor formation. Suppression occurs in part by downregulating c-myc and its downstream effectors ccnd1 and skp2, and causing accumulation of p27/Kip1 protein. In this cellular setting, CoAA directly represses the proto-oncogene, c-myc by recruiting HDAC3 protein and decreasing both the acetylation of histone H3 and the presence of RNA polymerase II on the c-myc promoter. Interestingly, a splicing isoform of CoAA, Coactivator Modulator (CoAM), antagonizes CoAA-induced G1/S transition and growth inhibition by negatively regulating the mRNA levels of the endogenous CoAA isoform. In addition, we found that expression of CoAA protein is significantly decreased in human renal cell carcinoma as compared to normal kidney. Our study presents evidence that CoAA is a potential tumor suppressor in renal carcinoma and that CoAM is a counterbalancing splice-isoform. This is so far the only example of a nuclear receptor coregulator involved in suppression of kidney cancer, and suggests potentially significant new roles for coregulators in renal cancer biology. PMID:18829545

Prediction of shear and tensile strength of the diffusion bonded AA5083 and AA7075 aluminium alloy using ANN

International Nuclear Information System (INIS)

Sagai Francis Britto, A.; Raj, R. Edwin; Mabel, M. Carolin

2017-01-01

Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.

Prediction of shear and tensile strength of the diffusion bonded AA5083 and AA7075 aluminium alloy using ANN

Energy Technology Data Exchange (ETDEWEB)

Sagai Francis Britto, A. [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Raj, R. Edwin, E-mail: redwinraj@gmail.com [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Mabel, M. Carolin [Department of Electrical and Electronics Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India)

2017-04-24

Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.

AA, sandwich line with magnetic horn

CERN Multimedia

CERN PhotoLab

1980-01-01

Continuation from 8010293: Finally, the sandwich line with the horn is placed on the ground, for the horn to be inspected and, if needed, exchanged for a new one. The whole procedure was trained with several members of the AA team, for quick and safe handling, and to share the radiation dose amongst them.

AA, mating of BST magnet halves

CERN Multimedia

CERN PhotoLab

1980-01-01

The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

Automated System Calibration and Verification of the Position Measurements for the Los Alamos Isotope Production Facility and the Switchyard Kicker Facilities

Science.gov (United States)

Barr, D.; Gilpatrick, J. D.; Martinez, D.; Shurter, R. B.

2004-11-01

The Los Alamos Neutron Science Center (LANSCE) facility at Los Alamos National Laboratory has constructed both an Isotope Production Facility (IPF) and a Switchyard Kicker (XDK) as additions to the H+ and H- accelerator. These additions contain eleven Beam Position Monitors (BPMs) that measure the beam's position throughout the transport. The analog electronics within each processing module determines the beam position using the log-ratio technique. For system reliability, calibrations compensate for various temperature drifts and other imperfections in the processing electronics components. Additionally, verifications are periodically implemented by a PC running a National Instruments LabVIEW virtual instrument (VI) to verify continued system and cable integrity. The VI communicates with the processor cards via a PCI/MXI-3 VXI-crate communication module. Previously, accelerator operators performed BPM system calibrations typically once per day while beam was explicitly turned off. One of this new measurement system's unique achievements is its automated calibration and verification capability. Taking advantage of the pulsed nature of the LANSCE-facility beams, the integrated electronics hardware and VI perform calibration and verification operations between beam pulses without interrupting production beam delivery. The design, construction, and performance results of the automated calibration and verification portion of this position measurement system will be the topic of this paper.

Dynamic Response of AA2519 Aluminum Alloy under High Strain Rates

Science.gov (United States)

Olasumboye, Adewale Taiwo

Like others in the AA2000 series, AA2519 is a heat-treatable Al-Cu alloy. Its excellent ballistic properties and stress corrosion cracking resistance, combined with other properties, qualify it as a prime candidate for armored vehicle and aircraft applications. However, available data on its high strain-rate response remains limited. In this study, AA2519 aluminum alloy was investigated in three different temper conditions: T4, T6, and T8, to determine the effects of heat treatment on the microstructure and dynamic deformation behavior of the material at high strain rates ranging within 1000 ≤ epsilon ≤ 4000 s-1. Split Hopkinson pressure bar integrated with digital image correlation system was used for mechanical response characterization. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. Results showed heterogeneous deformation in the three temper conditions. It was observed that dynamic behavior in each condition was dependent on strength properties due to the aging type controlling the strengthening precipitates produced and initial microstructure. At 1500 s -1, AA2519-T6 exhibited peak dynamic yield strength and flow stress of 509 and 667 MPa respectively, which are comparable with what were observed in T8 condition at higher rate of 3500 s-1 but AA2519-T4 showed the least strength and flow stress properties. Early stress collapse, dynamic strain aging, and higher susceptibility to shear band formation and fracture were observed in the T6 condition within the selected range of high strain rates. The alloy's general mode of damage evolution was by dispersoid particle nucleation, shearing and cracking.

Selection and characterization of resistance to the Vip3Aa20 protein from Bacillus thuringiensis in Spodoptera frugiperda.

Science.gov (United States)

Bernardi, Oderlei; Bernardi, Daniel; Horikoshi, Renato J; Okuma, Daniela M; Miraldo, Leonardo L; Fatoretto, Julio; Medeiros, Fernanda Cl; Burd, Tony; Omoto, Celso

2016-09-01

Spodoptera frugiperda is one the main target pests of maize events expressing Vip3Aa20 protein from Bacillus thuringiensis (Bt) in Brazil. In this study, we selected a resistant strain of S. frugiperda on Bt maize expressing Vip3Aa20 protein and characterized the inheritance and fitness costs of the resistance. The resistance ratio of the Vip3Aa20-resistant strain of S. frugiperda was >3200-fold. Neonates of the Vip3Aa20-resistant strain were able to survive and emerge as fertile adults on Vip3Aa20 maize, while larvae from susceptible and heterozygous strains did not survive. The inheritance of Vip3Aa20 resistance was autosomal recessive and monogenic. Life history studies to investigate fitness cost revealed an 11% reduction in the survival rate until adult stage and a ∼50% lower reproductive rate of the Vip3Aa20-resistant strain compared with susceptible and heterozygous strains. This is the first characterization of S. frugiperda resistance to Vip3Aa protein. Our results provide useful information for resistance management programs designed to prevent or delay resistance evolution to Vip3Aa proteins in S. frugiperda. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

AA-PMe, a novel asiatic acid derivative, induces apoptosis and suppresses proliferation, migration, and invasion of gastric cancer cells.

Science.gov (United States)

Jing, Yue; Wang, Gang; Ge, Ying; Xu, Minjie; Tang, Shuainan; Gong, Zhunan

2016-01-01

Asiatic acid (AA; 2α,3β,23-trihydroxyurs-12-ene-28-oic acid) is widely used for medicinal purposes in many Asian countries due to its various bioactivities. A series of AA derivatives has been synthesized in attempts to improve its therapeutic potencies. Herein we investigated the anti-tumor activities of N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-l-proline methyl ester (AA-PMe), a novel AA derivative. AA-PMe exhibited a stronger anti-cancer activity than its parent compound AA. AA-PMe inhibited the proliferation of SGC7901 and HGC27 human gastric cancer cells in a dose-dependent manner but had no significant toxicity in human gastric mucosa epithelial cells (GES-1). AA-PMe induced cell cycle arrest in G0/G1 phase and blocked G1-S transition, which correlated well with marked decreases in levels of cyclin D1, cyclin-dependent kinase CKD4, and phosphorylated retinoblastoma protein, and increase in cyclin-dependent kinase inhibitor P15. Further, AA-PMe induced apoptosis of human gastric cancer cells by affecting Bcl-2, Bax, c-Myc, and caspase-3. Moreover, AA-PMe suppressed the migration and invasion of human gastric cancer cells (SGC7901 and HGC27) cells by downregulating the expression of MMP-2 and MMP-9. Overall, this study investigated the potential anti-cancer activities of AA-PMe including inducing apoptosis and suppressing proliferation, migration and invasion of gastric cancer cells, as well as the underlying mechanisms, suggesting that AA-PMe is a promising anti-cancer drug candidate in gastric cancer therapy.

LHC abort gap cleaning studies during luminosity operation

CERN Document Server

Bartmann, W; Bracco, C; Bravin, E; Goddard, B; Höfle, W; Jacquet, D; Jeff, A; Kain, V; Meddahi, M; Roncarolo, F; Uythoven, J; Valuch, D; Gianfelice-Wendt, E

2012-01-01

The presence of significant intensities of un-bunched beam is a potentially serious issue in the LHC. Procedures using damper kickers for cleaning both the Abort Gap (AG) and the buckets targeted for injection, are currently in operation at flat bottom. Recent observations of relatively high population of the AG during physics runs brought up the need for AG cleaning during luminosity operation. In this paper the results of experimental studies performed in October 2011 are presented.

Co-deposition of basement membrane components during the induction of murine splenic AA amyloid

DEFF Research Database (Denmark)

Lyon, A W; Narindrasorasak, S; Young, I D

1991-01-01

Past studies have demonstrated that during murine AA amyloid induction there is co-deposition of the AA amyloid peptide and the basement membrane form of heparan sulfate proteoglycan. The synthesis and accumulation of heparan sulfate proteoglycan does not usually occur in the absence of other...... basement membrane components, such as type IV collagen, laminin, and fibronectin. Using immunohistochemical techniques, the present experiments have demonstrated that in addition to the heparan sulfate proteoglycan, there are other basement membrane components present in splenic AA amyloid deposits...... and these are present as soon as AA amyloid deposits are detectable. The results indicate that within the time constraints imposed by the experiments, the basement membrane components, fibronectin, laminin, type IV collagen, and heparan sulfate proteoglycan are co-deposited 36 to 48 hours after the AgNO3 and amyloid...

Intrauterine, postpartum and adult relationships between arachidonic acid (AA) and docosahexaenoic acid (DHA)

NARCIS (Netherlands)

Kuipers, Remko S.; Luxwolda, Martine F.; Dijck-Brouwer, D. A. Janneke; Muskiet, Frits A. J.

Erythrocyte (RBC) fatty acid compositions from populations with stable dietary habits but large variations in RBC-arachidonic (AA) and RBC-docosahexaenoic acid (DHA) provided us with insight into relationships between DHA and AA. It also enabled us to estimate the maternal RBC-DHA (mRBC-DHA) status

AAS Publishing News: Preparing Your Manuscript Just Got Easier

Science.gov (United States)

Kohler, Susanna

2016-03-01

Watermarking using the command watermark{DRAFT, v2}.Are you an astronomer considering submitting a paper to an AAS journal (i.e., AJ, ApJ, ApJ Letters, or ApJ Supplements)? If so, this post is for you! Read on to find out about the exciting new things you can do with the AASs newest LaTeX class file, available for download now.Why the Update?AAS publishing has maintained a consistent class file for LaTeX manuscript preparation for the past decade. But academic publishing is changing rapidly in todays era of electronic journals! Since its journals went fully electronic, the AAS has been continuously adding new publishing capabilities based on the recommendations of the Journals Task Force and the needs and requests of AAS authors. The AASs manuscript preparation tools are now being updated accordingly.Whats New in AASTex 6.0?There are many exciting new features and capabilities in AASTex 6.0. Here are just a few:Tracking options for author revisions include added{text}, deleted{text}, replaced{old}{new}, and explain{text}.Based on emulateapjDo you use the popular class file emulateapj to prepare your manuscripts? AASTex 6.0 is based on emulateapj, rather than on the older AASTex 5.2 (though 5.2 is still supported). This means that it is easy to produce a double-columned, single-spaced, and astro-ph-ready manuscript. Since two thirds of the AAS journals authors use emulateapj, this transition was designed to make manuscript preparation and sharing an easier and more seamless process.Tools for collaborationsDo you work in a large collaboration? AASTex now includes new tools to make preparing a manuscript within a collaboration easier. Drafts can now be watermarked to differentiate between versions. New markup for large author lists streamlines the display so that readers can access article information immediately, yet they can still access the full author list and affiliations at the end of the paper. And author revision markup allows members of a collaboration to

Overall view of AA in Bld. 193

CERN Multimedia

1980-01-01

See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

First circulating beam in the AA

CERN Multimedia

CERN PhotoLab

1980-01-01

On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.5 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are to numerous to name them all. Heribert Koziol, apparently asleep, is answering the call from an impatient director. See also 8007094.

Technical feasibility study for a solar energy system at Amsterdam Airport Schiphol (AAS)

NARCIS (Netherlands)

Janssen, P.N.J.W.; Myrzik, J.M.A.; Kling, W.L.; Reinders, L.

2010-01-01

This work arises within the framework of the introduction of renewable energies at Amsterdam Airport Schiphol (AAS) and the focus is on the technical feasibility of a solar energy system (SES) on ground level. The flight safety must always be guaranteed if solar panels are implemented on AAS. The

The adhesion performance of epoxy coating on AA6063 treated in Ti/Zr/V based solution

International Nuclear Information System (INIS)

Zhu, Wen; Li, Wenfang; Mu, Songlin; Yang, Yunyu; Zuo, Xi

2016-01-01

Highlights: • A non-chrome titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating is prepared on AA6063 at room temperature. • The Ti/Zr/V conversion coating is produced on AA6063 within 50 s. • The adhesion strength between epoxy coating and AA6063 is improved significantly after the Ti/Zr/V conversion treatment. - Abstract: An environment-friendly titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating was prepared on aluminum alloy 6063 (AA6063). The epoxy powder coatings were applied on the AA6063 samples with/without Ti/Zr/V conversion coatings via electrostatic spraying. The morphology and composition of the conversion coating were studied by scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS), respectively. The surface free energy components of AA6063 samples were measured by a static contact angle measuring device with Owens method. The adhesion properties of the epoxy coating on AA6063 treated with different conversion times were evaluated using a pull-off tester. The Ti/Zr/V conversion coating was mainly composed of metal oxide (TiO 2 , ZrO 2 , V 2 O 5 , Al 2 O 3 , etc.), metal fluoride (ZrF 4 , AlF 3 , etc.) and metal organic complex. The formation time of this conversion coating was reduced to 50 s. After such surface treatment, the samples' surface roughness was increased and the contact angle with water was decreased. Both the surface free energy and the work of adhesion were increased. The adhesion strength between the epoxy coating and AA6063 was enhanced significantly.

AA-PMe, a novel asiatic acid derivative, induces apoptosis and suppresses proliferation, migration, and invasion of gastric cancer cells

Science.gov (United States)

Jing, Yue; Wang, Gang; Ge, Ying; Xu, Minjie; Tang, Shuainan; Gong, Zhunan

2016-01-01

Asiatic acid (AA; 2α,3β,23-trihydroxyurs-12-ene-28-oic acid) is widely used for medicinal purposes in many Asian countries due to its various bioactivities. A series of AA derivatives has been synthesized in attempts to improve its therapeutic potencies. Herein we investigated the anti-tumor activities of N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-l-proline methyl ester (AA-PMe), a novel AA derivative. AA-PMe exhibited a stronger anti-cancer activity than its parent compound AA. AA-PMe inhibited the proliferation of SGC7901 and HGC27 human gastric cancer cells in a dose-dependent manner but had no significant toxicity in human gastric mucosa epithelial cells (GES-1). AA-PMe induced cell cycle arrest in G0/G1 phase and blocked G1-S transition, which correlated well with marked decreases in levels of cyclin D1, cyclin-dependent kinase CKD4, and phosphorylated retinoblastoma protein, and increase in cyclin-dependent kinase inhibitor P15. Further, AA-PMe induced apoptosis of human gastric cancer cells by affecting Bcl-2, Bax, c-Myc, and caspase-3. Moreover, AA-PMe suppressed the migration and invasion of human gastric cancer cells (SGC7901 and HGC27) cells by downregulating the expression of MMP-2 and MMP-9. Overall, this study investigated the potential anti-cancer activities of AA-PMe including inducing apoptosis and suppressing proliferation, migration and invasion of gastric cancer cells, as well as the underlying mechanisms, suggesting that AA-PMe is a promising anti-cancer drug candidate in gastric cancer therapy. PMID:27073325

[Exposure degree of important non-target arthropods to Cry2Aa in Bt rice fields].

Science.gov (United States)

Zhang, Qing-Ling; Li, Yun-He; Hua, Hong-Xia; Yang, Chang-Ju; Wu, Hong-Jin; Peng, Yu-Fa

2013-06-01

Based on the principle of "risk = hazard x exposure", the selected representative nontarget organisms in the assessment of the potential effects of insect-resistant genetically modified (GM) crops on non-target arthropods in laboratory are generally the arthropod species highly exposed to the insecticidal proteins expressed by the GM crops in farmland ecosystem. In order to understand the exposure degree of the important arthropod species to Cry proteins in Bt rice fields, and to select the appropriate non-target arthropods in the risk assessment of insect-resistant GM crops, the enzyme-linked immunosorbent assay (ELISA) was conducted to measure the Cry2Aa protein concentration in the arthropods collected from the cry2Aa rice fields at different rice growth stages. The results showed that there was a significant difference in the Cry2Aa content protein concentration in different arthropod species. Some species did not contain Cry2Aa protein, while some species contained larger amounts of Cry2Aa protein. Relative to the arthropods colleted after rice anthesis, the arthropods colleted in rice anthesis contained relative higher concentrations of Cry2Aa protein, especially for the predacious arthropods. No Cry proteins were detected in parasitic arthropods. This study provided references for the laboratory assessment of the effects of GM rice on nontarget arthropods.

Safe injection procedures, injection practices, and needlestick ...

African Journals Online (AJOL)

Results: Safe injection procedures regarding final waste disposal were sufficiently adopted, while measures regarding disposable injection equipment, waste containers, hand hygiene, as well as injection practices were inadequately carried out. Lack of job aid posters that promote safe injection and safe disposal of ...

AR, HEA and AAS in Rural Development Projects--Benchmarking towards the Best Processes.

Science.gov (United States)

Westermarck, Harri

In most countries, agricultural research (AR), institutions of higher education in agriculture (HEA), and agricultural advisory services (AAS) function as separate agencies. So far, in most countries, AR, HEA, and AAS have not had a common vision for rural development. In Finland, domination of agricultural production in Finland has led to a lack…

Clinical implications of eicosapentaenoic acid/arachidonic acid ratio (EPA/AA) in adult patients with congenital heart disease.

Science.gov (United States)

Kanoh, Miki; Inai, Kei; Shinohara, Tokuko; Tomimatsu, Hirofumi; Nakanishi, Toshio

2017-12-01

Recent studies showed that a low ratio between the levels of eicosapentaenoic acid and those of arachidonic acid (EPA/AA) is associated with higher incidence of coronary artery disease and poor prognosis of heart failure, arrhythmia, and cardiac sudden death. However, the clinical implications of EPA/AA in adult patients with congenital heart disease remain unclear. We aimed to assess the prognostic value of EPA/AA regarding cardiac events in adult patients with congenital heart disease. We measured the serum levels of eicosapentaenoic acid and arachidonic acid in 130 adult patients (median age, 31 years) stratified into two groups according to their EPA/AA (low, ≤0.22; high, >0.22). We prospectively analyzed the association between EPA/AA and incidence of cardiac events during a mean observation period of 15 months, expressed in terms of hazard ratio (HR) with 95% confidence interval (95% CI). In the subgroup of patients with biventricular circulation (2VC) (n = 76), we analyzed the same clinical endpoints. In our study population, EPA/AA was not associated with the incidence of arrhythmic events (HR, 1.52; 95% CI, 0.82-2.85; p = 0.19), but low EPA/AA was a predictor of heart failure hospitalization (HR, 2.83; 95% CI, 1.35-6.30; p AA of ≤0.25 was associated with a significantly higher risk of arrhythmic events (HR, 2.55; 95% CI, 1.11-6.41; p = 0.03) and heart failure hospitalization (HR, 5.20; 95% CI, 1.78-18.1; p AA represents a useful predictor of cardiac events in adult patients with congenital heart disease.

The adhesion performance of epoxy coating on AA6063 treated in Ti/Zr/V based solution

Energy Technology Data Exchange (ETDEWEB)

Zhu, Wen; Li, Wenfang, E-mail: mewfli@scut.edu.cn; Mu, Songlin; Yang, Yunyu; Zuo, Xi

2016-10-30

Highlights: • A non-chrome titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating is prepared on AA6063 at room temperature. • The Ti/Zr/V conversion coating is produced on AA6063 within 50 s. • The adhesion strength between epoxy coating and AA6063 is improved significantly after the Ti/Zr/V conversion treatment. - Abstract: An environment-friendly titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating was prepared on aluminum alloy 6063 (AA6063). The epoxy powder coatings were applied on the AA6063 samples with/without Ti/Zr/V conversion coatings via electrostatic spraying. The morphology and composition of the conversion coating were studied by scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS), respectively. The surface free energy components of AA6063 samples were measured by a static contact angle measuring device with Owens method. The adhesion properties of the epoxy coating on AA6063 treated with different conversion times were evaluated using a pull-off tester. The Ti/Zr/V conversion coating was mainly composed of metal oxide (TiO{sub 2}, ZrO{sub 2}, V{sub 2}O{sub 5}, Al{sub 2}O{sub 3}, etc.), metal fluoride (ZrF{sub 4}, AlF{sub 3}, etc.) and metal organic complex. The formation time of this conversion coating was reduced to 50 s. After such surface treatment, the samples' surface roughness was increased and the contact angle with water was decreased. Both the surface free energy and the work of adhesion were increased. The adhesion strength between the epoxy coating and AA6063 was enhanced significantly.

Experimental study on joining of AA6063 and AISI 1040 steel

Science.gov (United States)

Hynes, N. Rajesh Jesudoss; Raja, S.

2018-05-01

Feasibility of joining of dissimilar metals with different physical, chemical and thermal properties such as AA6063 alloy and AISI 1040 steel is worthwhile study, since it has tremendous applications in all most of all engineering domains. The mechanism of bonding is studied using scanning electron microscopy. Impact strength of AA2024/AISI joints, axial shortening distance, micro hardness distribution and joint strength are determined. Micro hardness profile shows increased hardness value at the joint interface, due to grain refinement.

Changing epidemiology of AA amyloidosis: clinical observations over 25 years at a single national referral centre.

Science.gov (United States)

Lane, Thirusha; Pinney, Jennifer H; Gilbertson, Janet A; Hutt, David F; Rowczenio, Dorota M; Mahmood, Shameem; Sachchithanantham, Sajitha; Fontana, Marianna; Youngstein, Taryn; Quarta, Candida C; Wechalekar, Ashutosh D; Gillmore, Julian D; Hawkins, Philip N; Lachmann, Helen J

2017-09-01

Systemic AA amyloidosis is a serious complication of chronic inflammation; however, there are relatively few published data on its incidence. We investigated the changing epidemiology of AA amyloidosis over a 25-year period at a single national referral centre. We conducted a retrospective study of all patients diagnosed with AA amyloidosis who had attended the centre between 1990 and 2014 inclusive. Six hundred and twenty-five patients were studied in three cohorts: C1: 1990-1997; C2: 1998-2006; C3: 2007-2014. Mean age at presentation increased from 46 in C1 to 56 in C3 (p AA amyloidosis over a quarter of a century, reflecting advances in therapeutics and overall management of complex chronic disease in an ageing population. AA amyloidosis of uncertain aetiology presents an emerging major problem. Newer techniques such as next-generation sequencing may aid diagnosis and effective treatment, thereby improving overall survival.

AAS 228: Day 1 morning

Science.gov (United States)

Kohler, Susanna

2016-06-01

Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the

Study of processes of interligand exchange between Cu(AA)2 and Y(DPM)3 in geseous phase

International Nuclear Information System (INIS)

Girichev, G.V.; Giricheva, N.I.; Belova, N.V.; Kuz'mina, N.P.; Kaul', A.R.; Gorbenko, O.Yu.

1993-01-01

Mass-spectrometric method was used to study the process, proceeding between gaseous copper acetylacetonate and yttrium dipivaloylmethanate in 150-630 deg C range. It was established that intensive ligand exchange with formation of Cu(DPM) (AA), Y(DPM) 2 (AA), Cu(DPM) 2 compounds in gaseous mixture took place between components. Thermal decomposition of copper and yttrium β-diketonates was observed with temperature growth, along with reactions of interligand exchange. Molecular forms of Y(DPM) 2 , Y(DPM)(AA), Cu(DPM) 2 and Cu(DPM)(AA) were the most thermally stable at that

Influence of titanium–boron additions on grain refinement of AA6082 gas tungsten arc welds

International Nuclear Information System (INIS)

Kishore Babu, N.; Talari, Mahesh Kumar; Dayou, Pan; Zheng, Sun; Jun, Wei; SivaPrasad, K.

2012-01-01

Highlights: ► Ti in the weld metal resulted in grain refinement due to growth restriction effect. ► Weld metal strength improved due to grain refinement caused by Tibor™ addition. ► Weld metal responded to post-weld ageing treatment due to dilution from base metal. ► Weld metal with AA5356 filler are stronger then AA4043 for all Tibor™ additions. -- Abstract: Grain refinement of weld metal plays a vital role in improving mechanical properties (ductility and toughness) as well as weldability. The present study has investigated the influence of Tibor™ additions on the structure and mechanical properties of AA6082 gas tungsten arc (GTA) weldments. Controlled amounts of Tibor™ grain refiner (containing Ti and B in a ratio of 5:1) were introduced into the molten pool of AA6082 by pre-deposited cast inserts (AA4043 and AA5356) under different welding conditions by GTA welding. Full penetration GTA welds were prepared using alternating current (AC). It was observed that grain size was decreased with increasing amounts of Tibor™. The grain refinement is mainly caused grain nucleation associated with constitutional undercooling during solidification. It has been shown that welds prepared with 5356 cast insert exhibited high strength and ductility when compared with other welds. The observed grain refinement was shown to result in an appreciable increase in fusion zone hardness, strength and ductility.

Renal AA amyloidosis in a patient with hereditary complete complement C4 deficiency

Directory of Open Access Journals (Sweden)

Imed Helal

2011-01-01

Full Text Available Hereditary complete C4 deficiency has until now been reported in 30 cases only. A disturbed clearance of immune- complexes probably predisposes these individuals to systemic lupus erythematosus, other immune- complex diseases and recurrent microbial infections. We present here a 20- year- old female with hereditary complete C4 deficiency. Renal biopsy demonstrated renal AA amyloidosis. This unique case further substantiates that deficiency of classical pathway components predisposes to the development of recurrent microbial infections and that the patients may develop AA amyloidosis. Furthermore, in clinical practice, the nephrotic syndrome occurring in a patient with hereditary complete complement C4 deficiency should lead to the suspicion of renal AA amyloidosis.

Therapeutic Benefits of Tocilizumab Vary in Different Organs of a Patient with AA Amyloidosis

Directory of Open Access Journals (Sweden)

Masaru Matsui

2014-01-01

Full Text Available Systemic reactive AA amyloidosis is a life-threatening complication of chronic inflammatory diseases. Anti-interleukin-6 receptor, tocilizumab (TCZ, has been shown to improve clinical symptoms of patients with AA amyloidosis, accompanied with regression of the amyloid deposition. We report a case of AA amyloidosis evaluated by histology of multiple organs before and after TCZ treatment. A woman in her 60s with rheumatoid arthritis was referred to our hospital because of cardiac and renal dysfunction. A gastric and renal biopsy revealed the deposition of AA amyloid, and echocardiography revealed concentric left ventricular hypertrophy. Her estimated glomerular filtration rate was decreased to 8.6 mL/min/1.73 m2, and B-type natriuretic peptide, C-reactive protein, and serum amyloid A protein were significantly elevated. TCZ treatments markedly decreased her serum amyloid A protein and C-reactive protein levels, but hemodialysis was required 1 year later. Endoscopic gastric rebiopsy 3 years after initiation of TCZ treatments revealed the regression of amyloid deposition and echocardiography revealed improvement of her left ventricular hypertrophy. However, a renal rebiopsy revealed that the amyloid deposition had not regressed. In conclusion, these observations suggest that the therapeutic effects of TCZ can vary among organs in patients with AA amyloidosis.

Machine development studies for PSB extraction at 160 MeV and PSB to PS beam transfer

CERN Document Server

Forte, V; Bartmann, W; Borburgh, J; Ferrero Colomo, A; Damerau, H; Di Giovanni, G P; Coralejo Feliciano, L M; Fraser, M A; Gamba, D; Mikulec, B; Guerrero Ollacarizqueta, A; Serluca, M; Sermeus, L; Sterbini, G

2017-01-01

This paper collects the machine development (MD) activities for the beam transfer studies in 2016 concerning the PSB extraction and the PSB-to-PS transfer. Many topics are covered: from the 160 MeV extraction from the PSB, useful for the future commissioning activities after the connection with Linac4, to new methodologies for measuring the magnetic waveforms of kickers and dispersion reduction schemes at PS injection, which are of great interest for the LHC Injectors Upgrade (LIU) [1] project.

Storage Stability Improvement of Copolymer Grafted Polypropylene-AcrylicAcid (PP-AA), by means of Various After Treatment Processes

International Nuclear Information System (INIS)

Gitopadmojo, Isminingsih

2000-01-01

Polypropylene yams that have been subjected to irradiation induced graftco-polymerization with acrylic acid, have gained its moisture regain and dyeability, that fulfilled the requirement as textile material for garment.However, the copolymer grafted PP-AA has suffered from degradation in thestorage, which was indicated in the previous study that the strengthretention has dropped tremendously by photo-oxidation or photo-degradation.After treatments of PP-AA yams with chemical compound that was able toprevent further photo-oxidation, will be expected to improve the stability ofPP-AA in storage. In this research activity, the polypropylene (PP) yams weresubjected to irradiation induced graft co-polymerization by means ofγ-Ray Co-60 as irradiation source with acrylic acid (AA) as monomer.Various after treatments were subjected to the grafted PP-AA yams such asalkalisation process; dyeing (anionic dyes, cationic dyes and nonionic dyes);as well as processing with optical brightening agent and UV stabilizer,separately. The PP-AA yams (before and after treatment) were subjected tostorage from 1 month up to 42 months, and then being tested for theirmoisture regain, strength retention and elongation at breaks. The samplesbeing stored for 12 months were subjected to radical analysis. It isconcluded from the experiment that after treatment of grafted PP-AA by meansof those various processes were able to improve the stability of copolymergrafted PP-AA in storage. The presence of peroxide radical in the ESR(electron spin resonance) spectrum on PP-AA yams before treatment and theones after treated with alkaline and being stored for 12 months haveindicated the presence of photo oxidation or photo degradation, while thepresence of poly enyl radical in the ESR spectrum of after treated PP-AA withdyes having azo and azine compound as chromophore, as well as with UVstabilizer with carbonyl as chromophore and being stored for 12 months haveproved that its presence have protected such

AA, closed orbit observation pickup

CERN Multimedia

1980-01-01

Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. See also 8001372, 8010042, 8010045

Avaliação agronômica em híbridos diplóides (AA de bananeira Agronomical evaluation of (AA banana diploid hybrids

Directory of Open Access Journals (Sweden)

Lauro Saraiva Lessa

2009-01-01

Full Text Available Objetivou-se avaliar características agronômicas em híbridos diplóides (AA de bananeira. No experimento, conduzido no campo experimental da Embrapa Mandioca e Fruticultura Tropical, em blocos casualizados com quatro repetições, foram avaliados 11 híbridos diplóides (AA de bananeira (4279-06, TH03-01, 8987-01, 0323-03, 1318-01, 0116-01, 8694-20, 1304-06, 9179-03, 4223-06 e SH3263. Os dados dos caracteres agronômicos avaliados foram submetidos à análise de variância e as médias dos genótipos foram agrupadas pelo teste de Scott-Knott, a 5% de probabilidade. O genótipo SH3263 apresentou valores favoráveis ao melhoramento para número de pencas e de frutos por cacho e baixa incidência de Sigatoka-amarela na floração, além de menor número de dias da floração à colheita, maior peso da segunda penca e comprimento de fruto acima de 10 cm. O híbrido 0323-03 apresentou a maior retenção de folhas vivas na colheita do cacho e, também, a menor nota para incidência de sigatoka-amarela na colheita. A alta variabilidade encontrada com a avaliação dos híbridos permite a seleção de diplóides (AA com potencial para utilização em programas de melhoramento da cultura.The aim of the present work was to characterize horticultural characteristics in (AA banana diploid hybrids. The experiment was carried out at the experimental field of Embrapa Cassava and Tropical Fruits in randomized blocks with four replicates and 11 (AA banana diploid hybrids were evaluated: (4279-06, TH03-01, 8987-01, 0323-03, 1318-01, 0116-01, 8694-20, 1304-06, 9179-03, 4223-06 and SH3263. Data of the agronomical characteristics evaluated were submitted to the analysis of variance and the averages of the genotypes grouped by the Scott-Knott test at 5% of probability. The SH3263 genotype presented favorable values to the breeding for number of hands per bunch, number of fruits per bunch, low yellow-sigatoka incidence during flowering and also lower number of days

The association between Interleukin (IL)-4 gene intron 3 VNTR polymorphism and alopecia areata (AA) in Turkish population.

Science.gov (United States)

Kalkan, Göknur; Karakus, Nevin; Baş, Yalçın; Takçı, Zennure; Ozuğuz, Pınar; Ateş, Omer; Yigit, Serbulent

2013-09-25

Alopecia areata (AA) is hypothesized to be an organ-specific autoimmune disease of hair follicles mediated by T cells. As immunological and genetic factors have been implicated in the pathogenesis of AA, the purpose of the present study was to investigate possible associations between the functional Interleukin (IL)-4 gene intron 3 VNTR polymorphism and AA susceptibility and disease progression in Turkish population. The study group consisted of 116 unrelated patients with AA and 125 unrelated healthy controls. Genomic DNA was isolated and IL-4 gene 70 bp VNTR polymorphism determined by using polymerase chain reaction (PCR) with specific primers. No association was observed between AA patients and controls according to genotype distribution (p=0.051). The allele distribution of IL-4 gene intron 3 VNTR polymorphism was statistically different between AA patients and control group (p=0.026). The frequency of P1 allele in patients was significantly higher than that in the control group. When the P2P2 genotype was compared with P1P2+P1P1 genotypes, a statistically significant difference was observed between patients and controls (p=0.036). Intron 3 VNTR polymorphism in the IL-4 gene was found to be associated with AA susceptibility in Turkish population. The results suggest that IL-4 VNTR polymorphism in the intron 3 region may be a risk factor for the development of AA among Turkish population. This is the first to report that intron 3 VNTR polymorphism in the IL-4 gene is associated with AA susceptibility. © 2013.

Mechanical properties of aluminium–copper–lithium alloy AA2195 at cryogenic temperatures

International Nuclear Information System (INIS)

Nayan, Niraj; Narayana Murty, S.V.S.; Jha, Abhay K.; Pant, Bhanu; Sharma, S.C.; George, Koshy M.; Sastry, G.V.S.

2014-01-01

Highlights: • 4 mm thick sheet of AA2195 was imparted T87 temper. • 7% cold work to impart T87 was given by combination of cold rolling and stretching. • Mechanical properties were evaluated at RT and cryogenic temperatures. • Strength of AA2195 are superior to the conventional aluminum alloy 2219 at all temperatures. • Strength decreases with decrease in temperature whereas ductility remains unchanged. - Abstract: Tensile testing was performed on a 4 mm thick sheet of the aluminum–lithium alloy AA2195 in T87 (solution treatment + water quenching + 7% cold work + peak aging) temper which was subjected to 7% cold working by combination of cold rolling and stretching, over a temperature range from ambient to liquid hydrogen (20 K) conditions. Properties were evaluated in longitudinal as well as transverse directions to characterize anisotropy with respect to strength and ductility. Strength and ductility were compared to the conventional aluminum alloy AA2219-T87, developed for similar cryogenic applications. Decreases in test temperature led to higher strengths with little or no change in ductility. As the temperature decreases, the differences between ultimate tensile strength as well as yield strength for two different combinations of cold roll and stretch studied in the present work, narrows down and become equal at 20 K

Cadmium and lead determination in foods by beam injection flame furnace atomic absorption spectrometry after ultrasound-assisted sample preparation

International Nuclear Information System (INIS)

Aleixo, Poliana Carolina; Junior, Dario Santos; Tomazelli, Andrea Cristina; Rufini, Iolanda A.; Berndt, Harald; Krug, Francisco Jose

2004-01-01

A simple method for cadmium and lead determination in foods by beam injection flame furnace atomic absorption spectrometry (BIFF-AAS) was proposed. Food slurries were prepared by transferring an exact amount of cryogenic-ground homogenized material (50-100 mg) to centrifuge tubes, followed by addition of 5 ml (up to 2.8 mol l -1 ) nitric acid solution and sonication in an ultrasonic bath during 5-10 min. Thereafter, slurries were diluted with water to 10 ml, centrifuged during 5 min at 5400 rpm and 400 μl aliquot of the supernatant was analyzed by BIFF-AAS. The detection limits based on peak height measurements were 0.03 μg g -1 Cd and 1.6 μg g -1 Pb for 2% (m/v) slurry (200 mg/10 ml). For method validation, the certified reference materials Pig Kidney (BCR 186) and Rice Flour (NIES 10) were used. Quantitative cadmium and lead recoveries were obtained and no statistical differences were found at 95% level by applying the t-test

Profile of renal AA amyloidosis in older and younger individuals: a single-centre experience.

Science.gov (United States)

Erdogmus, Siyar; Kendi Celebi, Zeynep; Akturk, Serkan; Kumru, Gizem; Duman, Neval; Ates, Kenan; Erturk, Sehsuvar; Nergizoglu, Gokhan; Kutlay, Sim; Sengul, Sule; Keven, Kenan

2018-05-18

In epidemiological studies of amyloid A (AA) amyloidosis from Turkey, the most frequently cause was familial Mediterranean fever (FMF) and it occurs generally in young age population. However, there are no sufficient data regarding aetiology, clinical presentation and prognosis of renal AA amyloidosis in advanced age patients. In this study, we aimed to investigate demographic, clinical presentation, aetiology and outcomes of adults aged 60 years or older patients with biopsy-proven renal AA amyloidosis. This is a retrospective study involving 53 patients who were diagnosed with AA amyloidosis by kidney biopsy from 2006 to 2016. In all patients, kidney biopsies were performed due to asymptomatic proteinuria, nephrotic syndrome and/or renal insufficiency. The patients were separated into two groups on the basis of age (group I: ≥60 years and group II: AA amyloidosis were as follows: FMF 16 (50%), bronchiectasis 7 (23%), chronic osteomyelitis 2 (6%), inflammatory bowel disease 2 (6%), rheumatoid arthritis 2 (6%), ankylosing spondylitis 1 (3%) and unknown aetiology 2 (6%). The underlying disorders of AA amyloidosis in group II patients were as follows: FMF 17 (81%), Behcet's disease 1 (5%) and unknown aetiology 3 (14%). No statistically significant differences were detected between two groups with regard to systolic and diastolic blood pressures, albumin, proteinuria and lipids. The combination of chronic kidney disease and nephrotic syndrome was the most common clinical presentation in group I (73%) and group II (43%) (p = .05). Compared to the group II, estimated glomerular filtration rate was significantly lower in group I at the time of kidney biopsy (p = .003). At 12-month follow-up, 61% of the group I and 33% of the group II developed end-stage kidney disease requiring dialysis, while 11% of the group I died. Our results indicated that renal AA amyloidosis is a rare disease in advanced age patients. At baseline and follow-up period, advanced age

Experience with the SLC permanent magnet multipoles

International Nuclear Information System (INIS)

Gross, G.; Spencer, J.

1994-06-01

Permanent magnets have been used in the SLC Damping Rings and their injection and extraction lines since 1985. Recent upgrades of the DR vacuum chambers provided an opportunity to check DR magnets prior to higher beam current operation. Several PM sextupoles downstream of the injection kickers in the electron ring had exceeded their thermal stabilization values of 80 degrees C and some showed serious mechanical deformations and radiation >1 R at contact. We discuss our observations, measurements and a few inexpensive modifications that should improve these magnets under such conditions. A new, block matching algorithm allowed us to use magnet blocks that had been considered unusable because of very different remament field strengths and easy axis errors

Investigation of Microstructure and Microhardness in Self-Reacting Friction Stir Welded AA2014-T6 and AA2219-T87

Science.gov (United States)

Horton, K. Renee; McGill, Preston; Barkey, Mark

2011-01-01

Friction stir welding (FSW) is a solid state welding process with potential advantages for aerospace and automotive industries dealing with light alloys. Self-reacting friction stir welding (SR-FSW) is one variation of the FSW process being developed at the National Aeronautics and Space Administration (NASA) for use in the fabrication of propellant tanks. This work reports on the microstructure and microhardness of SR-FSW between two dissimilar aluminum alloys. Specifically, the study examines the cross section of the weld joint formed between an AA2014-T6 plate on the advancing side and an AA2219-T87 plate on the retreating side. The microstructural analysis shows an irregularly displaced weld seam from the advancing side past the thermo-mechanical affected zone (TMAZ) into the weld nugget region. There are sharp variations in the microhardness across the weld. These variations are described in the paper and mechanisms for their formation are discussed.

Churg-Strauss syndrome associated with AA amyloidosis: a case report.

Science.gov (United States)

Maamar, Mouna; Tazi-Mezalek, Zoubida; Harmouche, Hicham; El Hamany, Zitouna; Adnaoui, Mohammed; Aouni, Mohammed

2012-01-01

Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/µL), positive p-ANCA, microscopic haematuria and proteinuria at 2g/day. A diagnosis of Churg-Strauss syndrome was established based on five criteria of the American College of Rheumatology (ACR). Renal biopsy showed an important type AA amyloid deposit. The patient was treated with steroids with a good response of the vasculitis and amyloidosis with disappearance of the proteinuria.

Scorpion neurotoxin AaIT-expressing Beauveria bassiana enhances the virulence against Aedes albopictus mosquitoes.

Science.gov (United States)

Deng, Sheng-Qun; Cai, Qun-Di; Deng, Ming-Zhi; Huang, Qiang; Peng, Hong-Juan

2017-12-01

To improve the insecticidal efficacy of this entomopathogen Beauveria bassiana, the fungus was genetically modified to express an insect-specific scorpion neurotoxin AaIT. The virulence of the recombinant B. bassiana strain (Bb-AaIT) against Aedes albopictus adults (which occurs via penetration through the cuticle during spore germination or by conidia ingestion), and the larvae (by conidia ingestion) was measured with bioassays. The median lethal concentration (LC 50 ) of Bb-AaIT against A. albopictus larvae was 313.3-fold lower on day 4 and 11.3-fold lower on day 10 than that of the wild type (WT). Through conidia feeding or body contact, Bb-AaIT killed 50% of adult female mosquitoes at 3.9- or 1.9-fold reduced concentrations on day 4 and at 2.1- or 2.4-fold reduced concentrations on day 10. Compared with the results for the WT, the median lethal time (LT 50 ) of Bb-AaIT was reduced by 28.6% at 1 × 10 7 conidia ml -1 and 34.3% at 1 × 10 6 conidia ml -1 in the larvae bioassay by conidia ingestion, while it decreased 32.3% at 1 × 10 7 conidia ml -1 by conidia ingestion and 24.2% at 1 × 10 8 conidia ml -1 by penetrating through the cuticle in the adult bioassay. All the differences were significant. Our findings indicated that Bb-AaIT had higher virulence and faster action than the WT in killing the larval and adult mosquitoes, and therefore, it is valuable for development as a commercial mosquito pesticide.

Distinguishing diffuse alopecia areata (AA) from pattern hair loss (PHL) using CD3(+) T cells.

Science.gov (United States)

Kolivras, Athanassios; Thompson, Curtis

2016-05-01

Distinguishing between diffuse subacute alopecia areata (AA), in which the peribulbar infiltrate is absent, and pattern hair loss is challenging, particularly in cases that lack marked follicular miniaturization and a marked catagen/telogen shift. We sought to distinguish diffuse AA from pattern hair loss using CD3(+) T lymphocytes. A total of 28 cases of subacute AA and 31 cases of pattern hair loss were selected and a 4-mm punch biopsy was performed. All the specimens were processed using the "HoVert" (horizontal and vertical) technique. In all cases, hematoxylin-eosin and immunohistochemical stains for CD3, CD4, CD8, and CD20 were performed. The presence of CD3(+) lymphocytes within empty follicular fibrous tracts (stela), even without a concomitant peribulbar infiltrate, is a reliable histopathological clue in supporting a diagnosis of AA (sensitivity 0.964, specificity 1, P ≤ .001). Limited tissue for analysis remained in the clinical sample tissue blocks. The presence of CD3(+) T-cells within empty follicular fibrous tracts (stela) supports a diagnosis of AA. Copyright © 2015 American Academy of Dermatology, Inc. Published by Elsevier Inc. All rights reserved.

AA, closed orbit observation pickup

CERN Multimedia

CERN PhotoLab

1980-01-01

Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles QFW, at maximum dispersion. See also 8001372, 8001383, 8010045

AA, closed orbit observation pickup

CERN Multimedia

CERN PhotoLab

1980-01-01

Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles, QFW, at maximum dispersion. See also 8001372,8001383, 8010042

AA, closed orbit observation pickup

CERN Multimedia

CERN PhotoLab

1980-01-01

Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. Werner Sax contemplates his achievement. See also 8001383, 8010042, 8010045.

AA, assembly of wide bending magnet

CERN Multimedia

CERN PhotoLab

1980-01-01

The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.

Effect of pin tool design on the material flow of dissimilar AA7075-AA6061 friction stir welds

Science.gov (United States)

Hasan, Mohammed M.; Ishak, M.; Rejab, M. R. M.

2017-10-01

Tool design is the most influential aspect in the friction stir welding (FSW) technology. Influence of pin tool geometry on material flow pattern are studied in this work during the FSW of dissimilar AA7075 and AA6061 aluminium alloys. Three truncated pin tool profiles (threaded, threaded with single flat, and unthreaded with single flat) were used to prepare the weldments. The workpieces were joined using a custom-made clamping system under 1100 rpm of spindle speed, 300 mm/min of traverse rate and 3° of tilt angle. The metallographic analysis showed that defect-free welds can be produced using the three pin tools with significant changes in the mixing stir zone structure. The results declared that the introducing of the flat on the cone of the probe deviates the pattern of the onion rings without changing the chemical composition of the created layers. This in turn improves the hardness distribution and tensile strength of the welded joint. It was also noted that both heat affected zone (HAZ) and thermal-mechanical affected zone (TMAZ) are similar in composition to their corresponding base materials (BM).

NCBI nr-aa BLAST: CBRC-DYAK-08-0043 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-08-0043 ref|YP_026048.1| NADH dehydrogenase subunit 4 [Speleonectes tulum...ensis] gb|AAS00889.1| NADH dehydrogenase subunit 4 [Speleonectes tulumensis] YP_026048.1 0.41 37% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-2150 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2150 ref|YP_073317.1| NADH dehydrogenase subunit 6 [Neomaskellia andro...pogonis] gb|AAS75443.1| NADH dehydrogenase subunit 6 [Neomaskellia andropogonis] YP_073317.1 0.86 27% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-1417 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-1417 ref|YP_073322.1| NADH dehydrogenase subunit 2 [Neomaskellia andro...pogonis] gb|AAS75448.1| NADH dehydrogenase subunit 2 [Neomaskellia andropogonis] YP_073322.1 0.025 25% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-1447 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-1447 ref|YP_026033.1| NADH dehydrogenase subunit 3 [Hutchinsoniella ma...cracantha] gb|AAS00874.1| NADH dehydrogenase subunit 3 [Hutchinsoniella macracantha] YP_026033.1 0.92 36% ...

Impact of as-cast structure on structure and properties of twin-roll cast AA8006 alloy

Energy Technology Data Exchange (ETDEWEB)

Slamova, M.; Ocenasek, V. [Vyzkumny Ustav Kovu, Panenske Brezany (Czechoslovakia); Juricek, Z.

2000-07-01

Sheet production by twin-roll casting (TRC) process is a well established practice in the aluminium industry because it offers several advantages in comparison with DC casting and hot rolling, esp. lower production and investment costs. Thin strips exhibiting a combination of good strength and high ductility are required for various applications and for this reason alloys with higher Fe and Mn content such as AA 8006 displace AA 1xxx or AA 8011 alloys. However, TRC of AA 8006 strips involves several problems, e.g. casting conditions and subsequent treatment procedures need fine tuning. The results of an investigation of the effect of casting conditions on structure and properties of AA 8006 strips are presented. The influence of casting speed, grain refiner addition, molten metal level in the tundish, tip setback and roll separating force was investigated. The impact of imperfect as-cast structure on structure and properties of thin strips in H22 and O tempers was evaluated and compared with strips from good as-cast material. (orig.)

Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin.

Science.gov (United States)

Oppert, Brenda; Dowd, Scot E; Bouffard, Pascal; Li, Lewyn; Conesa, Ana; Lorenzen, Marcé D; Toutges, Michelle; Marshall, Jeremy; Huestis, Diana L; Fabrick, Jeff; Oppert, Cris; Jurat-Fuentes, Juan Luis

2012-01-01

Bacillus thuringiensis (Bt) crystal (Cry) proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence dataset for T. molitor

Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin.

Directory of Open Access Journals (Sweden)

Brenda Oppert

Full Text Available Bacillus thuringiensis (Bt crystal (Cry proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence

ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available GTGMKSFLEKLDEATKEFETQYKKWINDRREAIKKQRENEKLQKWNEISNIFKSDGVELNRDAQTPCIPEHLVEGFEESNESEDLSEIDQIEQVMLNPKGRLNFV* ... ch_oct10_gene_aa_db Chro.50191 >Chro.50191 hypothetical protein MSNSFLRDLKFVGVSSFL

NCBI nr-aa BLAST: CBRC-TTRU-01-0857 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0857 ref|YP_073322.1| NADH dehydrogenase subunit 2 [Neomaskellia andro...pogonis] gb|AAS75448.1| NADH dehydrogenase subunit 2 [Neomaskellia andropogonis] YP_073322.1 5e-04 23% ...

Trust Building Recruitment Strategies for Researchers Conducting Studies in African American (AA) Churches: Lessons Learned.

Science.gov (United States)

Bonner, Gloria; Williams, Sharon; Wilkie, Diana; Hart, Alysha; Burnett, Glenda; Peacock, Geraldine

2017-12-01

An initial and vital important step in recruiting participants for church-based hospice and palliative care research is the establishment of trust and credibility within the church community. Mistrust of medical research is an extremely important barrier hindering recruitment in African American (AA) communities. A church-based EOL dementia education project is currently being conducted at four large urban AA churches. Church leaders voiced mistrust concerns of previous researchers who conducted investigations in their faith-based institutions. We explored strategies to ameliorate the mistrust concerns. Specific aim: To identify trust-rebuilding elements for researchers following others who violated trust of AA church leaders. Face-to-face, in-depth interviews were conducted from a convenient sample of four established AA church leaders. Interviews were held in the informants' churches to promote candor and comfort in revealing sensitive information about trust /mistrust. Content analysis framework was used to analyze the data. Elements identified from the analysis were then used to create themes. Multidimensional overarching themes emerged from the analysis included: Experience with researchers (positive and extremely negative), violation of trust and trust building strategies. Findings suggest that researchers who wish to conduct successful studies in the AA religious institutions must implement trust rebuilding strategies that include mutual respect, collaboration and partnership building. If general moral practices continue to be violated, threat to future hospice and palliative care research within the institutions may prevail. Thus, potential benefits are thwarted for the church members, AA community, and advancement of EOL care scholarship.

Hot Deformation Behavior of Hot-Extruded AA7175 Through Hot Torsion Tests.

Science.gov (United States)

Lee, Se-Yeon; Jung, Taek-Kyun; Son, Hyeon-Woo; Kim, Sang-Wook; Son, Kwang-Tae; Choi, Ho-Joon; Oh, Sang-Ho; Lee, Ji-Woon; Hyun, Soong-Keun

2018-03-01

The hot deformation behavior of hot-extruded AA7175 was investigated with flow curves and processing maps through hot torsion tests. The flow curves and the deformed microstructures revealed that dynamic recrystallization (DRX) occurred in the hot-extruded AA7175 during hot working. The failure strain was highest at medium temperature. This was mainly influenced by the dynamic precipitation of fine rod-shaped MgZn2. The processing map determined the optimal deformation condition for the alloy during hot working.

Timing system for multi-bunch/multi-train operation at ATF

International Nuclear Information System (INIS)

Naito, T.; Hayano, H.; Urakawa, J.; Imai, T.

2000-01-01

A timing system has been constructed for multi-bunch/multi-train operation at KEK-ATF. The linac accelerates 20 bunches of multi-bunch with 2.8 ns spacing. The Damping Ring stores up to 5 trains of multi-bunch. The timing system is required to provide flexible operation mode and bucket selection. A personal computer is used for manipulating the timing. The performance of kicker magnets at the injection/extruction is key issue for multi-train operation. The hardware and the test results are presented. (author)

Making ET AAS Determination Less Dependent on Vapourization ...

African Journals Online (AJOL)

NICO

The quantification of the analytes in ET AAS is normally attained by the measurement and integration of transient absorbance. High degree of atomization and constant vapour transportation rate for the analyte atoms in the absorption volume are considered to be crucial to grant correctness of the measurements. However ...

Overall view of the AA hall dominated by the 50 ton crane (Donges).

CERN Multimedia

1980-01-01

A 50 ton, 32 metre span overhead travelling cranre was mounted in one of the bays of Hall 193 (AA). An identical crane was mounted on the other bay. See also photo 8004261. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

NCBI nr-aa BLAST: CBRC-XTRO-01-3068 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3068 ref|NP_960250.1| AppC [Mycobacterium avium subsp. paratuberculosis... K-10] gb|AAS03633.1| AppC [Mycobacterium avium subsp. paratuberculosis K-10] NP_960250.1 2.1 28% ...

AAS 227: Day 3

Science.gov (United States)

Kohler, Susanna

2016-01-01

Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over

Pengaruh Rapat Arus Anodizing terhadap Nilai Kekerasan pada Plat Aluminium Paduan Aa Seri 2024-t3

OpenAIRE

Fajar Nugroho

2015-01-01

Aluminum alloy AA 2024-T3 is widely applied in the aircraft industry because it has good mechanical properties such as; light weight, good conductivity and the corrosion resistance. However Aluminium 2024-T3 susceptible to wearing. One method to improve the wear resistance o f AA 2024-T3 is the anodizing process. The aims of this research to study the effect of current density and anodizing time against the hardness of aluminum alloy AA 2024-T3. The process of anodizing was carried out using ...

NCBI nr-aa BLAST: CBRC-CREM-01-1284 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CREM-01-1284 ref|NP_962383.1| SugI [Mycobacterium avium subsp. paratuberculosis... K-10] gb|AAS05999.1| SugI [Mycobacterium avium subsp. paratuberculosis K-10] NP_962383.1 2e-85 55% ...

NCBI nr-aa BLAST: CBRC-FCAT-01-0804 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0804 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.8 24% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-1349 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-1349 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.8 25% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-2699 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2699 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 0.055 30% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0782 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.9 26% ...

Analysis of RHIC beam dump pre-fires

International Nuclear Information System (INIS)

Zhang, W.; Ahrens, L.; Fischer, W.; Hahn, H.; Mi, J.; Sandberg, J.; Tan, Y.

2011-01-01

It has been speculated that the beam may cause instability of the RHIC Beam Abort Kickers. In this study, we explore the available data of past beam operations, the device history of key modulator components, and the radiation patterns to examine the correlations. The RHIC beam abort kicker system was designed and built in the 90's. Over last decade, we have made many improvements to bring the RHIC beam abort kicker system to a stable operational state. However, the challenge continues. We present the analysis of the pre-fire, an unrequested discharge of kicker, issues which relates to the RHIC machine safety and operational stability.

NCBI nr-aa BLAST: CBRC-MDOM-04-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0135 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 3e-04 28% ...

AA, inner conductor of a magnetic horn

CERN Multimedia

CERN PhotoLab

1981-01-01

At the start-up of the AA and during its initial operation, magnetic horns focused the antiprotons emanating from the production target. These "current-sheet lenses" had a thin inner conductor (for minimum absorption of antiprotons), machined from aluminium to wall thicknesses of 0.7 or 1 mm. The half-sine pulses rose to 150 kA in 8 microsec. The angular acceptance was 50 mrad.

Valsartan reduces AT1-AA-induced apoptosis through suppression oxidative stress mediated ER stress in endothelial progenitor cells.

Science.gov (United States)

Wang, Z-C; Qi, J; Liu, L-M; Li, J; Xu, H-Y; Liang, B; Li, B

2017-03-01

Valsartan has been reported to have the function of treating hypertension and improving the prognosis of patients. Many studies indicated that valsartan can also increase angiotensin II, andosterone and plasma renin activity (PRA). Autoantibodies against the angiotensin II type 1 receptor (AT1-AA) have been showed to increase reactive oxygen species (ROS) and calcium (Ca2+) and result in apoptosis in vascular smooth muscle cells. In this study, we attempted to explore the effect of valsartan on AT1-AA-induced apoptosis in endothelial progenitor cells. Endothelial progenitor cells (EPCs) were cultured. The cytotoxicity was determined by MTT assay. EPCs apoptosis was determined by DAPI staining and flow cytometry. Reactive oxygen species, intracellular calcium concentration and calpain activity were measured using Fluostar Omega Spectrofluorimeter. The expression of p-ERK, p-eIF-2a, CHOP, Bcl-2 and caspase-3 were detected by Western blot. MTT assays showed valsartan significantly inhibited AT1-AA- induced decline of the viability of EPCs. DAPI staining and flow cytometry results indicated valsartan inhibited AT1-AA-induced decline of the viability of EPCs via inhibiting AT1-AA-induced apoptosis. Furthermore, the increasing of reactive oxygen species, intracellular calcium and calpain activity induced by AT1-AA in EPCs were also recovered after pre-treated with valsartan. Meanwhile, the upregulation of p-ERK, p-eIF-2a and CHOP, downregulation of Bcl-2, and activation of Caspase-3 caused by AT1-AA were reversed after pre-incubated with valsartan. Valsartan could inhibit AT1-AA-induced apoptosis through inhibiting oxidative stress mediated ER stress in EPCs.

Molecular cloning and expression analysis of the aqp1aa gene in half-smooth tongue sole (Cynoglossus semilaevis.

Directory of Open Access Journals (Sweden)

Hua Guo

Full Text Available Aquaporin 1 (AQP1 is a member of the transmembrane water channel family of proteins with special structural features, and two AQP1 paralogous genes (aqp1aa and aqp1ab are reported in teleosts. In the present study, the aqp1aa gene of half-smooth tongue sole (Cynoglossus semilaevis was cloned and characterized. The full-length cDNA of aqp1aa is 1411 bp with a 786 bp open reading frame encoding a 261-amino acid putative protein with a characteristic structure consisting of 6 membrane-spanning α-helical domains and two highly conserved asparagine-proline-alanine motifs. Real-time quantitative PCR revealed that aqp1aa mRNA is expressed predominantly in the testis of males and pseudo-males, while its expression is low in the ovary and lowest in doublesex and mab-3-related transcription factor 1(DMRT1 knock out fish and triploid males. In situ hybridization indicated that aqp1aa mRNA is expressed mainly in the germ cells of males and pseudo-males, especially in spermatozoa and spermatids. These results suggest that the aqp1aa may play a role in spermatogenesis of C. semilaevis.

Etanercept In the treatment of AA-amyloidosis in juvenile rheumatoid arthritis

Directory of Open Access Journals (Sweden)

H Mihels

2004-01-01

Full Text Available Objective. To study effect of etanercept, an antagonist of serum A amyloid production in the AA amyloidosis treatment in juvenile idiopathic arthritis (JIA. Material and methods. Etanercept was administered to all pts with AA amyloidosis admitted to Garmisch-Paterkirchen pediatric rheumatological clinic beginning with 2000. C-reactive protein (CRP, degree of proteinuria and serum creatinin were used as preliminary outcome measures. Results. 11 pts with seronegative JIA (6 boys and 5 girls were included in the study. Mean follow up duration was l,9±l.01 years. 8 children had systemic, 2 - olygoarticular and one - polyarticular disease onset. Before the study all pts had CRP level elevation (1,03-8,29 mg/dl, mean 4,53 mg/dl. 8 from 11 had marked proteinuria (364-7400 mg/24 hours, mean 1186 mg/24 hours. 2 from 11 had serum creatinin elevation. During etanercept treatment CRP level normalized in 2 and significantly decreased in 4 pts. Proteinuria decreased in 4 from 8 pts. Significant change of creatinin level was not achieved. One girl who did not have improvement during etanercept treatment showed CRP normalization and decrease of proteinuria when the drug was changed to infliximab. Conclusion. Treatment with etanercept provided improvement in almost 2/3 from 11 pts with JIA and AA amyloidosis. Etanercept may be the drug of choice in pts with normal creatinine level in the absence of proteinuria. When it fails another tumor necrosis factor antagonist such as infliximab should be used. It is necessary to extend volume and duration of the study to get more reliable data on etanercept efficacy in JIA pts with AA amyloidosis.

Noise-immune cavity-enhanced analytical atomic spectrometry — NICE-AAS — A technique for detection of elements down to zeptogram amounts

International Nuclear Information System (INIS)

Axner, Ove; Ehlers, Patrick; Hausmaninger, Thomas; Silander, Isak; Ma, Weiguang

2014-01-01

Noise-immune cavity-enhanced optical heterodyne molecular spectroscopy (NICE-OHMS) is a powerful technique for detection of molecular compounds in gas phase that is based on a combination of two important concepts: frequency modulation spectroscopy (FMS) for reduction of noise, and cavity enhancement, for prolongation of the interaction length between the light and the sample. Due to its unique properties, it has demonstrated unparalleled detection sensitivity when it comes to detection of molecular constituents in the gas phase. However, despite these, it has so far not been used for detection of atoms, i.e. for elemental analysis. The present work presents an assessment of the expected performance of Doppler-broadened (Db) NICE-OHMS for analytical atomic spectrometry, then referred to as noise-immune cavity-enhanced analytical atomic spectrometry (NICE-AAS). After a description of the basic principles of Db-NICE-OHMS, the modulation and detection conditions for optimum performance are identified. Based on a previous demonstrated detection sensitivity of Db-NICE-OHMS of 5 × 10 −12 cm −1 Hz −1∕2 (corresponding to a single-pass absorbance of 7 × 10 −11 over 10 s), the expected limits of detection (LODs) of Hg and Na by NICE-AAS are estimated. Hg is assumed to be detected in gas phase directly while Na is considered to be atomized in a graphite furnace (GF) prior to detection. It is shown that in the absence of spectral interferences, contaminated sample compartments, and optical saturation, it should be feasible to detect Hg down to 10 zg/cm 3 (10 fg/m 3 or 10 −5 ng/m 3 ), which corresponds to 25 atoms/cm 3 , and Na down to 0.5 zg (zg = zeptogram = 10 −21 g), representing 50 zg/mL (parts-per-sextillion, pps, 1:10 21 ) in liquid solution (assuming a sample of 10 μL) or solely 15 atoms injected into the GF, respectively. These LODs are several orders of magnitude lower (better) than any previous laser-based absorption technique previously demonstrated

Binding specificity of Bacillus thuringiensis Cry1Aa for purified, native Bombyx mori aminopeptidase N and cadherin-like receptors

Directory of Open Access Journals (Sweden)

Jenkins Jeremy L

2001-10-01

Full Text Available Abstract Background To better understand the molecular interactions of Bt toxins with non-target insects, we have examined the real-time binding specificity and affinity of Cry1 toxins to native silkworm (Bombyx mori midgut receptors. Previous studies on B. mori receptors utilized brush border membrane vesicles or purifed receptors in blot-type assays. Results The Bombyx mori (silkworm aminopeptidase N (APN and cadherin-like receptors for Bacillus thuringiensis insecticidal Cry1Aa toxin were purified and their real-time binding affinities for Cry toxins were examined by surface plasmon resonance. Cry1Ab and Cry1Ac toxins did not bind to the immobilized native receptors, correlating with their low toxicities. Cry1Aa displayed moderate affinity for B. mori APN (75 nM, and unusually tight binding to the cadherin-like receptor (2.6 nM, which results from slow dissociation rates. The binding of a hybrid toxin (Aa/Aa/Ac was identical to Cry1Aa. Conclusions These results indicate domain II of Cry1Aa is essential for binding to native B. mori receptors and for toxicity. Moreover, the high-affinity binding of Cry1Aa to native cadherin-like receptor emphasizes the importance of this receptor class for Bt toxin research.

Binding specificity of Bacillus thuringiensis Cry1Aa for purified, native Bombyx mori aminopeptidase N and cadherin-like receptors

Science.gov (United States)

Jenkins, Jeremy L; Dean, Donald H

2001-01-01

Background To better understand the molecular interactions of Bt toxins with non-target insects, we have examined the real-time binding specificity and affinity of Cry1 toxins to native silkworm (Bombyx mori) midgut receptors. Previous studies on B. mori receptors utilized brush border membrane vesicles or purifed receptors in blot-type assays. Results The Bombyx mori (silkworm) aminopeptidase N (APN) and cadherin-like receptors for Bacillus thuringiensis insecticidal Cry1Aa toxin were purified and their real-time binding affinities for Cry toxins were examined by surface plasmon resonance. Cry1Ab and Cry1Ac toxins did not bind to the immobilized native receptors, correlating with their low toxicities. Cry1Aa displayed moderate affinity for B. mori APN (75 nM), and unusually tight binding to the cadherin-like receptor (2.6 nM), which results from slow dissociation rates. The binding of a hybrid toxin (Aa/Aa/Ac) was identical to Cry1Aa. Conclusions These results indicate domain II of Cry1Aa is essential for binding to native B. mori receptors and for toxicity. Moreover, the high-affinity binding of Cry1Aa to native cadherin-like receptor emphasizes the importance of this receptor class for Bt toxin research. PMID:11722800

Non-injection Drug Use and Injection Initiation Assistance among People Who Inject Drugs in Tijuana, Mexico.

Science.gov (United States)

Ben Hamida, Amen; Rafful, Claudia; Jain, Sonia; Sun, Shelly; Gonzalez-Zuniga, Patricia; Rangel, Gudelia; Strathdee, Steffanie A; Werb, Dan

2018-02-01

Although most people who inject drugs (PWID) report receiving assistance during injection initiation events, little research has focused on risk factors among PWID for providing injection initiation assistance. We therefore sought to determine the influence of non-injection drug use among PWID on their risk to initiate others. We used generalized estimating equation (GEE) models on longitudinal data among a prospective cohort of PWID in Tijuana, Mexico (Proyecto El Cuete IV), while controlling for potential confounders. At baseline, 534 participants provided data on injection initiation assistance. Overall, 14% reported ever initiating others, with 4% reporting this behavior recently (i.e., in the past 6 months). In a multivariable GEE model, recent non-injection drug use was independently associated with providing injection initiation assistance (adjusted odds ratio [AOR] = 2.42, 95% confidence interval [CI] = 1.39-4.20). Further, in subanalyses examining specific drug types, recent non-injection use of cocaine (AOR = 9.31, 95% CI = 3.98-21.78), heroin (AOR = 4.00, 95% CI = 1.88-8.54), and methamphetamine (AOR = 2.03, 95% CI = 1.16-3.55) were all significantly associated with reporting providing injection initiation assistance. Our findings may have important implications for the development of interventional approaches to reduce injection initiation and related harms. Further research is needed to validate findings and inform future approaches to preventing entry into drug injecting.

Injection, injectivity and injectability in geothermal operations: problems and possible solutions. Phase I. Definition of the problems

Energy Technology Data Exchange (ETDEWEB)

Vetter, O.J.; Crichlow, H.B.

1979-02-14

The following topics are covered: thermodynamic instability of brine, injectivity loss during regular production and injection operations, injectivity loss caused by measures other than regular operations, heat mining and associated reservoir problems in reinjection, pressure maintenance through imported make-up water, suggested solutions to injection problems, and suggested solutions to injection problems: remedial and stimulation measures. (MHR)

Variation of amino acid sequences of serum amyloid a (SAA) and immunohistochemical analysis of amyloid a (AA) in Japanese domestic cats.

Science.gov (United States)

Tei, Meina; Uchida, Kazuyuki; Chambers, James K; Watanabe, Ken-Ichi; Tamamoto, Takashi; Ohno, Koichi; Nakayama, Hiroyuki

2018-02-02

Amyloid A (AA) amyloidosis, a fatal systemic amyloid disease, occurs secondary to chronic inflammatory conditions in humans. Although persistently elevated serum amyloid A (SAA) levels are required for its pathogenesis, not all individuals with chronic inflammation necessarily develop AA amyloidosis. Furthermore, many diseases in cats are associated with the elevated production of SAA, whereas only a small number actually develop AA amyloidosis. We hypothesized that a genetic mutation in the SAA gene may strongly contribute to the pathogenesis of feline AA amyloidosis. In the present study, genomic DNA from four Japanese domestic cats (JDCs) with AA amyloidosis and from five without amyloidosis was analyzed using polymerase chain reaction (PCR) amplification and direct sequencing. We identified the novel variation combination of 45R-51A in the deduced amino acid sequences of four JDCs with amyloidosis and five without. However, there was no relationship between amino acid variations and the distribution of AA amyloid deposits, indicating that differences in SAA sequences do not contribute to the pathogenesis of AA amyloidosis. Immunohistochemical analysis using antisera against the three different parts of the feline SAA protein-i.e., the N-terminal, central, and C-terminal regions-revealed that feline AA contained the C-terminus, unlike human AA. These results indicate that the cleavage and degradation of the C-terminus are not essential for amyloid fibril formation in JDCs.

Bt rice expressing Cry2Aa does not harm Cyrtorhinus lividipennis, a main predator of the nontarget herbivore Nilapavarta lugens.

Directory of Open Access Journals (Sweden)

Yu Han

Full Text Available T2A-1 is a newly developed transgenic rice that expresses a synthesized cry2Aa gene driven by the maize ubiquitin promoter. T2A-1 exhibits high resistance against lepidopteran pests of rice. The brown planthopper, Nilapavarta lugens (Stål, is a main nontarget sap-sucking insect pest of rice, and Cyrtorhinus lividipennis (Reuter is the major predator of the eggs and young nymphs of planthoppers. As C. lividipennis may expose to the Cry2Aa protein via N. lugens, it is therefore essential to assess the potential effects of transgenic cry2Aa rice on this predator. In the present study, three experiments were conducted to evaluate the ecological risk of transgenic cry2Aa rice to C. lividipennis: (1 a direct feeding experiment in which C. lividipennis was fed an artificial diet containing Cry2Aa at the dose of 10-time higher than that it may encounter in the realistic field condition; (2 a tritrophic experiment in which the Cry2Aa protein was delivered to C. lividipennis indirectly through prey eggs or nymphs; (3 a realistic field experiment in which the population dynamics of C. lividipennis were investigated using vacuum-suction. Both direct exposure to elevated doses of the Cry2Aa protein and prey-mediated exposure to realistic doses of the protein did not result in significant detrimental effects on the development, survival, female ratio and body weight of C. lividipennis. No significant differences in population density and population dynamics were observed between C. lividipennis in transgenic cry2Aa and nontransgenic rice fields. It may be concluded that transgenic cry2Aa rice had no detrimental effects on C. lividipennis. This study represents the first report of an assessment continuum for the effects of transgenic cry2Aa rice on C. lividipennis.

Lack of evidence for protein AA reactivity in amyloid deposits of lattice corneal dystrophy and amyloid corneal degeneration.

Science.gov (United States)

Gorevic, P D; Rodrigues, M M; Krachmer, J H; Green, C; Fujihara, S; Glenner, G G

1984-08-15

Amyloid fibrils occurring in primary and myeloma-associated (AL), secondary (AA), and certain neuropathic hereditary forms of systemic amyloidosis can be distinguished biochemically or immunohistologically as being composed of immunoglobulin light chain, protein AA, or prealbumin respectively. All types of systemic and several localized forms of amyloidosis contain amyloid P component (protein AP). We studied formalin-fixed tissue from eight cases of lattice corneal dystrophy by the immunoperoxidase method using antisera to proteins AA and AP, to normal serum prealbumin and prealbumin isolated from a case of hereditary amyloidosis, and to light-chain determinants; additional cases were examined by indirect immunofluorescence of fresh-frozen material. We found weak (1:10 dilution) staining with anti-AP, but no reactivity with other antisera. Congo red staining was resistant to pretreatment of sections with potassium permanganate, a characteristic of non-AA amyloid. Two-dimensional gels of solubilized proteins from frozen tissue from two cases of lattice corneal dystrophy resembled those obtained from normal human cornea. Western blots of two cases of polymorphous amyloid degeneration and solubilized protein from normal cornea did not react with radioactive iodine-labeled anti-AA or anti-AP with purified protein AP and unfixed protein AA amyloid tissue as controls. We were unable to corroborate the presence of protein AA in the amyloid deposits of lattice corneal dystrophy. Although staining with antiserum to protein AP was demonstrable, the molecular configuration of this protein in stromal deposits remains to be defined.

The Influences of Artificial Aging Temperature and Time on Pitting Susceptibility of SiCp/ AA2024 MMCs

International Nuclear Information System (INIS)

Kim, S. K.; Jo, C. J.; Kwon, B. H.; Hwang, W. S.

2000-01-01

The effects of artificial aging temperature and time were investigated on the pitting behaviors of SiCp/ AA2024 composites through measuring the changes of open circuit potential, pitting potential, and repassivation potential in a 3.5 wt% NaCl solution. And, the influence of microstructure on the pitting susceptibility was studied by measurement of TEM images. AA2024 Al alloy and 15vol%SiCp/ AA2024 composites were fabricated by vacuum hot pressing and hot extrusion with an extrusion ratio of 25 : 1. They were solutionized at 495 .deg. C for 4 hours, and aged at 130, 150, 170, and 190 .deg. C for 1, 2, 4, 8, and 16 hours. In aerated 3.5% NaCl solutions, the open circuit potential and pitting potential of both AA2024 alloy and composites were similar each other, and pitting occurred immediately at immersed condition. The pitting potential was decreased with increasing aging temperature and time. Also, the repassivation potential of SiCp/ AA2024 composites was decreased as increasing aging temperature and time. It was concluded that formation and growth of S' and S phase by artificial aging promoted the pitting susceptibility of SiCp/ AA2024 composites because these phases, easily soluble by forming galvanic couples with substrate Al alloy, served as preferential sites for nucleation of pits

Cold metal transfer spot plug welding of AA6061-T6-to-galvanized steel for automotive applications

International Nuclear Information System (INIS)

Cao, R.; Huang, Q.; Chen, J.H.; Wang, Pei-Chung

2014-01-01

Highlights: • Two Al-to-galvanized steel spot plug welding joints were studied by CMT method. • The optimum process variables for the two joints were gotten by orthogonal test. • Connection mechanism of the two joints were discussed. -- Abstract: In this study, cold metal transfer (CMT) spot plug joining of 1 mm thick Al AA6061-T6 to 1 mm thick galvanized steel (i.e., Q235) was studied. Welding variables were optimized for a plug weld in the center of a 25 mm overlap region with aluminum 4043 wire and 100% argon shielding gas. Microstructures and elemental distributions were characterized by scanning electron microscopy with energy dispersive X-ray spectrometer. Mechanical testing of CMT spot plug welded joints was conducted. It was found that it is feasible to join Al AA6061T6-to-galvanized steel by CMT spot plug welding method. The process variables for two joints with Al AA6061T6-to-galvanized mild steel and galvanized mild steel-to-Al AA6061T6 are optimized. The strength of CMT spot welded Al AA6061T6-to-galvanized mild steel is determined primarily by the strength and area of the brazed interface. While, the strength of the galvanized mild steel-to-Al AA6061T6 joint is mainly dependent upon the area of the weld metal

Transgenic plants expressing the AaIT/GNA fusion protein show increased resistance and toxicity to both chewing and sucking pests.

Science.gov (United States)

Liu, Shu-Min; Li, Jie; Zhu, Jin-Qi; Wang, Xiao-Wei; Wang, Cheng-Shu; Liu, Shu-Sheng; Chen, Xue-Xin; Li, Sheng

2016-04-01

The adoption of pest-resistant transgenic plants to reduce yield losses and decrease pesticide use has been successful. To achieve the goal of controlling both chewing and sucking pests in a given transgenic plant, we generated transgenic tobacco, Arabidopsis, and rice plants expressing the fusion protein, AaIT/GNA, in which an insecticidal scorpion venom neurotoxin (Androctonus australis toxin, AaIT) is fused to snowdrop lectin (Galanthus nivalis agglutinin, GNA). Compared with transgenic tobacco and Arabidopsis plants expressing AaIT or GNA, transgenic plants expressing AaIT/GNA exhibited increased resistance and toxicity to one chewing pest, the cotton bollworm, Helicoverpa armigera. Transgenic tobacco and rice plants expressing AaIT/GNA showed increased resistance and toxicity to two sucking pests, the whitefly, Bemisia tabaci, and the rice brown planthopper, Nilaparvata lugens, respectively. Moreover, in the field, transgenic rice plants expressing AaIT/GNA exhibited a significant improvement in grain yield when infested with N. lugens. This study shows that expressing the AaIT/GNA fusion protein in transgenic plants can be a useful approach for controlling pests, particularly sucking pests which are not susceptible to the toxin in Bt crops. © 2015 Institute of Zoology, Chinese Academy of Sciences.

A Multi-ringed, Modestly Inclined Protoplanetary Disk around AA Tau

Energy Technology Data Exchange (ETDEWEB)

Loomis, Ryan A.; Öberg, Karin I.; Andrews, Sean M.; MacGregor, Meredith A., E-mail: rloomis@cfa.harvard.edu [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States)

2017-05-01

AA Tau is the archetype for a class of stars with a peculiar periodic photometric variability thought to be related to a warped inner disk structure with a nearly edge-on viewing geometry. We present high resolution (∼0.″2) ALMA observations of the 0.87 and 1.3 mm dust continuum emission from the disk around AA Tau. These data reveal an evenly spaced three-ringed emission structure, with distinct peaks at 0.″34, 0.″66, and 0.″99, all viewed at a modest inclination of 59.°1 ± 0.°3 (decidedly not edge-on). In addition to this ringed substructure, we find non-axisymmetric features, including a “bridge” of emission that connects opposite sides of the innermost ring. We speculate on the nature of this “bridge” in light of accompanying observations of HCO{sup +} and {sup 13}CO ( J = 3–2) line emission. The HCO{sup +} emission is bright interior to the innermost dust ring, with a projected velocity field that appears rotated with respect to the resolved disk geometry, indicating the presence of a warp or inward radial flow. We suggest that the continuum bridge and HCO{sup +} line kinematics could originate from gap-crossing accretion streams, which may be responsible for the long-duration dimming of optical light from AA Tau.

A Multi-ringed, Modestly Inclined Protoplanetary Disk around AA Tau

International Nuclear Information System (INIS)

Loomis, Ryan A.; Öberg, Karin I.; Andrews, Sean M.; MacGregor, Meredith A.

2017-01-01

AA Tau is the archetype for a class of stars with a peculiar periodic photometric variability thought to be related to a warped inner disk structure with a nearly edge-on viewing geometry. We present high resolution (∼0.″2) ALMA observations of the 0.87 and 1.3 mm dust continuum emission from the disk around AA Tau. These data reveal an evenly spaced three-ringed emission structure, with distinct peaks at 0.″34, 0.″66, and 0.″99, all viewed at a modest inclination of 59.°1 ± 0.°3 (decidedly not edge-on). In addition to this ringed substructure, we find non-axisymmetric features, including a “bridge” of emission that connects opposite sides of the innermost ring. We speculate on the nature of this “bridge” in light of accompanying observations of HCO + and 13 CO ( J = 3–2) line emission. The HCO + emission is bright interior to the innermost dust ring, with a projected velocity field that appears rotated with respect to the resolved disk geometry, indicating the presence of a warp or inward radial flow. We suggest that the continuum bridge and HCO + line kinematics could originate from gap-crossing accretion streams, which may be responsible for the long-duration dimming of optical light from AA Tau.